4F62A

Crystal structure of a putative farnesyl-diphosphate synthase from marinomonas sp. med121 (target efi-501980)
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
291
structure length
267
Chain Sequence
VMNLKQFSTYTQSRVDQYLEQQLSDYAPANQLHNAMRYSLFGGKRIRPMLTYASAQLVGDISSLTDASAAALESIHAYSLIHDDLPAMDNPTCHIQFDEATAILAGDALQTFAFELLSNPTSAQPELAIKLIQELVVASGRNGMITGQMIDLSSENKNISLAELEQMHVHKTGALIKASVRMGALSTGQVKPEQLAKLDAYAHAIGLAFQVQDDIIDLTNKATYPKLLGLDGAKALVVRLHEQAIAQISEFGDKSQPLTDLANYIID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Marinomonas sp. med121
total genus 105
structure length 267
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.5.1.-:
pdb deposition date 2012-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4f62A00
5DHKA 3ACYA 3N6KF 3WCMA 1RQJA 3WJNA 3P5RA 4RXCA 4KK2A 4F62A 2FTZA 3P5PA 4PVYF 3KRCB 5I1UA 3LEEA 3LGZB 5IK6A 2AZKA 1HX9A 4RXAA 2Q9YA 1YHLA 1WL1A 4LZ0A 5ERMA 4KWDA 4DHDA 3TC1A 2E91A 4E9UA 3OABB 5E8HA 3CC9A 5A0IA 5ILIA 2OPMA 4EA2A 1YHMA 5DJVF 4DXJA 3LOMA 3TFPA 5CG6A 3N3LF 2F94F 3EGTA 5B0LA 3LSNA 5AFXA 3WEHA 2E92A 3AQBB 3WCBA 4N1ZF 3WCFA 2Z4YA 1V4EA 3EFQA 1YQ7A 3ACWA 3NPKA 3KRFA 4H5DF 4OMGA 3Q30A 1HXAA 2E8VA 5IM1A 5A0KA 2J1OA 3B7LA 4GA3A 2FORA 3ACXA 4DZWA 5AHUB 4NUAA 1YHKA 2ZCOA 4OKMA 2F89F 3VJAA 3WEIA 1N24A 2DH4A 3WCGA 2EWGA 5IN8A 4P0XA 3M00A 1DGPA 1UBWA 4MC8A 4GP2A 1N23A 3DYHA 4WK5A 3SDVA 4LLTA 3WSAA 3AQ0A 3LVSA 2Z7HA 3WCAA 4HD1A 3NRIA 3BNYA 4RXDA 2P1CA 5ILJA 3LJIA 2ZEUA 3WSBA 1N1BA 3G4FA 3RYWA 3KRAB 3N49F 5B0KA 3OYRA 4XQTF 3VJ9A 2ONGA 3WCLA 5A0JA 5B01A 5AYPA 4LUUA 3ZOUA 2Z4ZA 5EASA 2J5CA 2E8WA 2ZEVA 3ADZA 1HM4A 4KVIA 1WL0A 2RAHA 4Q23A 3P8RA 5HNAA 3QQVA 4H5CF 5E8LA 4DWBA 3DYGA 4LLSA 3RYEA 3KRAA 5B0IA 2E93A 4NKFA 3VJDA 3UCAA 2ZY1A 5ILYA 1UBYA 1V4IA 4OKZA 4MC0A 1UBVA 3KRPA 3PYBA 3WCDA 4E9ZA 1KIZA 4ZQ8A 4L2XF 5B0MA 5HN7A 5AELA 3PKOA 4KPDA 4LOBA 3LG5A 5DGNF 2F92F 3KRFB 1YJ4A 4FP4A 1JFGA 5H9DA 3ICMA 2AZJA 3SDTA 3WEFA 3WJKA 4NG6A 4KFAA 3LMDA 2E8TA 2ZCSA 1WY0A 4KUXA 1N22A 2E8UA 3N1VF 1KIYA 3Q1OA 3AQCB 3SAEA 5IKAA 4OGUA 5ILHA 1N1ZA 4RYPA 1YYQA 3NPRA 5B02A 2AEKA 1V4KA 2ZCRA 2OGDA 2OPNA 4KVWA 3G4DA 1HXGA 1YYTA 3NF2A 2ONHA 5DJRF 1VG4A 3V1VA 2AZLA 3WEGA 2OA6A 5DIQF 5IKHA 4QPFA 5ER8A 1YYUA 3MZVA 3TS7A 5HN9A 3WCIA 3WEJA 1N21A 4NKEA 3M9UA 4LA5A 3LZ9A 2Z4VA 1WL2A 5IMNA 1WKZA 3AE0A 4DWGA 2PS4A 3CP6A 5HN8A 4F6VA 5ILKA 4DEMF 1HM7A 1EZFA 3ZMBA 2F8CF 4KQSA 3OACB 3LK5A 4EA1A 1V4JA 4LPHF 4PVXF 3RMGA 3PDEA 3ICNA 2AELA 2PS8A 2F8ZF 3WCCA 4LPGF 5IMIA 3V1XA 3OACA 1RTRA 1ZW5A 3KRPB 3KROA 1YYRA 3IPIA 3N5JF 5JV0F 1WMWA 2E94A 5DZ2A 2QISA 2ZCQA 3IBAA 4LTVA 4P0VA 2E90A 3PYAA 3WJOA 2Z52A 3EZ3A 1RQIA 4NFJF 5JA0F 5EATA 4NFIF 1FPSA 2Q58A 3WEKA 3P8LA 1YYSA 3ZMCA 4LA6A 4JXYA 2H8OA 5B00A 3VJ8A 3VJEA 1WL3A 4KPJA 4KQ5A 5DGSF 4XQSF 4GP1A 1VG2A 1VG7A 3CKEA 3SDUA 3N45F 4XQRF 1HXCA 3P41A 4MC3A 3RBMA 4LTZA 5EROA 