4EA1A

Co-crystal structure of dehydrosqualene synthase (crtm) from s. aureus with sq-109
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
280
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 114
structure length 280
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4ea1A00
5ILZA 2E8UA 3AQBB 3N3DA 5E8HA 5DIQF 3M00A 5AFXA 4RXAA 3Q1OA 5HN9A 5JUZF 2E8WA 5ERMA 4PVYF 3P5RA 4LZCA 4MC8A 3QQVA 2QISA 2Z50A 3ADZA 2E8TA 3WSBA 3CKEA 2AZKA 1YYSA 2FTZA 1WL1A 4EA2A 5B00A 3WCIA 2Z4ZA 4DWGA 4Q23A 3WCHA 3RYWA 3ZMBA 5I1UA 3AQCB 2Q9ZA 4GP1A 4H5EF 3WEFA 3M02A 1VG4A 4OMGA 3TC1A 5A0KA 2E95A 3NF2A 4OGUA 3VJEA 3PKOA 2Z52A 1YQ7A 3SAEA 3CC9A 3ICZA 3P8RA 4F6VA 3KRPB 4E1EA 3WCCA 2ZCSA 3EGTA 5E8LA 3P5PA 2ONGA 4KQUA 3KRPA 3P8LA 4F6XA 5C05A 4NFIF 5JV0F 2Z7IA 4P0WA 4LUUA 2F94F 2F8ZF 3ZL6A 4DHDA 3N46F 1WKZA 1HXAA 2AETA 5ERNA 4LXWA 3G4FA 3CP6A 1YYTA 3DYHA 3PYAA 5B0KA 4KFAA 3EZ3A 4KKMA 5E8KA 5IK9A 1V4EA 5AYPA 3WEJA 1UBWA 5DGMF 1WMWA 3OYRA 4KUXA 4KVIA 3LSNA 4XQSF 3TFNA 3OABA 4LFVF 5B02A 2Q58A 5B0LA 4E9UA 1RQJA 2I19A 1PS1A 1WY0A 3PH7A 3ZCDA 4P0VA 3KRCA 5IMIA 5IN8A 4NFJF 1N21A 2ONHA 5CG5A 1YV5A 3OACB 2OGDA 2PS7A 3WEGA 2Z4XA 3G4DA 4XQRF 3KROA 1V4JA 3N1VF 2E90A 4GA3A 2PS8A 3RMGA 3WJNA 1YHLA 4H5DF 4NFKF 3KRFB 5IKAA 4OMHA 1HXCA 2E92A 4N1ZF 4NKEA 3M9UA 4LFGA 3PDEA 3SDVA 3KRAB 3KB9A 3WCLA 3WJOA 3WJKA 5IL8A 2ZCOA 2E93A 1HM7A 4KVWA 3RBMA 1DGPA 4KVDA 4LPGF 4LTZA 3LDWA 2E8XA 4GP2A 4KK2A 4GAXA 4L2XF 4H5CF 4NKFA 5IMPA 1HM4A 3NPKA 3S4JA 3N45F 4FJQA 3ACWA 4FP4A 1UBYA 5EASA 1RQIA 3VJ8A 1JFGA 3AQ0A 5ILHA 2OA6A 3S9VA 2AELA 1YYUA 5DHIA 3WCBA 4LIXA 2ZCQA 3ICMA 4NUAA 4LLTA 1YYRA 3N3LF 3N49F 4JXYA 2J1PA 1N20A 3WEIA 3VJDA 1WL2A 1V4HA 4P0XA 4LA5A 3RYEA 4KPJA 5DGNF 3KBKA 5JV1F 3N6KF 1YHKA 2ZEUA 3LG5A 3Q2ZA 4RXEA 3UCAA 5DJRF 3LGKA 3TFPA 2AZJA 1FPSA 2F9KF 3ID0A 4JVJF 3V66A 1HXGA 3M01A 2ZY1A 5EROA 4QXSF 3LLWA 4JXNA 5DJPF 3WCEA 3N5JF 5KSXF 3SDQA 1VG6A 3LK5A 3N1WF 1WL3A 5DJVF 1V4KA 4LFEA 1N22A 4KQSA 5B03A 3V1XA 3WC9A 3WCMA 4MC0A 1KIZA 2OPNA 1HX9A 5AHUB 2Z7HA 3PYBA 5B0MA 5ILJA 5IL3A 3OACA 3P41A 3IPIA 1V4IA 3VJBA 5B0JA 4K10A 3SDTA 5ILDA 1VG3A 2P1CA 3NRIA 4RXDA 2F8CF 3SDRA 4EA1A 1RTRA 3ZOUA 4KPDA 3SDUA 4JZBA 3KRFA 5ILIA 2J5CA 1YHMA 5JV2F 3TFVA 3APZA 2DH4A 3TS7A 4DZWA 2E8VA 3LEEA 4OKZA 1N1BA 3KRAA 2OPMA 2Z78A 5A0JA 4LA6A 4RYPA 2Z4VA 2E4OA 3Q30A 2ZCRA 3WCGA 4DWBA 3EFQA 4PVXF 2PS5A 3WEKA 3DYFA 4UMJA 1DI1A 3LVSA 2EWGA 3Q2QA 4XQTF 4DXJA 5IK6A 3VJCA 2O1OA 4WK5A 3N0GA 1UBXA 4KVYA 4DI5A 4JYXA 3ACXA 2Q9YA 4JZXA 4LTVA 2FORA 5JA0F 3BNYA 3MAVA 1N23A 4LZ0A 1YYQA 4HD1A 1VG7A 1UBVA 5DHKA 2Z4YA 3WE9A 1N1ZA 4E9ZA 2H8OA 1EZFA 5IKHA 3ZMCA 3LJIA 5EATA 5DW7A 3WCJA 4F62A 1WL0A 3LOMA 4KQ5A 4EA0A 3ICKA 5ILKA 3ACYA 3VJ9A 4RNQA 3AE0A 3N0FA 4DEMF 2VF6A 4MC3A 1JFAA 5HNAA 3DYGA 4LPHF 3NPRA 4N9UA 4RXCA 5HN7A 3M0GA 2F92F 3WEHA 3IBAA 3B7LA 1KIYA 5DGSF 3OABB 5B01A 5HN8A 2ZEVA 3VJAA 2J1OA 3MZVA 1ZW5A 2RAHA 5EAUA 3W7FA 4LLSA 4LOBA 5IMNA 4OKMA 3ASXA 3V1VA 3BNXA 3LGZB 5IVGA 3KRCB 2Z4WA 4ZQ8A 4KWDA 1VG2A 5H9DA 3WSAA 4QPFA 2E91A 2F7MF 5ER8A 1N24A 3LZ9A 5ILYA 3WCDA 2AEKA 5A0IA 2PS6A 2E94A 4NG6A 3KROB 5CG6A 3N5HF 3WCAA 2F89F 3LMDA 5DZ2A 5B0IA 2AZLA 5AELA 4LZ3A 2Q80A 5IM1A 5IK0A 1YJ4A 3WCFA 3QKCA 3ICNA 2PS4A
