4EA2A

Crystal structure of dehydrosqualene synthase (crtm) aureus complexed with sq-109
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
284
structure length
281
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 115
structure length 281
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4ea2A00
3WSAA 2F92F 3LSNA 4LZCA 1WL1A 3LEEA 4P0VA 3G4DA 3M0GA 4KWDA 4QXSF 2ZEVA 3WCMA 3AQ0A 4P0XA 3WEIA 2AEKA 5IVGA 3KRPB 3Q30A 2O1OA 5JV0F 3N49F 3KRPA 3WCFA 1VG6A 2Z4ZA 4OGUA 1YHMA 2AZLA 1N20A 2F94F 4LTZA 2E94A 3TFNA 4H5CF 5IM1A 5H9DA 4GA3A 3B7LA 1WY0A 3EGTA 5HN7A 4F62A 4XQSF 3N0FA 3ICZA 2PS5A 5DW7A 2Z4WA 3NPRA 2E90A 3WC9A 3V66A 3WJNA 2J1PA 4PVXF 3LLWA 4LUUA 5B0JA 5B03A 1YHKA 5ILDA 4LPHF 4LFEA 3TS7A 2F7MF 2F8CF 2E8WA 2Q58A 3M9UA 1EZFA 5EASA 4DXJA 1DI1A 2VF6A 3PKOA 3G4FA 3W7FA 1YYUA 4EA2A 2ZEUA 5EROA 3UCAA 2F9KF 1YHLA 5IN8A 5IMIA 2E8UA 2PS4A 4NUAA 2E95A 4GP1A 3AQBB 5ILIA 4WK5A 3SDUA 1RQIA 3N3DA 1PS1A 4H5DF 2ZCSA 5ERNA 3N6KF 4OKMA 1VG4A 4DHDA 1N21A 3VJBA 2ZCOA 3M01A 3VJCA 3CC9A 1JFGA 2Z7HA 4E9ZA 3ZCDA 3QKCA 4LIXA 3WCDA 1HXCA 4FP4A 4NFJF 4NKFA 3N45F 3TFPA 5DIQF 4PVYF 1V4IA 2J5CA 4KPJA 5AFXA 5B01A 3DYGA 3CKEA 3N3LF 5A0JA 1N22A 3LZ9A 3P5RA 5EAUA 4DI5A 1VG3A 3NPKA 2FORA 3RYEA 1HM4A 1UBYA 4KVDA 4LPGF 3WEKA 3V1VA 5ILZA 3N46F 4KK2A 1KIYA 4JYXA 3NF2A 5EATA 4NFIF 3KRAA 4KFAA 4RXEA 2AELA 4KVIA 3P41A 2FTZA 5AELA 3WCEA 5DHIA 4RXDA 3ADZA 3WCIA 2Z4VA 3LVSA 3N1VF 4N9UA 3ICMA 3LDWA 3ZL6A 5E8HA 2PS8A 3WJOA 5DJRF 2J1OA 4OMHA 4NFKF 4RNQA 3VJ8A 3SDVA 3S4JA 3KRCA 5HN8A 5JV2F 2ONGA 3VJ9A 3RYWA 1YYQA 1WL3A 2AETA 4MC8A 1V4HA 1V4EA 4LA5A 5C05A 3VJAA 5IMNA 3VJDA 3WCGA 5HNAA 1YJ4A 5B0KA 2Z4XA 4UMJA 1DGPA 1N1ZA 3WEGA 4H5EF 4LFVF 4DWGA 2E4OA 4JVJF 4GAXA 5ERMA 2E91A 5DJVF 3APZA 3AQCB 2E8XA 5A0KA 2ZCRA 2ZY1A 4K10A 5CG6A 3LGKA 3P5PA 3KROB 4RXAA 3NRIA 1VG2A 1YV5A 1UBWA 3ICKA 4FJQA 4E1EA 3KROA 4KVWA 1WMWA 1UBXA 5A0IA 1YYSA 1N24A 3PYBA 3OYRA 5B0MA 3ACXA 5ILKA 4JXNA 3DYFA 2Z7IA 4GP2A 3DYHA 5IK6A 3KRFB 5IL3A 3M02A 3KRFA 5DGNF 4DEMF 1KIZA 3KBKA 4ZQ8A 4HD1A 2AZKA 4L2XF 3P8RA 3Q1OA 5DGMF 2E8VA 3LJIA 4LOBA 4EA1A 3TC1A 3WCAA 3IBAA 3WE9A 2Q9ZA 2Q9YA 5HN9A 2PS7A 5B0IA 5JV1F 4KQSA 4OMGA 1JFAA 5ILJA 3PH7A 3N1WF 2E8TA 3KRAB 1UBVA 2I19A 4LZ0A 3WEJA 4RXCA 3LMDA 2F8ZF 3IPIA 4DWBA 3EZ3A 1N1BA 3V1XA 4LXWA 5ER8A 5IMPA 3WCLA 3SAEA 4P0WA 5IKHA 3LGZB 1RQJA 5B02A 3OACB 1HXGA 2DH4A 3OACA 3BNXA 3ZOUA 4RYPA 5IL8A 5JA0F 5CG5A 5IKAA 4MC3A 5DJPF 5JUZF 3KRCB 4KKMA 3RMGA 4XQRF 1WKZA 5DGSF 3LOMA 2EWGA 4JZXA 4DZWA 5IK9A 2AZJA 1N23A 2OA6A 5B00A 1HXAA 1WL2A 3WEHA 2Z50A 1YYTA 5KSXF 1HX9A 4F6XA 3ACYA 2F89F 3Q2QA 2ONHA 2RAHA 4LTVA 4N1ZF 4KVYA 2PS6A 3AE0A 4LLSA 4KUXA 1HM7A 4QPFA 5E8LA 3N5HF 3ZMCA 4LFGA 2Z4YA 3PDEA 3WJKA 3CP6A 4NG6A 3S9VA 1RTRA 3BNYA 2P1CA 4JXYA 3TFVA 1ZW5A 3WCJA 4JZBA 2OPNA 4EA0A 3N0GA 4KQ5A 3PYAA 