4DI5A 4LFEA 4RXEA 4JZBA 5C05A 1VG6A 5IVGA 5DHIA 5IK9A 1DI1A 3ZL6A 3WC9A 4NFKF 2I19A 3DYFA 5JUZF 1N20A 1PS1A 1YV5A 3S9VA 4EA0A 4KVYA 3M02A 5B0JA 3KRCA 4LZ3A 2E95A 3MAVA 2E4OA 5DW7A 3N46F 2VF6A 3M0GA 3ICKA 3Q2QA 3LGKA 4LIXA 1JFAA 5DJPF 3WCJA 3M01A 3LLWA 3OABA 2PS6A 3LDWA 5KSXF 4JYXA 3N3DA 3W7FA 3ASXA 3WE9A 4FJQA 1VG3A 2F9KF 4GAXA 1V4HA 4UMJA 3N1WF 3N0GA 4JZXA 4QXSF 2AETA 5DGMF 5JV2F 3WCEA 5JV1F 4P0WA 2Q9ZA 2Z50A 2Z4WA 3ICZA 3N5HF 4LFGA 3N0FA 4K10A 4KKMA 3PH7A 3KBKA 5B03A 3SDQA 3KROB 2PS5A 2Z7IA 5EAUA 3TFNA 4LFVF 2PS7A 2F7MF 3QKCA 4N9UA 5ILZA 1UBXA 3TFVA 4F6XA 4LZCA 5ERNA 5CG5A 3APZA 3V66A 2O1OA 3S4JA 2Z78A 3ID0A 5ILDA 5IMPA 4H5EF 3Q2ZA 4OMHA 5IL3A 4JXNA 4E1EA 4KVDA 3VJCA 2E8XA 3SDRA 5IL8A 2Q80A 2J1PA 3KB9A 3WCHA 3ZCDA 3BNXA 4KQUA 4RNQA 2Z4XA 5IK0A 4JVJF 5E8KA 3VJBA 4LXWA
chains in the Genus database with same CATH superfamily
5DHKA 3ACYA 3N6KF 3WCMA 1RQJA 3WJNA 3P5RA 4RXCA 4KK2A 4F62A 2FTZA 3P5PA 4PVYF 3KRCB 5I1UA 3LEEA 3LGZB 5IK6A 2AZKA 1HX9A 4RXAA 2Q9YA 1YHLA 1WL1A 4LZ0A 5ERMA 4KWDA 4DHDA 3TC1A 2E91A 4E9UA 3OABB 5E8HA 3CC9A 5A0IA 5ILIA 2OPMA 4EA2A 1YHMA 5DJVF 4DXJA 3LOMA 3TFPA 5CG6A 3N3LF 2F94F 3EGTA 5B0LA 3LSNA 5AFXA 3WEHA 2E92A 3AQBB 3WCBA 4N1ZF 3WCFA 2Z4YA 1V4EA 3EFQA 1YQ7A 3ACWA 3NPKA 3KRFA 4H5DF 4OMGA 3Q30A 1HXAA 2E8VA 5IM1A 5A0KA 2J1OA 3B7LA 4GA3A 2FORA 3ACXA 4DZWA 5AHUB 4NUAA 1YHKA 2ZCOA 4OKMA 2F89F 3VJAA 3WEIA 1N24A 2DH4A 3WCGA 2EWGA 5IN8A 4P0XA 3M00A 1DGPA 1UBWA 4MC8A 4GP2A 1N23A 3DYHA 4WK5A 3SDVA 4LLTA 3WSAA 3AQ0A 3LVSA 2Z7HA 3WCAA 4HD1A 3NRIA 3BNYA 4RXDA 2P1CA 5ILJA 3LJIA 2ZEUA 3WSBA 1N1BA 3G4FA 3RYWA 3KRAB 3N49F 5B0KA 3OYRA 4XQTF 3VJ9A 2ONGA 3WCLA 5A0JA 5B01A 5AYPA 4LUUA 3ZOUA 2Z4ZA 5EASA 2J5CA 2E8WA 2ZEVA 3ADZA 1HM4A 4KVIA 1WL0A 2RAHA 4Q23A 3P8RA 5HNAA 3QQVA 4H5CF 5E8LA 4DWBA 3DYGA 4LLSA 3RYEA 3KRAA 5B0IA 2E93A 4NKFA 3VJDA 3UCAA 2ZY1A 5ILYA 1UBYA 1V4IA 4OKZA 4MC0A 1UBVA 3KRPA 3PYBA 3WCDA 4E9ZA 1KIZA 4ZQ8A 4L2XF 5B0MA 5HN7A 5AELA 3PKOA 4KPDA 4LOBA 3LG5A 5DGNF 2F92F 3KRFB 1YJ4A 4FP4A 1JFGA 5H9DA 3ICMA 2AZJA 3SDTA 3WEFA 3WJKA 4NG6A 4KFAA 3LMDA 2E8TA 2ZCSA 1WY0A 4KUXA 1N22A 2E8UA 3N1VF 1KIYA 3Q1OA 3AQCB 3SAEA 5IKAA 4OGUA 5ILHA 1N1ZA 4RYPA 1YYQA 3NPRA 5B02A 2AEKA 1V4KA 2ZCRA 2OGDA 2OPNA 4KVWA 3G4DA 1HXGA 1YYTA 3NF2A 2ONHA 5DJRF 1VG4A 3V1VA 2AZLA 3WEGA 2OA6A 5DIQF 5IKHA 4QPFA 5ER8A 1YYUA 3MZVA 3TS7A 5HN9A 3WCIA 3WEJA 1N21A 4NKEA 3M9UA 4LA5A 3LZ9A 2Z4VA 1WL2A 5IMNA 1WKZA 3AE0A 4DWGA 2PS4A 3CP6A 5HN8A 4F6VA 5ILKA 4DEMF 1HM7A 1EZFA 3ZMBA 2F8CF 4KQSA 3OACB 3LK5A 4EA1A 1V4JA 4LPHF 4PVXF 3RMGA 3PDEA 3ICNA 2AELA 2PS8A 2F8ZF 3WCCA 4LPGF 5IMIA 3V1XA 3OACA 1RTRA 1ZW5A 3KRPB 3KROA 1YYRA 3IPIA 3N5JF 5JV0F 1WMWA 2E94A 5DZ2A 2QISA 2ZCQA 3IBAA 4LTVA 4P0VA 2E90A 3PYAA 3WJOA 2Z52A 3EZ3A 1RQIA 4NFJF 5JA0F 5EATA 4NFIF 1FPSA 2Q58A 3WEKA 3P8LA 1YYSA 3ZMCA 4LA6A 4JXYA 2H8OA 5B00A 3VJ8A 3VJEA 1WL3A 4KPJA 