chains in the Genus database with same CATH superfamily
5ILZA 2E8UA 3AQBB 3N3DA 5E8HA 5DIQF 3M00A 5AFXA 4RXAA 3Q1OA 5HN9A 5JUZF 2E8WA 5ERMA 4PVYF 3P5RA 4LZCA 4MC8A 3QQVA 2QISA 2Z50A 3ADZA 2E8TA 3WSBA 3CKEA 2AZKA 1YYSA 2FTZA 1WL1A 4EA2A 5B00A 3WCIA 2Z4ZA 4DWGA 4Q23A 3WCHA 3RYWA 3ZMBA 5I1UA 3AQCB 2Q9ZA 4GP1A 4H5EF 3WEFA 3M02A 1VG4A 4OMGA 3TC1A 5A0KA 2E95A 3NF2A 4OGUA 3VJEA 3PKOA 2Z52A 1YQ7A 3SAEA 3CC9A 3ICZA 3P8RA 4F6VA 3KRPB 4E1EA 3WCCA 2ZCSA 3EGTA 5E8LA 3P5PA 2ONGA 4KQUA 3KRPA 3P8LA 4F6XA 5C05A 4NFIF 5JV0F 2Z7IA 4P0WA 4LUUA 2F94F 2F8ZF 3ZL6A 4DHDA 3N46F 1WKZA 1HXAA 2AETA 5ERNA 4LXWA 3G4FA 3CP6A 1YYTA 3DYHA 3PYAA 5B0KA 4KFAA 3EZ3A 4KKMA 5E8KA 5IK9A 1V4EA 5AYPA 3WEJA 1UBWA 5DGMF 1WMWA 3OYRA 4KUXA 4KVIA 3LSNA 4XQSF 3TFNA 3OABA 4LFVF 5B02A 2Q58A 5B0LA 4E9UA 1RQJA 2I19A 1PS1A 1WY0A 3PH7A 3ZCDA 4P0VA 3KRCA 5IMIA 5IN8A 4NFJF 1N21A 2ONHA 5CG5A 1YV5A 3OACB 2OGDA 2PS7A 3WEGA 2Z4XA 3G4DA 4XQRF 3KROA 1V4JA 3N1VF 2E90A 4GA3A 2PS8A 3RMGA 3WJNA 1YHLA 4H5DF 4NFKF 3KRFB 5IKAA 4OMHA 1HXCA 2E92A 4N1ZF 4NKEA 3M9UA 4LFGA 3PDEA 3SDVA 3KRAB 3KB9A 3WCLA 3WJOA 3WJKA 5IL8A 2ZCOA 2E93A 1HM7A 4KVWA 3RBMA 1DGPA 4KVDA 4LPGF 4LTZA 3LDWA 2E8XA 4GP2A 4KK2A 4GAXA 4L2XF 4H5CF 4NKFA 5IMPA 1HM4A 3NPKA 3S4JA 3N45F 4FJQA 3ACWA 4FP4A 1UBYA 5EASA 1RQIA 3VJ8A 1JFGA 3AQ0A 5ILHA 2OA6A 3S9VA 2AELA 1YYUA 5DHIA 3WCBA 4LIXA 2ZCQA 3ICMA 4NUAA 4LLTA 1YYRA 3N3LF 3N49F 4JXYA 2J1PA 1N20A 3WEIA 3VJDA 1WL2A 1V4HA 4P0XA 4LA5A 3RYEA 4KPJA 5DGNF 3KBKA 5JV1F 3N6KF 1YHKA 2ZEUA 3LG5A 3Q2ZA 4RXEA 3UCAA 5DJRF 3LGKA 3TFPA 2AZJA 1FPSA 2F9KF 3ID0A 4JVJF 3V66A 1HXGA 3M01A 2ZY1A 5EROA 4QXSF 3LLWA 4JXNA 5DJPF 3WCEA 3N5JF 5KSXF 3SDQA 1VG6A 3LK5A 3N1WF 1WL3A 5DJVF 1V4KA 4LFEA 1N22A 4KQSA 5B03A 3V1XA 3WC9A 3WCMA 4MC0A 1KIZA 2OPNA 1HX9A 5AHUB 2Z7HA 3PYBA 5B0MA 5ILJA 5IL3A 3OACA 3P41A 3IPIA 1V4IA 3VJBA 5B0JA 4K10A 3SDTA 5ILDA 1VG3A 2P1CA 3NRIA 4RXDA 2F8CF 3SDRA 4EA1A 1RTRA 3ZOUA 4KPDA 3SDUA 4JZBA 3KRFA 5ILIA 2J5CA 1YHMA 5JV2F 3TFVA 3APZA 2DH4A 3TS7A 4DZWA 2E8VA 3LEEA 4OKZA 1N1BA 3KRAA 2OPMA 2Z78A 5A0JA 4LA6A 4RYPA 2Z4VA 2E4OA 3Q30A 2ZCRA 3WCGA 4DWBA 3EFQA 4PVXF 2PS5A 3WEKA 3DYFA 4UMJA 1DI1A 3LVSA 2EWGA 3Q2QA 4XQTF 4DXJA 5IK6A 3VJCA 2O1OA 4WK5A 3N0GA 1UBXA 4KVYA 4DI5A 4JYXA 3ACXA 2Q9YA 4JZXA 4LTVA 2FORA 5JA0F 3BNYA 3MAVA 1N23A 4LZ0A 1YYQA 4HD1A 1VG7A 1UBVA 5DHKA 2Z4YA 3WE9A 1N1ZA 4E9ZA 2H8OA 1EZFA 5IKHA 3ZMCA 3LJIA 5EATA 5DW7A 