3N5JF 2OPMA 2H8OA 5B0LA 3WSBA 2Z52A 1WL0A 4LA6A 2QISA 3RBMA 5E8KA 3VJEA 1FPSA 2Z78A 2E92A 3OABB 3ASXA 3OABA 4MC0A 1V4KA 5AHUB 2Q80A 4LZ3A 3SDQA 3WEFA 4F6VA 1YQ7A 5DHKA 3ID0A 3WCHA 5ILHA 4LLTA 5ILYA 3SDTA 5IK0A 3Q2ZA 2E93A 4XQTF 4E9UA 1VG7A 3ACWA 3MAVA 1YYRA 3MZVA 3WCBA 3ICNA 3LG5A 1V4JA 5DZ2A 2OGDA 3M00A 4OKZA 4KQUA 4NKEA 3LK5A 4KPDA 5AYPA 3ZMBA 5I1UA 3WCCA 3QQVA 3SDRA 2ZCQA 4Q23A 3KB9A 3P8LA 3EFQA
chains in the Genus database with same CATH superfamily
3WSAA 2F92F 3LSNA 4LZCA 1WL1A 3LEEA 4P0VA 3G4DA 3M0GA 4KWDA 4QXSF 2ZEVA 3WCMA 3AQ0A 4P0XA 3WEIA 2AEKA 5IVGA 3KRPB 3Q30A 2O1OA 5JV0F 3N49F 3KRPA 3WCFA 1VG6A 2Z4ZA 4OGUA 1YHMA 2AZLA 1N20A 2F94F 4LTZA 2E94A 3TFNA 4H5CF 5IM1A 5H9DA 4GA3A 3B7LA 1WY0A 3EGTA 5HN7A 4F62A 4XQSF 3N0FA 3ICZA 2PS5A 5DW7A 2Z4WA 3NPRA 2E90A 3WC9A 3V66A 3WJNA 2J1PA 4PVXF 3LLWA 4LUUA 5B0JA 5B03A 1YHKA 5ILDA 4LPHF 4LFEA 3TS7A 2F7MF 2F8CF 2E8WA 2Q58A 3M9UA 1EZFA 5EASA 4DXJA 1DI1A 2VF6A 3PKOA 3G4FA 3W7FA 1YYUA 4EA2A 2ZEUA 5EROA 3UCAA 2F9KF 1YHLA 5IN8A 5IMIA 2E8UA 2PS4A 4NUAA 2E95A 4GP1A 3AQBB 5ILIA 4WK5A 3SDUA 1RQIA 3N3DA 1PS1A 4H5DF 2ZCSA 5ERNA 3N6KF 4OKMA 1VG4A 4DHDA 1N21A 3VJBA 2ZCOA 3M01A 3VJCA 3CC9A 1JFGA 2Z7HA 4E9ZA 3ZCDA 3QKCA 4LIXA 3WCDA 1HXCA 4FP4A 4NFJF 4NKFA 3N45F 3TFPA 5DIQF 4PVYF 1V4IA 2J5CA 4KPJA 5AFXA 5B01A 3DYGA 3CKEA 3N3LF 5A0JA 1N22A 3LZ9A 3P5RA 5EAUA 4DI5A 1VG3A 3NPKA 2FORA 3RYEA 1HM4A 1UBYA 4KVDA 4LPGF 3WEKA 3V1VA 5ILZA 3N46F 4KK2A 1KIYA 4JYXA 3NF2A 5EATA 4NFIF 3KRAA 4KFAA 4RXEA 2AELA 4KVIA 3P41A 2FTZA 5AELA 3WCEA 5DHIA 4RXDA 3ADZA 3WCIA 2Z4VA 3LVSA 3N1VF 4N9UA 3ICMA 3LDWA 3ZL6A 5E8HA 2PS8A 3WJOA 5DJRF 2J1OA 4OMHA 4NFKF 4RNQA 3VJ8A 3SDVA 3S4JA 3KRCA 5HN8A 5JV2F 2ONGA 3VJ9A 3RYWA 1YYQA 1WL3A 2AETA 4MC8A 1V4HA 1V4EA 4LA5A 5C05A 3VJAA 5IMNA 3VJDA 3WCGA 5HNAA 1YJ4A 5B0KA 2Z4XA 4UMJA 1DGPA 1N1ZA 3WEGA 4H5EF 4LFVF 4DWGA 2E4OA 4JVJF 4GAXA 5ERMA 2E91A 5DJVF 3APZA 3AQCB 2E8XA 5A0KA 2ZCRA 2ZY1A 4K10A 5CG6A 3LGKA 3P5PA 3KROB 4RXAA 3NRIA 1VG2A 1YV5A 1UBWA 3ICKA 4FJQA 4E1EA 3KROA 4KVWA 1WMWA 1UBXA 5A0IA 1YYSA 1N24A 3PYBA 3OYRA 5B0MA 3ACXA 5ILKA 4JXNA 3DYFA 2Z7IA 4GP2A 3DYHA 5IK6A 3KRFB 5IL3A 3M02A 3KRFA 5DGNF 4DEMF 1KIZA 3KBKA 4ZQ8A 4HD1A 2AZKA 4L2XF 3P8RA 3Q1OA 5DGMF 2E8VA 3LJIA 4LOBA 4EA1A 3TC1A 3WCAA 3IBAA 3WE9A 2Q9ZA 2Q9YA 5HN9A 2PS7A 5B0IA 5JV1F 4KQSA 4OMGA 1JFAA 5ILJA 3PH7A 3N1WF 2E8TA 3KRAB 1UBVA 2I19A 4LZ0A 3WEJA 4RXCA 3LMDA 2F8ZF 3IPIA 4DWBA 3EZ3A 1N1BA 3V1XA 4LXWA 5ER8A 5IMPA 3WCLA 3SAEA 4P0WA 5IKHA 3LGZB 1RQJA 5B02A 3OACB 1HXGA 2DH4A 3OACA 3BNXA 3ZOUA 4RYPA 5IL8A 5JA0F 5CG5A 5IKAA 4MC3A 5DJPF 5JUZF 3KRCB 4KKMA 3RMGA 4XQRF 1WKZA 5DGSF 3LOMA 2EWGA 4JZXA 4DZWA 5IK9A 2AZJA 1N23A 2OA6A 5B00A 1HXAA 1WL2A 3WEHA 2Z50A 1YYTA 5KSXF 1HX9A 4F6XA 3ACYA 2F89F 3Q2QA 2ONHA 2RAHA 4LTVA 4N1ZF 4KVYA 2PS6A 3AE0A 4LLSA 4KUXA 