4KQ5A 5DGSF 4XQSF 4GP1A 1VG2A 1VG7A 3CKEA 3SDUA 3N45F 4XQRF 1HXCA 3P41A 4MC3A 3RBMA 4LTZA 5EROA 4DI5A 4LFEA 4RXEA 4JZBA 5C05A 1VG6A 5IVGA 5DHIA 5IK9A 1DI1A 3ZL6A 3WC9A 4NFKF 2I19A 3DYFA 5JUZF 1N20A 1PS1A 1YV5A 3S9VA 4EA0A 4KVYA 3M02A 5B0JA 3KRCA 4LZ3A 2E95A 3MAVA 2E4OA 5DW7A 3N46F 2VF6A 3M0GA 3ICKA 3Q2QA 3LGKA 4LIXA 1JFAA 5DJPF 3WCJA 3M01A 3LLWA 3OABA 2PS6A 3LDWA 5KSXF 4JYXA 3N3DA 3W7FA 3ASXA 3WE9A 4FJQA 1VG3A 2F9KF 4GAXA 1V4HA 4UMJA 3N1WF 3N0GA 4JZXA 4QXSF 2AETA 5DGMF 5JV2F 3WCEA 5JV1F 4P0WA 2Q9ZA 2Z50A 2Z4WA 3ICZA 3N5HF 4LFGA 3N0FA 4K10A 4KKMA 3PH7A 3KBKA 5B03A 3SDQA 3KROB 2PS5A 2Z7IA 5EAUA 3TFNA 4LFVF 2PS7A 2F7MF 3QKCA 4N9UA 5ILZA 1UBXA 3TFVA 4F6XA 4LZCA 5ERNA 5CG5A 3APZA 3V66A 2O1OA 3S4JA 2Z78A 3ID0A 5ILDA 5IMPA 4H5EF 3Q2ZA 4OMHA 5IL3A 4JXNA 4E1EA 4KVDA 3VJCA 2E8XA 3SDRA 5IL8A 2Q80A 2J1PA 3KB9A 3WCHA 3ZCDA 3BNXA 4KQUA 4RNQA 2Z4XA 5IK0A 4JVJF 5E8KA 3VJBA 4LXWA
chains in the Genus database with same CATH topology
5DHKA 3ACYA 3N6KF 3WCMA 1RQJA 3WJNA 3P5RA 4RXCA 4KK2A 4F62A 2FTZA 3P5PA 4PVYF 3KRCB 5I1UA 3LEEA 3LGZB 5IK6A 2AZKA 1HX9A 4RXAA 2Q9YA 1YHLA 1WL1A 4LZ0A 5ERMA 4KWDA 4DHDA 3TC1A 2E91A 4E9UA 3OABB 5E8HA 3CC9A 5A0IA 5ILIA 2OPMA 4EA2A 1YHMA 5DJVF 4DXJA 3LOMA 3TFPA 5CG6A 3N3LF 2F94F 3EGTA 5B0LA 3LSNA 5AFXA 3WEHA 2E92A 3AQBB 3WCBA 4N1ZF 3WCFA 2Z4YA 1V4EA 3EFQA 1YQ7A 3ACWA 3NPKA 3KRFA 4H5DF 4OMGA 3Q30A 1HXAA 2E8VA 5IM1A 5A0KA 2J1OA 3B7LA 4GA3A 2FORA 3ACXA 4DZWA 5AHUB 4NUAA 1YHKA 2ZCOA 4OKMA 2F89F 3VJAA 3WEIA 1N24A 2DH4A 3WCGA 2EWGA 5IN8A 4P0XA 3M00A 1DGPA 1UBWA 4MC8A 4GP2A 1N23A 3DYHA 4WK5A 3SDVA 4LLTA 3WSAA 3AQ0A 3LVSA 2Z7HA 3WCAA 4HD1A 3NRIA 3BNYA 4RXDA 2P1CA 5ILJA 3LJIA 2ZEUA 3WSBA 1N1BA 3G4FA 3RYWA 3KRAB 3N49F 5B0KA 3OYRA 4XQTF 3VJ9A 2ONGA 3WCLA 5A0JA 5B01A 5AYPA 4LUUA 3ZOUA 2Z4ZA 5EASA 2J5CA 2E8WA 2ZEVA 3ADZA 1HM4A 4KVIA 1WL0A 2RAHA 4Q23A 3P8RA 5HNAA 3QQVA 4H5CF 5E8LA 4DWBA 3DYGA 4LLSA 3RYEA 3KRAA 5B0IA 2E93A 4NKFA 3VJDA 3UCAA 2ZY1A 5ILYA 1UBYA 1V4IA 4OKZA 4MC0A 1UBVA 3KRPA 3PYBA 3WCDA 4E9ZA 1KIZA 4ZQ8A 4L2XF 5B0MA 5HN7A 5AELA 3PKOA 4KPDA 4LOBA 3LG5A 5DGNF 2F92F 3KRFB 1YJ4A 4FP4A 1JFGA 5H9DA 3ICMA 2AZJA 3SDTA 3WEFA 3WJKA 4NG6A 4KFAA 3LMDA 2E8TA 2ZCSA 1WY0A 4KUXA 1N22A 2E8UA 3N1VF 1KIYA 3Q1OA 3AQCB 3SAEA 5IKAA 4OGUA 5ILHA 1N1ZA 4RYPA 1YYQA 3NPRA 5B02A 2AEKA 1V4KA 2ZCRA 2OGDA 2OPNA 4KVWA 3G4DA 1HXGA 1YYTA 3NF2A 2ONHA 5DJRF 1VG4A 3V1VA 2AZLA 3WEGA 2OA6A 5DIQF 5IKHA 4QPFA 5ER8A 1YYUA 3MZVA 3TS7A 5HN9A 3WCIA 3WEJA 1N21A 4NKEA 3M9UA 4LA5A 3LZ9A 2Z4VA 1WL2A 5IMNA 1WKZA 3AE0A 4DWGA 2PS4A 3CP6A 5HN8A 4F6VA 5ILKA 4DEMF 1HM7A 1EZFA 3ZMBA 2F8CF 4KQSA 3OACB 3LK5A 4EA1A 1V4JA 4LPHF 4PVXF 3RMGA 3PDEA 3ICNA 2AELA 2PS8A 2F8ZF 3WCCA 4LPGF 5IMIA 3V1XA 3OACA 1RTRA 1ZW5A 3KRPB 3KROA 1YYRA 3IPIA 3N5JF 5JV0F 1WMWA 2E94A 5DZ2A 2QISA 2ZCQA 3IBAA 4LTVA 4P0VA 2E90A 3PYAA 3WJOA 2Z52A 3EZ3A 1RQIA 4NFJF 5JA0F 