3WCJA 4F62A 1WL0A 3LOMA 4KQ5A 4EA0A 3ICKA 5ILKA 3ACYA 3VJ9A 4RNQA 3AE0A 3N0FA 4DEMF 2VF6A 4MC3A 1JFAA 5HNAA 3DYGA 4LPHF 3NPRA 4N9UA 4RXCA 5HN7A 3M0GA 2F92F 3WEHA 3IBAA 3B7LA 1KIYA 5DGSF 3OABB 5B01A 5HN8A 2ZEVA 3VJAA 2J1OA 3MZVA 1ZW5A 2RAHA 5EAUA 3W7FA 4LLSA 4LOBA 5IMNA 4OKMA 3ASXA 3V1VA 3BNXA 3LGZB 5IVGA 3KRCB 2Z4WA 4ZQ8A 4KWDA 1VG2A 5H9DA 3WSAA 4QPFA 2E91A 2F7MF 5ER8A 1N24A 3LZ9A 5ILYA 3WCDA 2AEKA 5A0IA 2PS6A 2E94A 4NG6A 3KROB 5CG6A 3N5HF 3WCAA 2F89F 3LMDA 5DZ2A 5B0IA 2AZLA 5AELA 4LZ3A 2Q80A 5IM1A 5IK0A 1YJ4A 3WCFA 3QKCA 3ICNA 2PS4A
chains in the Genus database with same CATH topology
5ILZA 2E8UA 3AQBB 3N3DA 5E8HA 5DIQF 3M00A 5AFXA 4RXAA 3Q1OA 5HN9A 5JUZF 2E8WA 5ERMA 4PVYF 3P5RA 4LZCA 4MC8A 3QQVA 2QISA 2Z50A 3ADZA 2E8TA 3WSBA 3CKEA 2AZKA 1YYSA 2FTZA 1WL1A 4EA2A 5B00A 3WCIA 2Z4ZA 4DWGA 4Q23A 3WCHA 3RYWA 3ZMBA 5I1UA 3AQCB 2Q9ZA 4GP1A 4H5EF 3WEFA 3M02A 1VG4A 4OMGA 3TC1A 5A0KA 2E95A 3NF2A 4OGUA 3VJEA 3PKOA 2Z52A 1YQ7A 3SAEA 3CC9A 3ICZA 3P8RA 4F6VA 3KRPB 4E1EA 3WCCA 2ZCSA 3EGTA 5E8LA 3P5PA 2ONGA 4KQUA 3KRPA 3P8LA 4F6XA 5C05A 4NFIF 5JV0F 2Z7IA 4P0WA 4LUUA 2F94F 2F8ZF 3ZL6A 4DHDA 3N46F 1WKZA 1HXAA 2AETA 5ERNA 4LXWA 3G4FA 3CP6A 1YYTA 3DYHA 3PYAA 5B0KA 4KFAA 3EZ3A 4KKMA 5E8KA 5IK9A 1V4EA 5AYPA 3WEJA 1UBWA 5DGMF 1WMWA 3OYRA 4KUXA 4KVIA 3LSNA 4XQSF 3TFNA 3OABA 4LFVF 5B02A 2Q58A 5B0LA 4E9UA 1RQJA 2I19A 1PS1A 1WY0A 3PH7A 3ZCDA 4P0VA 3KRCA 5IMIA 5IN8A 4NFJF 1N21A 2ONHA 5CG5A 1YV5A 3OACB 2OGDA 2PS7A 3WEGA 2Z4XA 3G4DA 4XQRF 3KROA 1V4JA 3N1VF 2E90A 4GA3A 2PS8A 3RMGA 3WJNA 1YHLA 4H5DF 4NFKF 3KRFB 5IKAA 4OMHA 1HXCA 2E92A 4N1ZF 4NKEA 3M9UA 4LFGA 3PDEA 3SDVA 3KRAB 3KB9A 3WCLA 3WJOA 3WJKA 5IL8A 2ZCOA 2E93A 1HM7A 4KVWA 3RBMA 1DGPA 4KVDA 4LPGF 4LTZA 3LDWA 2E8XA 4GP2A 4KK2A 4GAXA 4L2XF 4H5CF 4NKFA 5IMPA 1HM4A 3NPKA 3S4JA 3N45F 4FJQA 3ACWA 4FP4A 1UBYA 5EASA 1RQIA 3VJ8A 1JFGA 3AQ0A 5ILHA 2OA6A 3S9VA 2AELA 1YYUA 5DHIA 3WCBA 4LIXA 2ZCQA 3ICMA 4NUAA 4LLTA 1YYRA 3N3LF 3N49F 4JXYA 2J1PA 1N20A 3WEIA 3VJDA 1WL2A 1V4HA 4P0XA 4LA5A 3RYEA 4KPJA 5DGNF 3KBKA 5JV1F 3N6KF 1YHKA 2ZEUA 3LG5A 3Q2ZA 4RXEA 3UCAA 5DJRF 3LGKA 3TFPA 2AZJA 1FPSA 2F9KF 3ID0A 4JVJF 3V66A 1HXGA 3M01A 2ZY1A 5EROA 4QXSF 3LLWA 4JXNA 5DJPF 3WCEA 3N5JF 5KSXF 3SDQA 1VG6A 3LK5A 3N1WF 1WL3A 5DJVF 1V4KA 4LFEA 1N22A 4KQSA 5B03A 3V1XA 3WC9A 3WCMA 4MC0A 1KIZA 2OPNA 1HX9A 5AHUB 2Z7HA 3PYBA 5B0MA 5ILJA 5IL3A 3OACA 3P41A 3IPIA 1V4IA 3VJBA 5B0JA 4K10A 3SDTA 5ILDA 1VG3A 2P1CA 3NRIA 4RXDA 2F8CF 3SDRA 4EA1A 1RTRA 3ZOUA 4KPDA 3SDUA 4JZBA 3KRFA 5ILIA 2J5CA 1YHMA 5JV2F 3TFVA 3APZA 2DH4A 3TS7A 4DZWA 2E8VA 3LEEA 4OKZA 1N1BA 3KRAA 2OPMA 2Z78A 5A0JA 4LA6A 4RYPA 2Z4VA 2E4OA 3Q30A 2ZCRA 3WCGA 4DWBA 3EFQA 4PVXF 2PS5A 3WEKA 3DYFA 4UMJA 1DI1A 3LVSA 2EWGA 3Q2QA 4XQTF 4DXJA 5IK6A 3VJCA 2O1OA 4WK5A 3N0GA 1UBXA 4KVYA 4DI5A 4JYXA 3ACXA 