1HM7A 4QPFA 5E8LA 3N5HF 3ZMCA 4LFGA 2Z4YA 3PDEA 3WJKA 3CP6A 4NG6A 3S9VA 1RTRA 3BNYA 2P1CA 4JXYA 3TFVA 1ZW5A 3WCJA 4JZBA 2OPNA 4EA0A 3N0GA 4KQ5A 3PYAA 3N5JF 2OPMA 2H8OA 5B0LA 3WSBA 2Z52A 1WL0A 4LA6A 2QISA 3RBMA 5E8KA 3VJEA 1FPSA 2Z78A 2E92A 3OABB 3ASXA 3OABA 4MC0A 1V4KA 5AHUB 2Q80A 4LZ3A 3SDQA 3WEFA 4F6VA 1YQ7A 5DHKA 3ID0A 3WCHA 5ILHA 4LLTA 5ILYA 3SDTA 5IK0A 3Q2ZA 2E93A 4XQTF 4E9UA 1VG7A 3ACWA 3MAVA 1YYRA 3MZVA 3WCBA 3ICNA 3LG5A 1V4JA 5DZ2A 2OGDA 3M00A 4OKZA 4KQUA 4NKEA 3LK5A 4KPDA 5AYPA 3ZMBA 5I1UA 3WCCA 3QQVA 3SDRA 2ZCQA 4Q23A 3KB9A 3P8LA 3EFQA
chains in the Genus database with same CATH topology
3WSAA 2F92F 3LSNA 4LZCA 1WL1A 3LEEA 4P0VA 3G4DA 3M0GA 4KWDA 4QXSF 2ZEVA 3WCMA 3AQ0A 4P0XA 3WEIA 2AEKA 5IVGA 3KRPB 3Q30A 2O1OA 5JV0F 3N49F 3KRPA 3WCFA 1VG6A 2Z4ZA 4OGUA 1YHMA 2AZLA 1N20A 2F94F 4LTZA 2E94A 3TFNA 4H5CF 5IM1A 5H9DA 4GA3A 3B7LA 1WY0A 3EGTA 5HN7A 4F62A 4XQSF 3N0FA 3ICZA 2PS5A 5DW7A 2Z4WA 3NPRA 2E90A 3WC9A 3V66A 3WJNA 2J1PA 4PVXF 3LLWA 4LUUA 5B0JA 5B03A 1YHKA 5ILDA 4LPHF 4LFEA 3TS7A 2F7MF 2F8CF 2E8WA 2Q58A 3M9UA 1EZFA 5EASA 4DXJA 1DI1A 2VF6A 3PKOA 3G4FA 3W7FA 1YYUA 4EA2A 2ZEUA 5EROA 3UCAA 2F9KF 1YHLA 5IN8A 5IMIA 2E8UA 2PS4A 4NUAA 2E95A 4GP1A 3AQBB 5ILIA 4WK5A 3SDUA 1RQIA 3N3DA 1PS1A 4H5DF 2ZCSA 5ERNA 3N6KF 4OKMA 1VG4A 4DHDA 1N21A 3VJBA 2ZCOA 3M01A 3VJCA 3CC9A 1JFGA 2Z7HA 4E9ZA 3ZCDA 3QKCA 4LIXA 3WCDA 1HXCA 4FP4A 4NFJF 4NKFA 3N45F 3TFPA 5DIQF 4PVYF 1V4IA 2J5CA 4KPJA 5AFXA 5B01A 3DYGA 3CKEA 3N3LF 5A0JA 1N22A 3LZ9A 3P5RA 5EAUA 4DI5A 1VG3A 3NPKA 2FORA 3RYEA 1HM4A 1UBYA 4KVDA 4LPGF 3WEKA 3V1VA 5ILZA 3N46F 4KK2A 1KIYA 4JYXA 3NF2A 5EATA 4NFIF 3KRAA 4KFAA 4RXEA 2AELA 4KVIA 3P41A 2FTZA 5AELA 3WCEA 5DHIA 4RXDA 3ADZA 3WCIA 2Z4VA 3LVSA 3N1VF 4N9UA 3ICMA 3LDWA 3ZL6A 5E8HA 2PS8A 3WJOA 5DJRF 2J1OA 4OMHA 4NFKF 4RNQA 3VJ8A 3SDVA 3S4JA 3KRCA 5HN8A 5JV2F 2ONGA 3VJ9A 3RYWA 1YYQA 1WL3A 2AETA 4MC8A 1V4HA 1V4EA 4LA5A 5C05A 3VJAA 5IMNA 3VJDA 3WCGA 5HNAA 1YJ4A 5B0KA 2Z4XA 4UMJA 1DGPA 1N1ZA 3WEGA 4H5EF 4LFVF 4DWGA 2E4OA 4JVJF 4GAXA 5ERMA 2E91A 5DJVF 3APZA 3AQCB 2E8XA 5A0KA 2ZCRA 2ZY1A 4K10A 5CG6A 3LGKA 3P5PA 3KROB 4RXAA 3NRIA 1VG2A 1YV5A 1UBWA 3ICKA 4FJQA 4E1EA 3KROA 4KVWA 1WMWA 1UBXA 5A0IA 1YYSA 1N24A 3PYBA 3OYRA 5B0MA 3ACXA 5ILKA 4JXNA 3DYFA 2Z7IA 4GP2A 3DYHA 5IK6A 3KRFB 5IL3A 3M02A 3KRFA 5DGNF 4DEMF 1KIZA 3KBKA 4ZQ8A 4HD1A 2AZKA 4L2XF 3P8RA 3Q1OA 5DGMF 2E8VA 3LJIA 4LOBA 4EA1A 3TC1A 3WCAA 3IBAA 3WE9A 2Q9ZA 2Q9YA 5HN9A 2PS7A 5B0IA 5JV1F 4KQSA 4OMGA 1JFAA 5ILJA 3PH7A 3N1WF 2E8TA 3KRAB 1UBVA 2I19A 4LZ0A 3WEJA 4RXCA 3LMDA 2F8ZF 3IPIA 4DWBA 3EZ3A 1N1BA 3V1XA 4LXWA 5ER8A 5IMPA 3WCLA 3SAEA 4P0WA 5IKHA 3LGZB 1RQJA 5B02A 3OACB 1HXGA 2DH4A 3OACA 3BNXA 3ZOUA 4RYPA 5IL8A 5JA0F 5CG5A 5IKAA 4MC3A 5DJPF 5JUZF 3KRCB 4KKMA 3RMGA 4XQRF 1WKZA 5DGSF 3LOMA 2EWGA 4JZXA 4DZWA 