5EATA 4NFIF 1FPSA 2Q58A 3WEKA 3P8LA 1YYSA 3ZMCA 4LA6A 4JXYA 2H8OA 5B00A 3VJ8A 3VJEA 1WL3A 4KPJA 4KQ5A 5DGSF 4XQSF 4GP1A 1VG2A 1VG7A 3CKEA 3SDUA 3N45F 4XQRF 1HXCA 3P41A 4MC3A 3RBMA 4LTZA 5EROA 4DI5A 4LFEA 4RXEA 4JZBA 5C05A 1VG6A 5IVGA 5DHIA 5IK9A 1DI1A 3ZL6A 3WC9A 4NFKF 2I19A 3DYFA 5JUZF 1N20A 1PS1A 1YV5A 3S9VA 4EA0A 4KVYA 3M02A 5B0JA 3KRCA 4LZ3A 2E95A 3MAVA 2E4OA 5DW7A 3N46F 2VF6A 3M0GA 3ICKA 3Q2QA 3LGKA 4LIXA 1JFAA 5DJPF 3WCJA 3M01A 3LLWA 3OABA 2PS6A 3LDWA 5KSXF 4JYXA 3N3DA 3W7FA 3ASXA 3WE9A 4FJQA 1VG3A 2F9KF 4GAXA 1V4HA 4UMJA 3N1WF 3N0GA 4JZXA 4QXSF 2AETA 5DGMF 5JV2F 3WCEA 5JV1F 4P0WA 2Q9ZA 2Z50A 2Z4WA 3ICZA 3N5HF 4LFGA 3N0FA 4K10A 4KKMA 3PH7A 3KBKA 5B03A 3SDQA 3KROB 2PS5A 2Z7IA 5EAUA 3TFNA 4LFVF 2PS7A 2F7MF 3QKCA 4N9UA 5ILZA 1UBXA 3TFVA 4F6XA 4LZCA 5ERNA 5CG5A 3APZA 3V66A 2O1OA 3S4JA 2Z78A 3ID0A 5ILDA 5IMPA 4H5EF 3Q2ZA 4OMHA 5IL3A 4JXNA 4E1EA 4KVDA 3VJCA 2E8XA 3SDRA 5IL8A 2Q80A 2J1PA 3KB9A 3WCHA 3ZCDA 3BNXA 4KQUA 4RNQA 2Z4XA 5IK0A 4JVJF 5E8KA 3VJBA 4LXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DHK A;  3ACY A;  3N6K F;  3WCM A;  1RQJ A;  3WJN A;  3P5R A;  4RXC A;  4KK2 A;  4F62 A;  2FTZ A;  3P5P A;  4PVY F;  3KRC B;  5I1U A;  3LEE A;  3LGZ B;  5IK6 A;  2AZK A;  1HX9 A;  4RXA A;  2Q9Y A;  1YHL A;  1WL1 A;  4LZ0 A;  5ERM A;  4KWD A;  4DHD A;  3TC1 A;  2E91 A;  4E9U A;  3OAB B;  5E8H A;  3CC9 A;  5A0I A;  5ILI A;  2OPM A;  4EA2 A;  1YHM A;  5DJV F;  4DXJ A;  3LOM A;  3TFP A;  5CG6 A;  3N3L F;  2F94 F;  3EGT A;  5B0L A;  3LSN A;  5AFX A;  3WEH A;  2E92 A;  3AQB B;  3WCB A;  4N1Z F;  3WCF A;  2Z4Y A;  1V4E A;  3EFQ A;  1YQ7 A;  3ACW A;  3NPK A;  3KRF A;  4H5D F;  4OMG A;  3Q30 A;  1HXA A;  2E8V A;  5IM1 A;  5A0K A;  2J1O A;  3B7L A;  4GA3 A;  2FOR A;  3ACX A;  4DZW A;  5AHU B;  4NUA A;  1YHK A;  2ZCO A;  4OKM A;  2F89 F;  3VJA A;  3WEI A;  1N24 A;  2DH4 A;  3WCG A;  2EWG A;  5IN8 A;  4P0X A;  3M00 A;  1DGP A;  1UBW A;  4MC8 A;  4GP2 A;  1N23 A;  3DYH A;  4WK5 A;  3SDV A;  4LLT A;  3WSA A;  3AQ0 A;  3LVS A;  2Z7H A;  3WCA A;  4HD1 A;  3NRI A;  3BNY A;  4RXD A;  2P1C A;  5ILJ A;  3LJI A;  2ZEU A;  3WSB A;  1N1B A;  3G4F A;  3RYW A;  3KRA B;  3N49 F;  5B0K A;  3OYR A;  4XQT F;  3VJ9 A;  2ONG A;  3WCL A;  5A0J A;  5B01 A;  5AYP A;  4LUU A;  3ZOU A;  2Z4Z A;  5EAS A;  2J5C A;  2E8W A;  2ZEV A;  3ADZ A;  1HM4 A;  4KVI A;  1WL0 A;  2RAH A;  4Q23 A;  3P8R A;  5HNA A;  3QQV A;  4H5C F;  5E8L A;  4DWB A;  3DYG A;  4LLS A;  3RYE A;  3KRA A;  5B0I A;  2E93 A;  4NKF A;  3VJD A;  3UCA A;  2ZY1 A;  5ILY A;  1UBY A;  1V4I A;  4OKZ A;  4MC0 A;  1UBV A;  3KRP A;  3PYB A;  3WCD A;  4E9Z A;  1KIZ A;  4ZQ8 A;  4L2X F;  5B0M A;  5HN7 A;  5AEL A;  3PKO A;  4KPD A;  4LOB A;  3LG5 A;  5DGN F;  2F92 F;  3KRF B;  1YJ4 A;  4FP4 A;  1JFG A;  5H9D A;  3ICM A;  2AZJ A;  3SDT A;  3WEF A;  3WJK A;  4NG6 A;  4KFA