2Q9YA 4JZXA 4LTVA 2FORA 5JA0F 3BNYA 3MAVA 1N23A 4LZ0A 1YYQA 4HD1A 1VG7A 1UBVA 5DHKA 2Z4YA 3WE9A 1N1ZA 4E9ZA 2H8OA 1EZFA 5IKHA 3ZMCA 3LJIA 5EATA 5DW7A 3WCJA 4F62A 1WL0A 3LOMA 4KQ5A 4EA0A 3ICKA 5ILKA 3ACYA 3VJ9A 4RNQA 3AE0A 3N0FA 4DEMF 2VF6A 4MC3A 1JFAA 5HNAA 3DYGA 4LPHF 3NPRA 4N9UA 4RXCA 5HN7A 3M0GA 2F92F 3WEHA 3IBAA 3B7LA 1KIYA 5DGSF 3OABB 5B01A 5HN8A 2ZEVA 3VJAA 2J1OA 3MZVA 1ZW5A 2RAHA 5EAUA 3W7FA 4LLSA 4LOBA 5IMNA 4OKMA 3ASXA 3V1VA 3BNXA 3LGZB 5IVGA 3KRCB 2Z4WA 4ZQ8A 4KWDA 1VG2A 5H9DA 3WSAA 4QPFA 2E91A 2F7MF 5ER8A 1N24A 3LZ9A 5ILYA 3WCDA 2AEKA 5A0IA 2PS6A 2E94A 4NG6A 3KROB 5CG6A 3N5HF 3WCAA 2F89F 3LMDA 5DZ2A 5B0IA 2AZLA 5AELA 4LZ3A 2Q80A 5IM1A 5IK0A 1YJ4A 3WCFA 3QKCA 3ICNA 2PS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILZ A;  2E8U A;  3AQB B;  3N3D A;  5E8H A;  5DIQ F;  3M00 A;  5AFX A;  4RXA A;  3Q1O A;  5HN9 A;  5JUZ F;  2E8W A;  5ERM A;  4PVY F;  3P5R A;  4LZC A;  4MC8 A;  3QQV A;  2QIS A;  2Z50 A;  3ADZ A;  2E8T A;  3WSB A;  3CKE A;  2AZK A;  1YYS A;  2FTZ A;  1WL1 A;  4EA2 A;  5B00 A;  3WCI A;  2Z4Z A;  4DWG A;  4Q23 A;  3WCH A;  3RYW A;  3ZMB A;  5I1U A;  3AQC B;  2Q9Z A;  4GP1 A;  4H5E F;  3WEF A;  3M02 A;  1VG4 A;  4OMG A;  3TC1 A;  5A0K A;  2E95 A;  3NF2 A;  4OGU A;  3VJE A;  3PKO A;  2Z52 A;  1YQ7 A;  3SAE A;  3CC9 A;  3ICZ A;  3P8R A;  4F6V A;  3KRP B;  4E1E A;  3WCC A;  2ZCS A;  3EGT A;  5E8L A;  3P5P A;  2ONG A;  4KQU A;  3KRP A;  3P8L A;  4F6X A;  5C05 A;  4NFI F;  5JV0 F;  2Z7I A;  4P0W A;  4LUU A;  2F94 F;  2F8Z F;  3ZL6 A;  4DHD A;  3N46 F;  1WKZ A;  1HXA A;  2AET A;  5ERN A;  4LXW A;  3G4F A;  3CP6 A;  1YYT A;  3DYH A;  3PYA A;  5B0K A;  4KFA A;  3EZ3 A;  4KKM A;  5E8K A;  5IK9 A;  1V4E A;  5AYP A;  3WEJ A;  1UBW A;  5DGM F;  1WMW A;  3OYR A;  4KUX A;  4KVI A;  3LSN A;  4XQS F;  3TFN A;  3OAB A;  4LFV F;  5B02 A;  2Q58 A;  5B0L A;  4E9U A;  1RQJ A;  2I19 A;  1PS1 A;  1WY0 A;  3PH7 A;  3ZCD A;  4P0V A;  3KRC A;  5IMI A;  5IN8 A;  4NFJ F;  1N21 A;  2ONH A;  5CG5 A;  1YV5 A;  3OAC B;  2OGD A;  2PS7 A;  3WEG A;  2Z4X A;  3G4D A;  4XQR F;  3KRO A;  1V4J A;  3N1V F;  2E90 A;  4GA3 A;  2PS8 A;  3RMG A;  3WJN A;  1YHL A;  4H5D F;  4NFK F;  3KRF B;  5IKA A;  4OMH A;  1HXC A;  2E92 A;  4N1Z F;  4NKE A;  3M9U A;  4LFG A;  3PDE A;  3SDV A;  3KRA B;  3KB9 A;  3WCL A;  3WJO A;  3WJK A;  5IL8 A;  2ZCO A;  2E93 A;  1HM7 A;  4KVW A;  3RBM A;  1DGP A;  4KVD A;  4LPG F;  4LTZ A;  3LDW A;  2E8X A;  4GP2 A;  4KK2 A;  4GAX A;  4L2X F;  4H5C F;  4NKF A;  5IMP A;  1HM4 A;  3NPK A;  3S4J A;  3N45 F;  4FJQ A;  3ACW A;  4FP4 A;  1UBY A;  5EAS A;  1RQI A;  3VJ8 A;  1JFG A;  3AQ0 A;  5ILH A;  2OA6 A;  3S9V A;  2AEL A;  1YYU A;  5DHI A;  3WCB A;  4LIX A;  2ZCQ A;  3ICM A;  4NUA A;  4LLT A;  1YYR A;  3N3L F;  3N49 F;  4JXY A;  2J1P