5IK9A 2AZJA 1N23A 2OA6A 5B00A 1HXAA 1WL2A 3WEHA 2Z50A 1YYTA 5KSXF 1HX9A 4F6XA 3ACYA 2F89F 3Q2QA 2ONHA 2RAHA 4LTVA 4N1ZF 4KVYA 2PS6A 3AE0A 4LLSA 4KUXA 1HM7A 4QPFA 5E8LA 3N5HF 3ZMCA 4LFGA 2Z4YA 3PDEA 3WJKA 3CP6A 4NG6A 3S9VA 1RTRA 3BNYA 2P1CA 4JXYA 3TFVA 1ZW5A 3WCJA 4JZBA 2OPNA 4EA0A 3N0GA 4KQ5A 3PYAA 3N5JF 2OPMA 2H8OA 5B0LA 3WSBA 2Z52A 1WL0A 4LA6A 2QISA 3RBMA 5E8KA 3VJEA 1FPSA 2Z78A 2E92A 3OABB 3ASXA 3OABA 4MC0A 1V4KA 5AHUB 2Q80A 4LZ3A 3SDQA 3WEFA 4F6VA 1YQ7A 5DHKA 3ID0A 3WCHA 5ILHA 4LLTA 5ILYA 3SDTA 5IK0A 3Q2ZA 2E93A 4XQTF 4E9UA 1VG7A 3ACWA 3MAVA 1YYRA 3MZVA 3WCBA 3ICNA 3LG5A 1V4JA 5DZ2A 2OGDA 3M00A 4OKZA 4KQUA 4NKEA 3LK5A 4KPDA 5AYPA 3ZMBA 5I1UA 3WCCA 3QQVA 3SDRA 2ZCQA 4Q23A 3KB9A 3P8LA 3EFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WSA A;  2F92 F;  3LSN A;  4LZC A;  1WL1 A;  3LEE A;  4P0V A;  3G4D A;  3M0G A;  4KWD A;  4QXS F;  2ZEV A;  3WCM A;  3AQ0 A;  4P0X A;  3WEI A;  2AEK A;  5IVG A;  3KRP B;  3Q30 A;  2O1O A;  5JV0 F;  3N49 F;  3KRP A;  3WCF A;  1VG6 A;  2Z4Z A;  4OGU A;  1YHM A;  2AZL A;  1N20 A;  2F94 F;  4LTZ A;  2E94 A;  3TFN A;  4H5C F;  5IM1 A;  5H9D A;  4GA3 A;  3B7L A;  1WY0 A;  3EGT A;  5HN7 A;  4F62 A;  4XQS F;  3N0F A;  3ICZ A;  2PS5 A;  5DW7 A;  2Z4W A;  3NPR A;  2E90 A;  3WC9 A;  3V66 A;  3WJN A;  2J1P A;  4PVX F;  3LLW A;  4LUU A;  5B0J A;  5B03 A;  1YHK A;  5ILD A;  4LPH F;  4LFE A;  3TS7 A;  2F7M F;  2F8C F;  2E8W A;  2Q58 A;  3M9U A;  1EZF A;  5EAS A;  4DXJ A;  1DI1 A;  2VF6 A;  3PKO A;  3G4F A;  3W7F A;  1YYU A;  4EA2 A;  2ZEU A;  5ERO A;  3UCA A;  2F9K F;  1YHL A;  5IN8 A;  5IMI A;  2E8U A;  2PS4 A;  4NUA A;  2E95 A;  4GP1 A;  3AQB B;  5ILI A;  4WK5 A;  3SDU A;  1RQI A;  3N3D A;  1PS1 A;  4H5D F;  2ZCS A;  5ERN A;  3N6K F;  4OKM A;  1VG4 A;  4DHD A;  1N21 A;  3VJB A;  2ZCO A;  3M01 A;  3VJC A;  3CC9 A;  1JFG A;  2Z7H A;  4E9Z A;  3ZCD A;  3QKC A;  4LIX A;  3WCD A;  1HXC A;  4FP4 A;  4NFJ F;  4NKF A;  3N45 F;  3TFP A;  5DIQ F;  4PVY F;  1V4I A;  2J5C A;  4KPJ A;  5AFX A;  5B01 A;  3DYG A;  3CKE A;  3N3L F;  5A0J A;  1N22 A;  3LZ9 A;  3P5R A;  5EAU A;  4DI5 A;  1VG3 A;  3NPK A;  2FOR A;  3RYE A;  1HM4 A;  1UBY A;  4KVD A;  4LPG F;  3WEK A;  3V1V A;  5ILZ A;  3N46 F;  4KK2 A;  1KIY A;  4JYX A;  3NF2 A;  5EAT A;  4NFI F;  3KRA A;  4KFA A;  4RXE A;  2AEL A;  4KVI A;  3P41 A;  2FTZ A;  5AEL A;  3WCE A;  5DHI A;  4RXD A;  3ADZ A;  3WCI A;  2Z4V A;  3LVS A;  3N1V F;  4N9U A;  3ICM A;  3LDW A;  3ZL6 A;  5E8H A;  2PS8 A;  3WJO A;  5DJR F;  2J1O A;  4OMH A;  4NFK F;  4RNQ A;  3VJ8 A;  3SDV A;  3S4J A;  3KRC A;  5HN8 A;  5JV2 F;  2ONG A;  3VJ9 A;  3RYW A;  1YYQ A;  1WL3 A;  2AET A;  4MC8 A;  1V4H A;  1V4E A;  4LA5 A;  5C05 A;  3VJA A;  5IMN A;  3VJD A;  3WCG A;  5HNA A;  1YJ4 A;  5B0K A;  2Z4X A;  4UMJ A;  1DGP