A;  3LMD A;  2E8T A;  2ZCS A;  1WY0 A;  4KUX A;  1N22 A;  2E8U A;  3N1V F;  1KIY A;  3Q1O A;  3AQC B;  3SAE A;  5IKA A;  4OGU A;  5ILH A;  1N1Z A;  4RYP A;  1YYQ A;  3NPR A;  5B02 A;  2AEK A;  1V4K A;  2ZCR A;  2OGD A;  2OPN A;  4KVW A;  3G4D A;  1HXG A;  1YYT A;  3NF2 A;  2ONH A;  5DJR F;  1VG4 A;  3V1V A;  2AZL A;  3WEG A;  2OA6 A;  5DIQ F;  5IKH A;  4QPF A;  5ER8 A;  1YYU A;  3MZV A;  3TS7 A;  5HN9 A;  3WCI A;  3WEJ A;  1N21 A;  4NKE A;  3M9U A;  4LA5 A;  3LZ9 A;  2Z4V A;  1WL2 A;  5IMN A;  1WKZ A;  3AE0 A;  4DWG A;  2PS4 A;  3CP6 A;  5HN8 A;  4F6V A;  5ILK A;  4DEM F;  1HM7 A;  1EZF A;  3ZMB A;  2F8C F;  4KQS A;  3OAC B;  3LK5 A;  4EA1 A;  1V4J A;  4LPH F;  4PVX F;  3RMG A;  3PDE A;  3ICN A;  2AEL A;  2PS8 A;  2F8Z F;  3WCC A;  4LPG F;  5IMI A;  3V1X A;  3OAC A;  1RTR A;  1ZW5 A;  3KRP B;  3KRO A;  1YYR A;  3IPI A;  3N5J F;  5JV0 F;  1WMW A;  2E94 A;  5DZ2 A;  2QIS A;  2ZCQ A;  3IBA A;  4LTV A;  4P0V A;  2E90 A;  3PYA A;  3WJO A;  2Z52 A;  3EZ3 A;  1RQI A;  4NFJ F;  5JA0 F;  5EAT A;  4NFI F;  1FPS A;  2Q58 A;  3WEK A;  3P8L A;  1YYS A;  3ZMC A;  4LA6 A;  4JXY A;  2H8O A;  5B00 A;  3VJ8 A;  3VJE A;  1WL3 A;  4KPJ A;  4KQ5 A;  5DGS F;  4XQS F;  4GP1 A;  1VG2 A;  1VG7 A;  3CKE A;  3SDU A;  3N45 F;  4XQR F;  1HXC A;  3P41 A;  4MC3 A;  3RBM A;  4LTZ A;  5ERO A;  4DI5 A;  4LFE A;  4RXE A;  4JZB A;  5C05 A;  1VG6 A;  5IVG A;  5DHI A;  5IK9 A;  1DI1 A;  3ZL6 A;  3WC9 A;  4NFK F;  2I19 A;  3DYF A;  5JUZ F;  1N20 A;  1PS1 A;  1YV5 A;  3S9V A;  4EA0 A;  4KVY A;  3M02 A;  5B0J A;  3KRC A;  4LZ3 A;  2E95 A;  3MAV A;  2E4O A;  5DW7 A;  3N46 F;  2VF6 A;  3M0G A;  3ICK A;  3Q2Q A;  3LGK A;  4LIX A;  1JFA A;  5DJP F;  3WCJ A;  3M01 A;  3LLW A;  3OAB A;  2PS6 A;  3LDW A;  5KSX F;  4JYX A;  3N3D A;  3W7F A;  3ASX A;  3WE9 A;  4FJQ A;  1VG3 A;  2F9K F;  4GAX A;  1V4H A;  4UMJ A;  3N1W F;  3N0G A;  4JZX A;  4QXS F;  2AET A;  5DGM F;  5JV2 F;  3WCE A;  5JV1 F;  4P0W A;  2Q9Z A;  2Z50 A;  2Z4W A;  3ICZ A;  3N5H F;  4LFG A;  3N0F A;  4K10 A;  4KKM A;  3PH7 A;  3KBK A;  5B03 A;  3SDQ A;  3KRO B;  2PS5 A;  2Z7I A;  5EAU A;  3TFN A;  4LFV F;  2PS7 A;  2F7M F;  3QKC A;  4N9U A;  5ILZ A;  1UBX A;  3TFV A;  4F6X A;  4LZC A;  5ERN A;  5CG5 A;  3APZ A;  3V66 A;  2O1O A;  3S4J A;  2Z78 A;  3ID0 A;  5ILD A;  5IMP A;  4H5E F;  3Q2Z A;  4OMH A;  5IL3 A;  4JXN A;  4E1E A;  4KVD A;  3VJC A;  2E8X A;  3SDR A;  5IL8 A;  2Q80 A;  2J1P A;  3KB9 A;  3WCH A;  3ZCD A;  3BNX A;  4KQU A;  4RNQ A;  2Z4X A;  5IK0 A;  4JVJ F;  5E8K A;  3VJB A;  4LXW A; 
#chains in the Genus database with same CATH topology