A;  1N20 A;  3WEI A;  3VJD A;  1WL2 A;  1V4H A;  4P0X A;  4LA5 A;  3RYE A;  4KPJ A;  5DGN F;  3KBK A;  5JV1 F;  3N6K F;  1YHK A;  2ZEU A;  3LG5 A;  3Q2Z A;  4RXE A;  3UCA A;  5DJR F;  3LGK A;  3TFP A;  2AZJ A;  1FPS A;  2F9K F;  3ID0 A;  4JVJ F;  3V66 A;  1HXG A;  3M01 A;  2ZY1 A;  5ERO A;  4QXS F;  3LLW A;  4JXN A;  5DJP F;  3WCE A;  3N5J F;  5KSX F;  3SDQ A;  1VG6 A;  3LK5 A;  3N1W F;  1WL3 A;  5DJV F;  1V4K A;  4LFE A;  1N22 A;  4KQS A;  5B03 A;  3V1X A;  3WC9 A;  3WCM A;  4MC0 A;  1KIZ A;  2OPN A;  1HX9 A;  5AHU B;  2Z7H A;  3PYB A;  5B0M A;  5ILJ A;  5IL3 A;  3OAC A;  3P41 A;  3IPI A;  1V4I A;  3VJB A;  5B0J A;  4K10 A;  3SDT A;  5ILD A;  1VG3 A;  2P1C A;  3NRI A;  4RXD A;  2F8C F;  3SDR A;  4EA1 A;  1RTR A;  3ZOU A;  4KPD A;  3SDU A;  4JZB A;  3KRF A;  5ILI A;  2J5C A;  1YHM A;  5JV2 F;  3TFV A;  3APZ A;  2DH4 A;  3TS7 A;  4DZW A;  2E8V A;  3LEE A;  4OKZ A;  1N1B A;  3KRA A;  2OPM A;  2Z78 A;  5A0J A;  4LA6 A;  4RYP A;  2Z4V A;  2E4O A;  3Q30 A;  2ZCR A;  3WCG A;  4DWB A;  3EFQ A;  4PVX F;  2PS5 A;  3WEK A;  3DYF A;  4UMJ A;  1DI1 A;  3LVS A;  2EWG A;  3Q2Q A;  4XQT F;  4DXJ A;  5IK6 A;  3VJC A;  2O1O A;  4WK5 A;  3N0G A;  1UBX A;  4KVY A;  4DI5 A;  4JYX A;  3ACX A;  2Q9Y A;  4JZX A;  4LTV A;  2FOR A;  5JA0 F;  3BNY A;  3MAV A;  1N23 A;  4LZ0 A;  1YYQ A;  4HD1 A;  1VG7 A;  1UBV A;  5DHK A;  2Z4Y A;  3WE9 A;  1N1Z A;  4E9Z A;  2H8O A;  1EZF A;  5IKH A;  3ZMC A;  3LJI A;  5EAT A;  5DW7 A;  3WCJ A;  4F62 A;  1WL0 A;  3LOM A;  4KQ5 A;  4EA0 A;  3ICK A;  5ILK A;  3ACY A;  3VJ9 A;  4RNQ A;  3AE0 A;  3N0F A;  4DEM F;  2VF6 A;  4MC3 A;  1JFA A;  5HNA A;  3DYG A;  4LPH F;  3NPR A;  4N9U A;  4RXC A;  5HN7 A;  3M0G A;  2F92 F;  3WEH A;  3IBA A;  3B7L A;  1KIY A;  5DGS F;  3OAB B;  5B01 A;  5HN8 A;  2ZEV A;  3VJA A;  2J1O A;  3MZV A;  1ZW5 A;  2RAH A;  5EAU A;  3W7F A;  4LLS A;  4LOB A;  5IMN A;  4OKM A;  3ASX A;  3V1V A;  3BNX A;  3LGZ B;  5IVG A;  3KRC B;  2Z4W A;  4ZQ8 A;  4KWD A;  1VG2 A;  5H9D A;  3WSA A;  4QPF A;  2E91 A;  2F7M F;  5ER8 A;  1N24 A;  3LZ9 A;  5ILY A;  3WCD A;  2AEK A;  5A0I A;  2PS6 A;  2E94 A;  4NG6 A;  3KRO B;  5CG6 A;  3N5H F;  3WCA A;  2F89 F;  3LMD A;  5DZ2 A;  5B0I A;  2AZL A;  5AEL A;  4LZ3 A;  2Q80 A;  5IM1 A;  5IK0 A;  1YJ4 A;  3WCF A;  3QKC A;  3ICN A;  2PS4 A; 
#chains in the Genus database with same CATH topology