A;  1N1Z A;  3WEG A;  4H5E F;  4LFV F;  4DWG A;  2E4O A;  4JVJ F;  4GAX A;  5ERM A;  2E91 A;  5DJV F;  3APZ A;  3AQC B;  2E8X A;  5A0K A;  2ZCR A;  2ZY1 A;  4K10 A;  5CG6 A;  3LGK A;  3P5P A;  3KRO B;  4RXA A;  3NRI A;  1VG2 A;  1YV5 A;  1UBW A;  3ICK A;  4FJQ A;  4E1E A;  3KRO A;  4KVW A;  1WMW A;  1UBX A;  5A0I A;  1YYS A;  1N24 A;  3PYB A;  3OYR A;  5B0M A;  3ACX A;  5ILK A;  4JXN A;  3DYF A;  2Z7I A;  4GP2 A;  3DYH A;  5IK6 A;  3KRF B;  5IL3 A;  3M02 A;  3KRF A;  5DGN F;  4DEM F;  1KIZ A;  3KBK A;  4ZQ8 A;  4HD1 A;  2AZK A;  4L2X F;  3P8R A;  3Q1O A;  5DGM F;  2E8V A;  3LJI A;  4LOB A;  4EA1 A;  3TC1 A;  3WCA A;  3IBA A;  3WE9 A;  2Q9Z A;  2Q9Y A;  5HN9 A;  2PS7 A;  5B0I A;  5JV1 F;  4KQS A;  4OMG A;  1JFA A;  5ILJ A;  3PH7 A;  3N1W F;  2E8T A;  3KRA B;  1UBV A;  2I19 A;  4LZ0 A;  3WEJ A;  4RXC A;  3LMD A;  2F8Z F;  3IPI A;  4DWB A;  3EZ3 A;  1N1B A;  3V1X A;  4LXW A;  5ER8 A;  5IMP A;  3WCL A;  3SAE A;  4P0W A;  5IKH A;  3LGZ B;  1RQJ A;  5B02 A;  3OAC B;  1HXG A;  2DH4 A;  3OAC A;  3BNX A;  3ZOU A;  4RYP A;  5IL8 A;  5JA0 F;  5CG5 A;  5IKA A;  4MC3 A;  5DJP F;  5JUZ F;  3KRC B;  4KKM A;  3RMG A;  4XQR F;  1WKZ A;  5DGS F;  3LOM A;  2EWG A;  4JZX A;  4DZW A;  5IK9 A;  2AZJ A;  1N23 A;  2OA6 A;  5B00 A;  1HXA A;  1WL2 A;  3WEH A;  2Z50 A;  1YYT A;  5KSX F;  1HX9 A;  4F6X A;  3ACY A;  2F89 F;  3Q2Q A;  2ONH A;  2RAH A;  4LTV A;  4N1Z F;  4KVY A;  2PS6 A;  3AE0 A;  4LLS A;  4KUX A;  1HM7 A;  4QPF A;  5E8L A;  3N5H F;  3ZMC A;  4LFG A;  2Z4Y A;  3PDE A;  3WJK A;  3CP6 A;  4NG6 A;  3S9V A;  1RTR A;  3BNY A;  2P1C A;  4JXY A;  3TFV A;  1ZW5 A;  3WCJ A;  4JZB A;  2OPN A;  4EA0 A;  3N0G A;  4KQ5 A;  3PYA A;  3N5J F;  2OPM A;  2H8O A;  5B0L A;  3WSB A;  2Z52 A;  1WL0 A;  4LA6 A;  2QIS A;  3RBM A;  5E8K A;  3VJE A;  1FPS A;  2Z78 A;  2E92 A;  3OAB B;  3ASX A;  3OAB A;  4MC0 A;  1V4K A;  5AHU B;  2Q80 A;  4LZ3 A;  3SDQ A;  3WEF A;  4F6V A;  1YQ7 A;  5DHK A;  3ID0 A;  3WCH A;  5ILH A;  4LLT A;  5ILY A;  3SDT A;  5IK0 A;  3Q2Z A;  2E93 A;  4XQT F;  4E9U A;  1VG7 A;  3ACW A;  3MAV A;  1YYR A;  3MZV A;  3WCB A;  3ICN A;  3LG5 A;  1V4J A;  5DZ2 A;  2OGD A;  3M00 A;  4OKZ A;  4KQU A;  4NKE A;  3LK5 A;  4KPD A;  5AYP A;  3ZMB A;  5I1U A;  3WCC A;  3QQV A;  3SDR A;  2ZCQ A;  4Q23 A;  3KB9 A;  3P8L A;  3EFQ A; 
#chains in the Genus database with same CATH topology