 5DHK A;  3ACY A;  3N6K F;  3WCM A;  1RQJ A;  3WJN A;  3P5R A;  4RXC A;  4KK2 A;  4F62 A;  2FTZ A;  3P5P A;  4PVY F;  3KRC B;  5I1U A;  3LEE A;  3LGZ B;  5IK6 A;  2AZK A;  1HX9 A;  4RXA A;  2Q9Y A;  1YHL A;  1WL1 A;  4LZ0 A;  5ERM A;  4KWD A;  4DHD A;  3TC1 A;  2E91 A;  4E9U A;  3OAB B;  5E8H A;  3CC9 A;  5A0I A;  5ILI A;  2OPM A;  4EA2 A;  1YHM A;  5DJV F;  4DXJ A;  3LOM A;  3TFP A;  5CG6 A;  3N3L F;  2F94 F;  3EGT A;  5B0L A;  3LSN A;  5AFX A;  3WEH A;  2E92 A;  3AQB B;  3WCB A;  4N1Z F;  3WCF A;  2Z4Y A;  1V4E A;  3EFQ A;  1YQ7 A;  3ACW A;  3NPK A;  3KRF A;  4H5D F;  4OMG A;  3Q30 A;  1HXA A;  2E8V A;  5IM1 A;  5A0K A;  2J1O A;  3B7L A;  4GA3 A;  2FOR A;  3ACX A;  4DZW A;  5AHU B;  4NUA A;  1YHK A;  2ZCO A;  4OKM A;  2F89 F;  3VJA A;  3WEI A;  1N24 A;  2DH4 A;  3WCG A;  2EWG A;  5IN8 A;  4P0X A;  3M00 A;  1DGP A;  1UBW A;  4MC8 A;  4GP2 A;  1N23 A;  3DYH A;  4WK5 A;  3SDV A;  4LLT A;  3WSA A;  3AQ0 A;  3LVS A;  2Z7H A;  3WCA A;  4HD1 A;  3NRI A;  3BNY A;  4RXD A;  2P1C A;  5ILJ A;  3LJI A;  2ZEU A;  3WSB A;  1N1B A;  3G4F A;  3RYW A;  3KRA B;  3N49 F;  5B0K A;  3OYR A;  4XQT F;  3VJ9 A;  2ONG A;  3WCL A;  5A0J A;  5B01 A;  5AYP A;  4LUU A;  3ZOU A;  2Z4Z A;  5EAS A;  2J5C A;  2E8W A;  2ZEV A;  3ADZ A;  1HM4 A;  4KVI A;  1WL0 A;  2RAH A;  4Q23 A;  3P8R A;  5HNA A;  3QQV A;  4H5C F;  5E8L A;  4DWB A;  3DYG A;  4LLS A;  3RYE A;  3KRA A;  5B0I A;  2E93 A;  4NKF A;  3VJD A;  3UCA A;  2ZY1 A;  5ILY A;  1UBY A;  1V4I A;  4OKZ A;  4MC0 A;  1UBV A;  3KRP A;  3PYB A;  3WCD A;  4E9Z A;  1KIZ A;  4ZQ8 A;  4L2X F;  5B0M A;  5HN7 A;  5AEL A;  3PKO A;  4KPD A;  4LOB A;  3LG5 A;  5DGN F;  2F92 F;  3KRF B;  1YJ4 A;  4FP4 A;  1JFG A;  5H9D A;  3ICM A;  2AZJ A;  3SDT A;  3WEF A;  3WJK A;  4NG6 A;  4KFA A;  3LMD A;  2E8T A;  2ZCS A;  1WY0 A;  4KUX A;  1N22 A;  2E8U A;  3N1V F;  1KIY A;  3Q1O A;  3AQC B;  3SAE A;  5IKA A;  4OGU A;  5ILH A;  1N1Z A;  4RYP A;  1YYQ A;  3NPR A;  5B02 A;  2AEK A;  1V4K A;  2ZCR A;  2OGD A;  2OPN A;  4KVW A;  3G4D A;  1HXG A;  1YYT A;  3NF2 A;  2ONH A;  5DJR F;  1VG4 A;  3V1V A;  2AZL A;  3WEG A;  2OA6 A;  5DIQ F;  5IKH A;  4QPF A;  5ER8 A;  1YYU A;  3MZV A;  3TS7 A;  5HN9 A;  3WCI A;  3WEJ A;  1N21 A;  4NKE A;  3M9U A;  4LA5 A;  3LZ9 A;  2Z4V A;  1WL2 A;  5IMN A;  1WKZ A;  3AE0 A;  4DWG A;  2PS4 A;  3CP6 A;  5HN8 A;  4F6V A;  5ILK A;  4DEM F;  1HM7 A;  1EZF A;  3ZMB A;  2F8C F;  4KQS A;  3OAC B;  3LK5 A;  4EA1 A;  1V4J A;  4LPH F;  4PVX F;  3RMG A;  3PDE A;  3ICN A;  2AEL A;  2PS8 A;  2F8Z F;  3WCC A;  4LPG F;  5IMI A;  3V1X A;  3OAC A;  1RTR A;  1ZW5 A;  3KRP B;  3KRO A;  1YYR A;  3IPI A;  3N5J F;  5JV0 F;  1WMW A;  2E94 A;  5DZ2 A;  2QIS A;  2ZCQ A;  3IBA A;  4LTV A;  4P0V A;  2E90 A;  3PYA A;  3WJO A;  2Z52 A;  3EZ3 A;  1RQI A;  4NFJ F;  5JA0 F;  5EAT A;  4NFI F;  1FPS A;  2Q58 A;  3WEK A;  3P8L A;  1YYS A;  3ZMC A;  4LA6 A;  4JXY A;  2H8O A;  5B00 A;  3VJ8 A;  3VJE A;  1WL3 A;  4KPJ A;  4KQ5 A;  5DGS F;  4XQS F;  4GP1 A;  1VG2 A;  1VG7 A;  3CKE A;  3SDU A;  3N45 F;  4XQR F;  1HXC A;  3P41 A;  4MC3 