 5ILZ A;  2E8U A;  3AQB B;  3N3D A;  5E8H A;  5DIQ F;  3M00 A;  5AFX A;  4RXA A;  3Q1O A;  5HN9 A;  5JUZ F;  2E8W A;  5ERM A;  4PVY F;  3P5R A;  4LZC A;  4MC8 A;  3QQV A;  2QIS A;  2Z50 A;  3ADZ A;  2E8T A;  3WSB A;  3CKE A;  2AZK A;  1YYS A;  2FTZ A;  1WL1 A;  4EA2 A;  5B00 A;  3WCI A;  2Z4Z A;  4DWG A;  4Q23 A;  3WCH A;  3RYW A;  3ZMB A;  5I1U A;  3AQC B;  2Q9Z A;  4GP1 A;  4H5E F;  3WEF A;  3M02 A;  1VG4 A;  4OMG A;  3TC1 A;  5A0K A;  2E95 A;  3NF2 A;  4OGU A;  3VJE A;  3PKO A;  2Z52 A;  1YQ7 A;  3SAE A;  3CC9 A;  3ICZ A;  3P8R A;  4F6V A;  3KRP B;  4E1E A;  3WCC A;  2ZCS A;  3EGT A;  5E8L A;  3P5P A;  2ONG A;  4KQU A;  3KRP A;  3P8L A;  4F6X A;  5C05 A;  4NFI F;  5JV0 F;  2Z7I A;  4P0W A;  4LUU A;  2F94 F;  2F8Z F;  3ZL6 A;  4DHD A;  3N46 F;  1WKZ A;  1HXA A;  2AET A;  5ERN A;  4LXW A;  3G4F A;  3CP6 A;  1YYT A;  3DYH A;  3PYA A;  5B0K A;  4KFA A;  3EZ3 A;  4KKM A;  5E8K A;  5IK9 A;  1V4E A;  5AYP A;  3WEJ A;  1UBW A;  5DGM F;  1WMW A;  3OYR A;  4KUX A;  4KVI A;  3LSN A;  4XQS F;  3TFN A;  3OAB A;  4LFV F;  5B02 A;  2Q58 A;  5B0L A;  4E9U A;  1RQJ A;  2I19 A;  1PS1 A;  1WY0 A;  3PH7 A;  3ZCD A;  4P0V A;  3KRC A;  5IMI A;  5IN8 A;  4NFJ F;  1N21 A;  2ONH A;  5CG5 A;  1YV5 A;  3OAC B;  2OGD A;  2PS7 A;  3WEG A;  2Z4X A;  3G4D A;  4XQR F;  3KRO A;  1V4J A;  3N1V F;  2E90 A;  4GA3 A;  2PS8 A;  3RMG A;  3WJN A;  1YHL A;  4H5D F;  4NFK F;  3KRF B;  5IKA A;  4OMH A;  1HXC A;  2E92 A;  4N1Z F;  4NKE A;  3M9U A;  4LFG A;  3PDE A;  3SDV A;  3KRA B;  3KB9 A;  3WCL A;  3WJO A;  3WJK A;  5IL8 A;  2ZCO A;  2E93 A;  1HM7 A;  4KVW A;  3RBM A;  1DGP A;  4KVD A;  4LPG F;  4LTZ A;  3LDW A;  2E8X A;  4GP2 A;  4KK2 A;  4GAX A;  4L2X F;  4H5C F;  4NKF A;  5IMP A;  1HM4 A;  3NPK A;  3S4J A;  3N45 F;  4FJQ A;  3ACW A;  4FP4 A;  1UBY A;  5EAS A;  1RQI A;  3VJ8 A;  1JFG A;  3AQ0 A;  5ILH A;  2OA6 A;  3S9V A;  2AEL A;  1YYU A;  5DHI A;  3WCB A;  4LIX A;  2ZCQ A;  3ICM A;  4NUA A;  4LLT A;  1YYR A;  3N3L F;  3N49 F;  4JXY A;  2J1P A;  1N20 A;  3WEI A;  3VJD A;  1WL2 A;  1V4H A;  4P0X A;  4LA5 A;  3RYE A;  4KPJ A;  5DGN F;  3KBK A;  5JV1 F;  3N6K F;  1YHK A;  2ZEU A;  3LG5 A;  3Q2Z A;  4RXE A;  3UCA A;  5DJR F;  3LGK A;  3TFP A;  2AZJ A;  1FPS A;  2F9K F;  3ID0 A;  4JVJ F;  3V66 A;  1HXG A;  3M01 A;  2ZY1 A;  5ERO A;  4QXS F;  3LLW A;  4JXN A;  5DJP F;  3WCE A;  3N5J F;  5KSX F;  3SDQ A;  1VG6 A;  3LK5 A;  3N1W F;  1WL3 A;  5DJV F;  1V4K A;  4LFE A;  1N22 A;  4KQS A;  5B03 A;  3V1X A;  3WC9 A;  3WCM A;  4MC0 A;  1KIZ A;  2OPN A;  1HX9 A;  5AHU B;  2Z7H A;  3PYB A;  5B0M A;  5ILJ A;  5IL3 A;  3OAC A;  3P41 A;  3IPI A;  1V4I A;  3VJB A;  5B0J A;  4K10 A;  3SDT A;  5ILD A;  1VG3 A;  2P1C A;  3NRI A;  4RXD A;  2F8C F;  3SDR A;  4EA1 A;  1RTR A;  3ZOU A;  4KPD A;  3SDU A;  4JZB A;  3KRF A;  5ILI A;  2J5C A;  1YHM A;  5JV2 F;  3TFV A;  3APZ A;  2DH4 A;  3TS7 A;  4DZW A;  2E8V A;  3LEE A;  4OKZ A;  1N1B A;  3KRA A;  2OPM A;  2Z78 A;  5A0J A;  4LA6 A;  4RYP A;  2Z4V A;  2E4O A;  3Q30 A;  2ZCR A;  3WCG A;  4DWB A;  3EFQ A;  4PVX F;  2PS5 A;  3WEK A;  3DYF A;  4UMJ A;  1DI1 A;  3LVS A;  2EWG A;  3Q2Q A;  4XQT F;  4DXJ A;  5IK6 A;  3VJC A;  2O1O A;  4WK5 A;  