 3WSA A;  2F92 F;  3LSN A;  4LZC A;  1WL1 A;  3LEE A;  4P0V A;  3G4D A;  3M0G A;  4KWD A;  4QXS F;  2ZEV A;  3WCM A;  3AQ0 A;  4P0X A;  3WEI A;  2AEK A;  5IVG A;  3KRP B;  3Q30 A;  2O1O A;  5JV0 F;  3N49 F;  3KRP A;  3WCF A;  1VG6 A;  2Z4Z A;  4OGU A;  1YHM A;  2AZL A;  1N20 A;  2F94 F;  4LTZ A;  2E94 A;  3TFN A;  4H5C F;  5IM1 A;  5H9D A;  4GA3 A;  3B7L A;  1WY0 A;  3EGT A;  5HN7 A;  4F62 A;  4XQS F;  3N0F A;  3ICZ A;  2PS5 A;  5DW7 A;  2Z4W A;  3NPR A;  2E90 A;  3WC9 A;  3V66 A;  3WJN A;  2J1P A;  4PVX F;  3LLW A;  4LUU A;  5B0J A;  5B03 A;  1YHK A;  5ILD A;  4LPH F;  4LFE A;  3TS7 A;  2F7M F;  2F8C F;  2E8W A;  2Q58 A;  3M9U A;  1EZF A;  5EAS A;  4DXJ A;  1DI1 A;  2VF6 A;  3PKO A;  3G4F A;  3W7F A;  1YYU A;  4EA2 A;  2ZEU A;  5ERO A;  3UCA A;  2F9K F;  1YHL A;  5IN8 A;  5IMI A;  2E8U A;  2PS4 A;  4NUA A;  2E95 A;  4GP1 A;  3AQB B;  5ILI A;  4WK5 A;  3SDU A;  1RQI A;  3N3D A;  1PS1 A;  4H5D F;  2ZCS A;  5ERN A;  3N6K F;  4OKM A;  1VG4 A;  4DHD A;  1N21 A;  3VJB A;  2ZCO A;  3M01 A;  3VJC A;  3CC9 A;  1JFG A;  2Z7H A;  4E9Z A;  3ZCD A;  3QKC A;  4LIX A;  3WCD A;  1HXC A;  4FP4 A;  4NFJ F;  4NKF A;  3N45 F;  3TFP A;  5DIQ F;  4PVY F;  1V4I A;  2J5C A;  4KPJ A;  5AFX A;  5B01 A;  3DYG A;  3CKE A;  3N3L F;  5A0J A;  1N22 A;  3LZ9 A;  3P5R A;  5EAU A;  4DI5 A;  1VG3 A;  3NPK A;  2FOR A;  3RYE A;  1HM4 A;  1UBY A;  4KVD A;  4LPG F;  3WEK A;  3V1V A;  5ILZ A;  3N46 F;  4KK2 A;  1KIY A;  4JYX A;  3NF2 A;  5EAT A;  4NFI F;  3KRA A;  4KFA A;  4RXE A;  2AEL A;  4KVI A;  3P41 A;  2FTZ A;  5AEL A;  3WCE A;  5DHI A;  4RXD A;  3ADZ A;  3WCI A;  2Z4V A;  3LVS A;  3N1V F;  4N9U A;  3ICM A;  3LDW A;  3ZL6 A;  5E8H A;  2PS8 A;  3WJO A;  5DJR F;  2J1O A;  4OMH A;  4NFK F;  4RNQ A;  3VJ8 A;  3SDV A;  3S4J A;  3KRC A;  5HN8 A;  5JV2 F;  2ONG A;  3VJ9 A;  3RYW A;  1YYQ A;  1WL3 A;  2AET A;  4MC8 A;  1V4H A;  1V4E A;  4LA5 A;  5C05 A;  3VJA A;  5IMN A;  3VJD A;  3WCG A;  5HNA A;  1YJ4 A;  5B0K A;  2Z4X A;  4UMJ A;  1DGP A;  1N1Z A;  3WEG A;  4H5E F;  4LFV F;  4DWG A;  2E4O A;  4JVJ F;  4GAX A;  5ERM A;  2E91 A;  5DJV F;  3APZ A;  3AQC B;  2E8X A;  5A0K A;  2ZCR A;  2ZY1 A;  4K10 A;  5CG6 A;  3LGK A;  3P5P A;  3KRO B;  4RXA A;  3NRI A;  1VG2 A;  1YV5 A;  1UBW A;  3ICK A;  4FJQ A;  4E1E A;  3KRO A;  4KVW A;  1WMW A;  1UBX A;  5A0I A;  1YYS A;  1N24 A;  3PYB A;  3OYR A;  5B0M A;  3ACX A;  5ILK A;  4JXN A;  3DYF A;  2Z7I A;  4GP2 A;  3DYH A;  5IK6 A;  3KRF B;  5IL3 A;  3M02 A;  3KRF A;  5DGN F;  4DEM F;  1KIZ A;  3KBK A;  4ZQ8 A;  4HD1 A;  2AZK A;  4L2X F;  3P8R A;  3Q1O A;  5DGM F;  2E8V A;  3LJI A;  4LOB A;  4EA1 A;  3TC1 A;  3WCA A;  3IBA A;  3WE9 A;  2Q9Z A;  2Q9Y A;  5HN9 A;  2PS7 A;  5B0I A;  5JV1 F;  4KQS A;  4OMG A;  1JFA A;  5ILJ A;  3PH7 A;  3N1W F;  2E8T A;  3KRA B;  1UBV A;  2I19 A;  4LZ0 A;  3WEJ A;  4RXC A;  3LMD A;  2F8Z F;  3IPI A;  4DWB A;  3EZ3 A;  1N1B A;  3V1X A;  4LXW A;  5ER8 A;  5IMP A;  3WCL A;  3SAE A;  4P0W A;  5IKH A;  3LGZ B;  1RQJ A;  5B02 A;  3OAC B;  1HXG A;  2DH4 A;  3OAC A;  3BNX A;  3ZOU A;  4RYP A;  5IL8 A;  5JA0 F;  5CG5 A;  5IKA A;  4MC3 A;  5DJP F;  5JUZ F;  3KRC B;  4KKM A;  3RMG A;  4XQR F;  1WKZ A;  5DGS