A;  3RBM A;  4LTZ A;  5ERO A;  4DI5 A;  4LFE A;  4RXE A;  4JZB A;  5C05 A;  1VG6 A;  5IVG A;  5DHI A;  5IK9 A;  1DI1 A;  3ZL6 A;  3WC9 A;  4NFK F;  2I19 A;  3DYF A;  5JUZ F;  1N20 A;  1PS1 A;  1YV5 A;  3S9V A;  4EA0 A;  4KVY A;  3M02 A;  5B0J A;  3KRC A;  4LZ3 A;  2E95 A;  3MAV A;  2E4O A;  5DW7 A;  3N46 F;  2VF6 A;  3M0G A;  3ICK A;  3Q2Q A;  3LGK A;  4LIX A;  1JFA A;  5DJP F;  3WCJ A;  3M01 A;  3LLW A;  3OAB A;  2PS6 A;  3LDW A;  5KSX F;  4JYX A;  3N3D A;  3W7F A;  3ASX A;  3WE9 A;  4FJQ A;  1VG3 A;  2F9K F;  4GAX A;  1V4H A;  4UMJ A;  3N1W F;  3N0G A;  4JZX A;  4QXS F;  2AET A;  5DGM F;  5JV2 F;  3WCE A;  5JV1 F;  4P0W A;  2Q9Z A;  2Z50 A;  2Z4W A;  3ICZ A;  3N5H F;  4LFG A;  3N0F A;  4K10 A;  4KKM A;  3PH7 A;  3KBK A;  5B03 A;  3SDQ A;  3KRO B;  2PS5 A;  2Z7I A;  5EAU A;  3TFN A;  4LFV F;  2PS7 A;  2F7M F;  3QKC A;  4N9U A;  5ILZ A;  1UBX A;  3TFV A;  4F6X A;  4LZC A;  5ERN A;  5CG5 A;  3APZ A;  3V66 A;  2O1O A;  3S4J A;  2Z78 A;  3ID0 A;  5ILD A;  5IMP A;  4H5E F;  3Q2Z A;  4OMH A;  5IL3 A;  4JXN A;  4E1E A;  4KVD A;  3VJC A;  2E8X A;  3SDR A;  5IL8 A;  2Q80 A;  2J1P A;  3KB9 A;  3WCH A;  3ZCD A;  3BNX A;  4KQU A;  4RNQ A;  2Z4X A;  5IK0 A;  4JVJ F;  5E8K A;  3VJB A;  4LXW A; 
#chains in the Genus database with same CATH homology
 5DHK A;  3ACY A;  3N6K F;  3WCM A;  1RQJ A;  3WJN A;  3P5R A;  4RXC A;  4KK2 A;  4F62 A;  2FTZ A;  3P5P A;  4PVY F;  3KRC B;  5I1U A;  3LEE A;  3LGZ B;  5IK6 A;  2AZK A;  1HX9 A;  4RXA A;  2Q9Y A;  1YHL A;  1WL1 A;  4LZ0 A;  5ERM A;  4KWD A;  4DHD A;  3TC1 A;  2E91 A;  4E9U A;  3OAB B;  5E8H A;  3CC9 A;  5A0I A;  5ILI A;  2OPM A;  4EA2 A;  1YHM A;  5DJV F;  4DXJ A;  3LOM A;  3TFP A;  5CG6 A;  3N3L F;  2F94 F;  3EGT A;  5B0L A;  3LSN A;  5AFX A;  3WEH A;  2E92 A;  3AQB B;  3WCB A;  4N1Z F;  3WCF A;  2Z4Y A;  1V4E A;  3EFQ A;  1YQ7 A;  3ACW A;  3NPK A;  3KRF A;  4H5D F;  4OMG A;  3Q30 A;  1HXA A;  2E8V A;  5IM1 A;  5A0K A;  2J1O A;  3B7L A;  4GA3 A;  2FOR A;  3ACX A;  4DZW A;  5AHU B;  4NUA A;  1YHK A;  2ZCO A;  4OKM A;  2F89 F;  3VJA A;  3WEI A;  1N24 A;  2DH4 A;  3WCG A;  2EWG A;  5IN8 A;  4P0X A;  3M00 A;  1DGP A;  1UBW A;  4MC8 A;  4GP2 A;  1N23 A;  3DYH A;  4WK5 A;  3SDV A;  4LLT A;  3WSA A;  3AQ0 A;  3LVS A;  2Z7H A;  3WCA A;  4HD1 A;  3NRI A;  3BNY A;  4RXD A;  2P1C A;  5ILJ A;  3LJI A;  2ZEU A;  3WSB A;  1N1B A;  3G4F A;  3RYW A;  3KRA B;  3N49 F;  5B0K A;  3OYR A;  4XQT F;  3VJ9 A;  2ONG A;  3WCL A;  5A0J A;  5B01 A;  5AYP A;  4LUU A;  3ZOU A;  2Z4Z A;  5EAS A;  2J5C A;  2E8W A;  2ZEV A;  3ADZ A;  1HM4 A;  4KVI A;  1WL0 A;  2RAH A;  4Q23 A;  3P8R A;  5HNA A;  3QQV A;  4H5C F;  5E8L A;  4DWB A;  3DYG A;  4LLS A;  3RYE A;  3KRA A;  5B0I A;  2E93 A;  4NKF A;  3VJD A;  3UCA A;  2ZY1 A;  5ILY A;  1UBY A;  1V4I A;  4OKZ A;  4MC0 A;  1UBV A;  3KRP A;  3PYB