3N0G A;  1UBX A;  4KVY A;  4DI5 A;  4JYX A;  3ACX A;  2Q9Y A;  4JZX A;  4LTV A;  2FOR A;  5JA0 F;  3BNY A;  3MAV A;  1N23 A;  4LZ0 A;  1YYQ A;  4HD1 A;  1VG7 A;  1UBV A;  5DHK A;  2Z4Y A;  3WE9 A;  1N1Z A;  4E9Z A;  2H8O A;  1EZF A;  5IKH A;  3ZMC A;  3LJI A;  5EAT A;  5DW7 A;  3WCJ A;  4F62 A;  1WL0 A;  3LOM A;  4KQ5 A;  4EA0 A;  3ICK A;  5ILK A;  3ACY A;  3VJ9 A;  4RNQ A;  3AE0 A;  3N0F A;  4DEM F;  2VF6 A;  4MC3 A;  1JFA A;  5HNA A;  3DYG A;  4LPH F;  3NPR A;  4N9U A;  4RXC A;  5HN7 A;  3M0G A;  2F92 F;  3WEH A;  3IBA A;  3B7L A;  1KIY A;  5DGS F;  3OAB B;  5B01 A;  5HN8 A;  2ZEV A;  3VJA A;  2J1O A;  3MZV A;  1ZW5 A;  2RAH A;  5EAU A;  3W7F A;  4LLS A;  4LOB A;  5IMN A;  4OKM A;  3ASX A;  3V1V A;  3BNX A;  3LGZ B;  5IVG A;  3KRC B;  2Z4W A;  4ZQ8 A;  4KWD A;  1VG2 A;  5H9D A;  3WSA A;  4QPF A;  2E91 A;  2F7M F;  5ER8 A;  1N24 A;  3LZ9 A;  5ILY A;  3WCD A;  2AEK A;  5A0I A;  2PS6 A;  2E94 A;  4NG6 A;  3KRO B;  5CG6 A;  3N5H F;  3WCA A;  2F89 F;  3LMD A;  5DZ2 A;  5B0I A;  2AZL A;  5AEL A;  4LZ3 A;  2Q80 A;  5IM1 A;  5IK0 A;  1YJ4 A;  3WCF A;  3QKC A;  3ICN A;  2PS4 A; 
#chains in the Genus database with same CATH homology
 5ILZ A;  2E8U A;  3AQB B;  3N3D A;  5E8H A;  5DIQ F;  3M00 A;  5AFX A;  4RXA A;  3Q1O A;  5HN9 A;  5JUZ F;  2E8W A;  5ERM A;  4PVY F;  3P5R A;  4LZC A;  4MC8 A;  3QQV A;  2QIS A;  2Z50 A;  3ADZ A;  2E8T A;  3WSB A;  3CKE A;  2AZK A;  1YYS A;  2FTZ A;  1WL1 A;  4EA2 A;  5B00 A;  3WCI A;  2Z4Z A;  4DWG A;  4Q23 A;  3WCH A;  3RYW A;  3ZMB A;  5I1U A;  3AQC B;  2Q9Z A;  4GP1 A;  4H5E F;  3WEF A;  3M02 A;  1VG4 A;  4OMG A;  3TC1 A;  5A0K A;  2E95 A;  3NF2 A;  4OGU A;  3VJE A;  3PKO A;  2Z52 A;  1YQ7 A;  3SAE A;  3CC9 A;  3ICZ A;  3P8R A;  4F6V A;  3KRP B;  4E1E A;  3WCC A;  2ZCS A;  3EGT A;  5E8L A;  3P5P A;  2ONG A;  4KQU A;  3KRP A;  3P8L A;  4F6X A;  5C05 A;  4NFI F;  5JV0 F;  2Z7I A;  4P0W A;  4LUU A;  2F94 F;  2F8Z F;  3ZL6 A;  4DHD A;  3N46 F;  1WKZ A;  1HXA A;  2AET A;  5ERN A;  4LXW A;  3G4F A;  3CP6 A;  1YYT A;  3DYH A;  3PYA A;  5B0K A;  4KFA A;  3EZ3 A;  4KKM A;  5E8K A;  5IK9 A;  1V4E A;  5AYP A;  3WEJ A;  1UBW A;  5DGM F;  1WMW A;  3OYR A;  4KUX A;  4KVI A;  3LSN A;  4XQS F;  3TFN A;  3OAB A;  4LFV F;  5B02 A;  2Q58 A;  5B0L A;  4E9U A;  1RQJ A;  2I19 A;  1PS1 A;  1WY0 A;  3PH7 A;  3ZCD A;  4P0V A;  3KRC A;  5IMI A;  5IN8 A;  4NFJ F;  1N21 A;  2ONH A;  5CG5 A;  1YV5 A;  3OAC B;  2OGD A;  2PS7 A;  3WEG A;  2Z4X A;  3G4D A;  4XQR F;  3KRO A;  1V4J A;  3N1V F;  2E90 A;  4GA3 A;  2PS8 A;  3RMG A;  3WJN A;  1YHL A;  4H5D F;  4NFK F;  3KRF B;  5IKA A;  4OMH A;  1HXC A;  2E92 A;  4N1Z F;  4NKE A;  3M9U A;  4LFG A;  3PDE A;  3SDV A;  3KRA B;  3KB9 A;  3WCL A;  3WJO A;  3WJK A;  5IL8 A;  2ZCO A;  2E93 A;  1HM7 