F;  3LOM A;  2EWG A;  4JZX A;  4DZW A;  5IK9 A;  2AZJ A;  1N23 A;  2OA6 A;  5B00 A;  1HXA A;  1WL2 A;  3WEH A;  2Z50 A;  1YYT A;  5KSX F;  1HX9 A;  4F6X A;  3ACY A;  2F89 F;  3Q2Q A;  2ONH A;  2RAH A;  4LTV A;  4N1Z F;  4KVY A;  2PS6 A;  3AE0 A;  4LLS A;  4KUX A;  1HM7 A;  4QPF A;  5E8L A;  3N5H F;  3ZMC A;  4LFG A;  2Z4Y A;  3PDE A;  3WJK A;  3CP6 A;  4NG6 A;  3S9V A;  1RTR A;  3BNY A;  2P1C A;  4JXY A;  3TFV A;  1ZW5 A;  3WCJ A;  4JZB A;  2OPN A;  4EA0 A;  3N0G A;  4KQ5 A;  3PYA A;  3N5J F;  2OPM A;  2H8O A;  5B0L A;  3WSB A;  2Z52 A;  1WL0 A;  4LA6 A;  2QIS A;  3RBM A;  5E8K A;  3VJE A;  1FPS A;  2Z78 A;  2E92 A;  3OAB B;  3ASX A;  3OAB A;  4MC0 A;  1V4K A;  5AHU B;  2Q80 A;  4LZ3 A;  3SDQ A;  3WEF A;  4F6V A;  1YQ7 A;  5DHK A;  3ID0 A;  3WCH A;  5ILH A;  4LLT A;  5ILY A;  3SDT A;  5IK0 A;  3Q2Z A;  2E93 A;  4XQT F;  4E9U A;  1VG7 A;  3ACW A;  3MAV A;  1YYR A;  3MZV A;  3WCB A;  3ICN A;  3LG5 A;  1V4J A;  5DZ2 A;  2OGD A;  3M00 A;  4OKZ A;  4KQU A;  4NKE A;  3LK5 A;  4KPD A;  5AYP A;  3ZMB A;  5I1U A;  3WCC A;  3QQV A;  3SDR A;  2ZCQ A;  4Q23 A;  3KB9 A;  3P8L A;  3EFQ A; 
#chains in the Genus database with same CATH homology
 3WSA A;  2F92 F;  3LSN A;  4LZC A;  1WL1 A;  3LEE A;  4P0V A;  3G4D A;  3M0G A;  4KWD A;  4QXS F;  2ZEV A;  3WCM A;  3AQ0 A;  4P0X A;  3WEI A;  2AEK A;  5IVG A;  3KRP B;  3Q30 A;  2O1O A;  5JV0 F;  3N49 F;  3KRP A;  3WCF A;  1VG6 A;  2Z4Z A;  4OGU A;  1YHM A;  2AZL A;  1N20 A;  2F94 F;  4LTZ A;  2E94 A;  3TFN A;  4H5C F;  5IM1 A;  5H9D A;  4GA3 A;  3B7L A;  1WY0 A;  3EGT A;  5HN7 A;  4F62 A;  4XQS F;  3N0F A;  3ICZ A;  2PS5 A;  5DW7 A;  2Z4W A;  3NPR A;  2E90 A;  3WC9 A;  3V66 A;  3WJN A;  2J1P A;  4PVX F;  3LLW A;  4LUU A;  5B0J A;  5B03 A;  1YHK A;  5ILD A;  4LPH F;  4LFE A;  3TS7 A;  2F7M F;  2F8C F;  2E8W A;  2Q58 A;  3M9U A;  1EZF A;  5EAS A;  4DXJ A;  1DI1 A;  2VF6 A;  3PKO A;  3G4F A;  3W7F A;  1YYU A;  4EA2 A;  2ZEU A;  5ERO A;  3UCA A;  2F9K F;  1YHL A;  5IN8 A;  5IMI A;  2E8U A;  2PS4 A;  4NUA A;  2E95 A;  4GP1 A;  3AQB B;  5ILI A;  4WK5 A;  3SDU A;  1RQI A;  3N3D A;  1PS1 A;  4H5D F;  2ZCS A;  5ERN A;  3N6K F;  4OKM A;  1VG4 A;  4DHD A;  1N21 A;  3VJB A;  2ZCO A;  3M01 A;  3VJC A;  3CC9 A;  1JFG A;  2Z7H A;  4E9Z A;  3ZCD A;  3QKC A;  4LIX A;  3WCD A;  1HXC A;  4FP4 A;  4NFJ F;  4NKF A;  3N45 F;  3TFP A;  5DIQ F;  4PVY F;  1V4I A;  2J5C A;  4KPJ A;  5AFX A;  5B01 A;  3DYG A;  3CKE A;  3N3L F;  5A0J A;  1N22 A;  3LZ9 A;  3P5R A;  5EAU A;  4DI5 A;  1VG3 A;  3NPK A;  2FOR A;  3RYE A;  1HM4 A;  1UBY A;  4KVD A;  4LPG F;  3WEK A;  3V1V A;  5ILZ A;  3N46 F;  4KK2 A;  1KIY A;  4JYX A;  3NF2 A;  5EAT A;  4NFI F;  3KRA A;  4KFA A;  4RXE A;  2AEL A;  4KVI A;  3P41 A;  2FTZ A;  5AEL A;  3WCE A;  5DHI A;  4RXD