A;  3WCD A;  4E9Z A;  1KIZ A;  4ZQ8 A;  4L2X F;  5B0M A;  5HN7 A;  5AEL A;  3PKO A;  4KPD A;  4LOB A;  3LG5 A;  5DGN F;  2F92 F;  3KRF B;  1YJ4 A;  4FP4 A;  1JFG A;  5H9D A;  3ICM A;  2AZJ A;  3SDT A;  3WEF A;  3WJK A;  4NG6 A;  4KFA A;  3LMD A;  2E8T A;  2ZCS A;  1WY0 A;  4KUX A;  1N22 A;  2E8U A;  3N1V F;  1KIY A;  3Q1O A;  3AQC B;  3SAE A;  5IKA A;  4OGU A;  5ILH A;  1N1Z A;  4RYP A;  1YYQ A;  3NPR A;  5B02 A;  2AEK A;  1V4K A;  2ZCR A;  2OGD A;  2OPN A;  4KVW A;  3G4D A;  1HXG A;  1YYT A;  3NF2 A;  2ONH A;  5DJR F;  1VG4 A;  3V1V A;  2AZL A;  3WEG A;  2OA6 A;  5DIQ F;  5IKH A;  4QPF A;  5ER8 A;  1YYU A;  3MZV A;  3TS7 A;  5HN9 A;  3WCI A;  3WEJ A;  1N21 A;  4NKE A;  3M9U A;  4LA5 A;  3LZ9 A;  2Z4V A;  1WL2 A;  5IMN A;  1WKZ A;  3AE0 A;  4DWG A;  2PS4 A;  3CP6 A;  5HN8 A;  4F6V A;  5ILK A;  4DEM F;  1HM7 A;  1EZF A;  3ZMB A;  2F8C F;  4KQS A;  3OAC B;  3LK5 A;  4EA1 A;  1V4J A;  4LPH F;  4PVX F;  3RMG A;  3PDE A;  3ICN A;  2AEL A;  2PS8 A;  2F8Z F;  3WCC A;  4LPG F;  5IMI A;  3V1X A;  3OAC A;  1RTR A;  1ZW5 A;  3KRP B;  3KRO A;  1YYR A;  3IPI A;  3N5J F;  5JV0 F;  1WMW A;  2E94 A;  5DZ2 A;  2QIS A;  2ZCQ A;  3IBA A;  4LTV A;  4P0V A;  2E90 A;  3PYA A;  3WJO A;  2Z52 A;  3EZ3 A;  1RQI A;  4NFJ F;  5JA0 F;  5EAT A;  4NFI F;  1FPS A;  2Q58 A;  3WEK A;  3P8L A;  1YYS A;  3ZMC A;  4LA6 A;  4JXY A;  2H8O A;  5B00 A;  3VJ8 A;  3VJE A;  1WL3 A;  4KPJ A;  4KQ5 A;  5DGS F;  4XQS F;  4GP1 A;  1VG2 A;  1VG7 A;  3CKE A;  3SDU A;  3N45 F;  4XQR F;  1HXC A;  3P41 A;  4MC3 A;  3RBM A;  4LTZ A;  5ERO A;  4DI5 A;  4LFE A;  4RXE A;  4JZB A;  5C05 A;  1VG6 A;  5IVG A;  5DHI A;  5IK9 A;  1DI1 A;  3ZL6 A;  3WC9 A;  4NFK F;  2I19 A;  3DYF A;  5JUZ F;  1N20 A;  1PS1 A;  1YV5 A;  3S9V A;  4EA0 A;  4KVY A;  3M02 A;  5B0J A;  3KRC A;  4LZ3 A;  2E95 A;  3MAV A;  2E4O A;  5DW7 A;  3N46 F;  2VF6 A;  3M0G A;  3ICK A;  3Q2Q A;  3LGK A;  4LIX A;  1JFA A;  5DJP F;  3WCJ A;  3M01 A;  3LLW A;  3OAB A;  2PS6 A;  3LDW A;  5KSX F;  4JYX A;  3N3D A;  3W7F A;  3ASX A;  3WE9 A;  4FJQ A;  1VG3 A;  2F9K F;  4GAX A;  1V4H A;  4UMJ A;  3N1W F;  3N0G A;  4JZX A;  4QXS F;  2AET A;  5DGM F;  5JV2 F;  3WCE A;  5JV1 F;  4P0W A;  2Q9Z A;  2Z50 A;  2Z4W A;  3ICZ A;  3N5H F;  4LFG A;  3N0F A;  4K10 A;  4KKM A;  3PH7 A;  3KBK A;  5B03 A;  3SDQ A;  3KRO B;  2PS5 A;  2Z7I A;  5EAU A;  3TFN A;  4LFV F;  2PS7 A;  2F7M F;  3QKC A;  4N9U A;  5ILZ A;  1UBX A;  3TFV A;  4F6X A;  4LZC A;  5ERN A;  5CG5 A;  3APZ A;  3V66 A;  2O1O A;  3S4J A;  2Z78 A;  3ID0 A;  5ILD A;  5IMP A;  4H5E F;  3Q2Z A;  4OMH A;  5IL3 A;  4JXN A;  4E1E A;  4KVD A;  3VJC A;  2E8X A;  3SDR A;  5IL8 A;  2Q80 A;  2J1P A;  3KB9 A;  3WCH A;  3ZCD A;  3BNX A;  4KQU A;  4RNQ A;  2Z4X A;  5IK0 A;  4JVJ F;  5E8K A;  3VJB A;  4LXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...