A;  4KVW A;  3RBM A;  1DGP A;  4KVD A;  4LPG F;  4LTZ A;  3LDW A;  2E8X A;  4GP2 A;  4KK2 A;  4GAX A;  4L2X F;  4H5C F;  4NKF A;  5IMP A;  1HM4 A;  3NPK A;  3S4J A;  3N45 F;  4FJQ A;  3ACW A;  4FP4 A;  1UBY A;  5EAS A;  1RQI A;  3VJ8 A;  1JFG A;  3AQ0 A;  5ILH A;  2OA6 A;  3S9V A;  2AEL A;  1YYU A;  5DHI A;  3WCB A;  4LIX A;  2ZCQ A;  3ICM A;  4NUA A;  4LLT A;  1YYR A;  3N3L F;  3N49 F;  4JXY A;  2J1P A;  1N20 A;  3WEI A;  3VJD A;  1WL2 A;  1V4H A;  4P0X A;  4LA5 A;  3RYE A;  4KPJ A;  5DGN F;  3KBK A;  5JV1 F;  3N6K F;  1YHK A;  2ZEU A;  3LG5 A;  3Q2Z A;  4RXE A;  3UCA A;  5DJR F;  3LGK A;  3TFP A;  2AZJ A;  1FPS A;  2F9K F;  3ID0 A;  4JVJ F;  3V66 A;  1HXG A;  3M01 A;  2ZY1 A;  5ERO A;  4QXS F;  3LLW A;  4JXN A;  5DJP F;  3WCE A;  3N5J F;  5KSX F;  3SDQ A;  1VG6 A;  3LK5 A;  3N1W F;  1WL3 A;  5DJV F;  1V4K A;  4LFE A;  1N22 A;  4KQS A;  5B03 A;  3V1X A;  3WC9 A;  3WCM A;  4MC0 A;  1KIZ A;  2OPN A;  1HX9 A;  5AHU B;  2Z7H A;  3PYB A;  5B0M A;  5ILJ A;  5IL3 A;  3OAC A;  3P41 A;  3IPI A;  1V4I A;  3VJB A;  5B0J A;  4K10 A;  3SDT A;  5ILD A;  1VG3 A;  2P1C A;  3NRI A;  4RXD A;  2F8C F;  3SDR A;  4EA1 A;  1RTR A;  3ZOU A;  4KPD A;  3SDU A;  4JZB A;  3KRF A;  5ILI A;  2J5C A;  1YHM A;  5JV2 F;  3TFV A;  3APZ A;  2DH4 A;  3TS7 A;  4DZW A;  2E8V A;  3LEE A;  4OKZ A;  1N1B A;  3KRA A;  2OPM A;  2Z78 A;  5A0J A;  4LA6 A;  4RYP A;  2Z4V A;  2E4O A;  3Q30 A;  2ZCR A;  3WCG A;  4DWB A;  3EFQ A;  4PVX F;  2PS5 A;  3WEK A;  3DYF A;  4UMJ A;  1DI1 A;  3LVS A;  2EWG A;  3Q2Q A;  4XQT F;  4DXJ A;  5IK6 A;  3VJC A;  2O1O A;  4WK5 A;  3N0G A;  1UBX A;  4KVY A;  4DI5 A;  4JYX A;  3ACX A;  2Q9Y A;  4JZX A;  4LTV A;  2FOR A;  5JA0 F;  3BNY A;  3MAV A;  1N23 A;  4LZ0 A;  1YYQ A;  4HD1 A;  1VG7 A;  1UBV A;  5DHK A;  2Z4Y A;  3WE9 A;  1N1Z A;  4E9Z A;  2H8O A;  1EZF A;  5IKH A;  3ZMC A;  3LJI A;  5EAT A;  5DW7 A;  3WCJ A;  4F62 A;  1WL0 A;  3LOM A;  4KQ5 A;  4EA0 A;  3ICK A;  5ILK A;  3ACY A;  3VJ9 A;  4RNQ A;  3AE0 A;  3N0F A;  4DEM F;  2VF6 A;  4MC3 A;  1JFA A;  5HNA A;  3DYG A;  4LPH F;  3NPR A;  4N9U A;  4RXC A;  5HN7 A;  3M0G A;  2F92 F;  3WEH A;  3IBA A;  3B7L A;  1KIY A;  5DGS F;  3OAB B;  5B01 A;  5HN8 A;  2ZEV A;  3VJA A;  2J1O A;  3MZV A;  1ZW5 A;  2RAH A;  5EAU A;  3W7F A;  4LLS A;  4LOB A;  5IMN A;  4OKM A;  3ASX A;  3V1V A;  3BNX A;  3LGZ B;  5IVG A;  3KRC B;  2Z4W A;  4ZQ8 A;  4KWD A;  1VG2 A;  5H9D A;  3WSA A;  4QPF A;  2E91 A;  2F7M F;  5ER8 A;  1N24 A;  3LZ9 A;  5ILY A;  3WCD A;  2AEK A;  5A0I A;  2PS6 A;  2E94 A;  4NG6 A;  3KRO B;  5CG6 A;  3N5H F;  3WCA A;  2F89 F;  3LMD A;  5DZ2 A;  5B0I A;  2AZL A;  5AEL A;  4LZ3 A;  2Q80 A;  5IM1 A;  5IK0 A;  1YJ4 A;  3WCF A;  3QKC A;  3ICN A;  2PS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...