A;  3ADZ A;  3WCI A;  2Z4V A;  3LVS A;  3N1V F;  4N9U A;  3ICM A;  3LDW A;  3ZL6 A;  5E8H A;  2PS8 A;  3WJO A;  5DJR F;  2J1O A;  4OMH A;  4NFK F;  4RNQ A;  3VJ8 A;  3SDV A;  3S4J A;  3KRC A;  5HN8 A;  5JV2 F;  2ONG A;  3VJ9 A;  3RYW A;  1YYQ A;  1WL3 A;  2AET A;  4MC8 A;  1V4H A;  1V4E A;  4LA5 A;  5C05 A;  3VJA A;  5IMN A;  3VJD A;  3WCG A;  5HNA A;  1YJ4 A;  5B0K A;  2Z4X A;  4UMJ A;  1DGP A;  1N1Z A;  3WEG A;  4H5E F;  4LFV F;  4DWG A;  2E4O A;  4JVJ F;  4GAX A;  5ERM A;  2E91 A;  5DJV F;  3APZ A;  3AQC B;  2E8X A;  5A0K A;  2ZCR A;  2ZY1 A;  4K10 A;  5CG6 A;  3LGK A;  3P5P A;  3KRO B;  4RXA A;  3NRI A;  1VG2 A;  1YV5 A;  1UBW A;  3ICK A;  4FJQ A;  4E1E A;  3KRO A;  4KVW A;  1WMW A;  1UBX A;  5A0I A;  1YYS A;  1N24 A;  3PYB A;  3OYR A;  5B0M A;  3ACX A;  5ILK A;  4JXN A;  3DYF A;  2Z7I A;  4GP2 A;  3DYH A;  5IK6 A;  3KRF B;  5IL3 A;  3M02 A;  3KRF A;  5DGN F;  4DEM F;  1KIZ A;  3KBK A;  4ZQ8 A;  4HD1 A;  2AZK A;  4L2X F;  3P8R A;  3Q1O A;  5DGM F;  2E8V A;  3LJI A;  4LOB A;  4EA1 A;  3TC1 A;  3WCA A;  3IBA A;  3WE9 A;  2Q9Z A;  2Q9Y A;  5HN9 A;  2PS7 A;  5B0I A;  5JV1 F;  4KQS A;  4OMG A;  1JFA A;  5ILJ A;  3PH7 A;  3N1W F;  2E8T A;  3KRA B;  1UBV A;  2I19 A;  4LZ0 A;  3WEJ A;  4RXC A;  3LMD A;  2F8Z F;  3IPI A;  4DWB A;  3EZ3 A;  1N1B A;  3V1X A;  4LXW A;  5ER8 A;  5IMP A;  3WCL A;  3SAE A;  4P0W A;  5IKH A;  3LGZ B;  1RQJ A;  5B02 A;  3OAC B;  1HXG A;  2DH4 A;  3OAC A;  3BNX A;  3ZOU A;  4RYP A;  5IL8 A;  5JA0 F;  5CG5 A;  5IKA A;  4MC3 A;  5DJP F;  5JUZ F;  3KRC B;  4KKM A;  3RMG A;  4XQR F;  1WKZ A;  5DGS F;  3LOM A;  2EWG A;  4JZX A;  4DZW A;  5IK9 A;  2AZJ A;  1N23 A;  2OA6 A;  5B00 A;  1HXA A;  1WL2 A;  3WEH A;  2Z50 A;  1YYT A;  5KSX F;  1HX9 A;  4F6X A;  3ACY A;  2F89 F;  3Q2Q A;  2ONH A;  2RAH A;  4LTV A;  4N1Z F;  4KVY A;  2PS6 A;  3AE0 A;  4LLS A;  4KUX A;  1HM7 A;  4QPF A;  5E8L A;  3N5H F;  3ZMC A;  4LFG A;  2Z4Y A;  3PDE A;  3WJK A;  3CP6 A;  4NG6 A;  3S9V A;  1RTR A;  3BNY A;  2P1C A;  4JXY A;  3TFV A;  1ZW5 A;  3WCJ A;  4JZB A;  2OPN A;  4EA0 A;  3N0G A;  4KQ5 A;  3PYA A;  3N5J F;  2OPM A;  2H8O A;  5B0L A;  3WSB A;  2Z52 A;  1WL0 A;  4LA6 A;  2QIS A;  3RBM A;  5E8K A;  3VJE A;  1FPS A;  2Z78 A;  2E92 A;  3OAB B;  3ASX A;  3OAB A;  4MC0 A;  1V4K A;  5AHU B;  2Q80 A;  4LZ3 A;  3SDQ A;  3WEF A;  4F6V A;  1YQ7 A;  5DHK A;  3ID0 A;  3WCH A;  5ILH A;  4LLT A;  5ILY A;  3SDT A;  5IK0 A;  3Q2Z A;  2E93 A;  4XQT F;  4E9U A;  1VG7 A;  3ACW A;  3MAV A;  1YYR A;  3MZV A;  3WCB A;  3ICN A;  3LG5 A;  1V4J A;  5DZ2 A;  2OGD A;  3M00 A;  4OKZ A;  4KQU A;  4NKE A;  3LK5 A;  4KPD A;  5AYP A;  3ZMB A;  5I1U A;  3WCC A;  3QQV A;  3SDR A;  2ZCQ A;  4Q23 A;  3KB9 A;  3P8L A;  3EFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...