4F6VA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with bph-1034, mg2+ and fmp.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
281
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title HIV-1 Integrase Inhibitor-Inspired Antibacterials Targeting Isoprenoid Biosynthesis.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 114
structure length 281
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4f6vA00
3VJ8A 3WCFA 1KIYA 4LOBA 4DEMF 3SAEA 3KRFA 1N1ZA 2Z7IA 5B0JA 4H5DF 3G4FA 5AHUB 1UBWA 4QPFA 3M02A 4LPGF 5IL8A 5ER8A 1WKZA 5E8KA 4LZ0A 1V4JA 3VJAA 3WCLA 4KQ5A 4DXJA 3N0GA 1V4KA 1VG3A 2J1PA 5IL3A 1VG6A 3V66A 1RQIA 1RTRA 5IK0A 3PKOA 3P8RA 4EA1A 1KIZA 2J5CA 5IMPA 4DZWA 3OABA 4JZXA 2Z7HA 3N0FA 4NG6A 5A0IA 3WCDA 2QISA 5IN8A 1WY0A 2ZCRA 3KROB 4KQUA 3WEJA 2Z4VA 3WCEA 2P1CA 3KROA 3SDUA 5HN9A 1N23A 1DI1A 4DHDA 5HN7A 1WMWA 5JV0F 1N21A 3ZCDA 4PVYF 5IK6A 4FP4A 3KRPB 2Z4WA 3CP6A 3KRPA 2Q9ZA 3BNXA 4OMHA 4E9UA 4F6VA 3SDTA 3N5JF 2OPMA 4GP2A 2F8CF 5KSXF 4LTZA 4GA3A 3S4JA 5DJPF 5H9DA 3PH7A 4PVXF 3IBAA 4DI5A 3B7LA 3Q2ZA 3P8LA 3TS7A 4LZ3A 5DJRF 3LLWA 3ACYA 3WCGA 3SDRA 2ZCSA 2AZKA 3LJIA 4P0VA 3ICKA 1YYQA 1V4IA 4RYPA 4LXWA 3S9VA 3ICNA 3AQ0A 5DZ2A 3IPIA 2E90A 3Q30A 3M01A 3DYHA 2E93A 2FORA 4JXYA 2F94F 4KVIA 4OGUA 3WEIA 1YJ4A 3QKCA 4NFKF 5EROA 1PS1A 2PS7A 1YYUA 3P5RA 4NFJF 1HM7A 5ERMA 3APZA 2F9KF 2E92A 2E94A 4MC0A 1RQJA 5IVGA 5IKHA 3ACXA 4DWGA 3ACWA 3KRFB 4RXAA 1HM4A 4RNQA 3N6KF 5IMNA 1FPSA 3ICMA 1UBXA 3N1WF 5IKAA 3WCAA 4NKFA 3ZL6A 1N1BA 4P0XA 4UMJA 3WCJA 4WK5A 4KVDA 4ZQ8A 4XQSF 4LIXA 1YHKA 1HX9A 3VJEA 2F89F 1N24A 2Z4ZA 5DGMF 1YYRA 4E9ZA 3WJKA 2Z4YA 2PS4A 4OKZA 2H8OA 5EATA 4HD1A 2AZLA 3ZMCA 1VG7A 3OABB 3VJ9A 3LMDA 5ILIA 3DYGA 4N9UA 3LVSA 5HN8A 5E8HA 3WE9A 5DJVF 3OACA 5AFXA 3M9UA 5CG6A 3V1XA 4MC8A 2Q9YA 3KB9A 5ILKA 2Q80A 3NPKA 3MAVA 4GAXA 5CG5A 4K10A 2Z50A 4L2XF 2FTZA 4LA6A 5DHKA 3WCMA 2Z78A 5B02A 3LEEA 3LDWA 4QXSF 3QQVA 2E8UA 3ID0A 4F6XA 3WCIA 3WJNA 4E1EA 2F92F 3RBMA 5ILDA 3N46F 3NRIA 4OKMA 3Q1OA 3P41A 4LLSA 4JVJF 3WEFA 5JA0F 3UCAA 3LZ9A 1YHLA 3WCBA 5B0MA 2AETA 2Z4XA 1JFGA 1HXGA 5AELA 5HNAA 5B03A 3LG5A 2PS5A 2Z52A 2E8VA 3NPRA 5C05A 1VG2A 1UBYA 3AQCB 3TC1A 4KWDA 3TFNA 3VJCA 2ZCOA 1YQ7A 1HXAA 3M00A 4F62A 3LSNA 4RXDA 3SDVA 3V1VA 2E91A 2ZEUA 4KPJA 2OGDA 1JFAA 5B01A 3AQBB 3ZMBA 3ASXA 3VJDA 4LZCA 3ZOUA 4XQTF 3EFQA 3RMGA 2Q58A 3WEKA 4JYXA 3DYFA 4LFGA 3N45F 4Q23A 4NUAA 4NKEA 3BNYA 3LK5A 3AE0A 5JV1F 3NF2A 2O1OA 5JV2F 3KRCA 2DH4A 2VF6A 4DWBA 4LLTA 2E4OA 5DW7A 3N5HF 4KKMA 3WSBA 3CC9A 2AEKA 3N3LF 4LFVF 1ZW5A 1YV5A 3WSAA 4MC3A 2OPNA 1YHMA 4EA2A 3KBKA 5ILJA 4H5CF 3EZ3A 1N22A 2ZY1A 1UBVA 3OACB 5B0IA 3RYEA 2ZCQA 3LGZB 2PS8A 4JXNA 3PYBA 4FJQA 4P0WA 2ONHA 3WCCA 4KFAA 5EAUA 3CKEA 3PYAA 1EZFA 1HXCA 3KRAB 3EGTA 4KK2A 1WL3A 3KRAA 3M0GA 4KPDA 3WCHA 3N49F 2PS6A 3WEHA 4JZBA 2EWGA 4RXEA 4KQSA 3RYWA 4GP1A 1V4EA 5B0KA 3G4DA 5A0KA 5B0LA 3ADZA 4NFIF 3WEGA 5DGSF 1V4HA 3MZVA 3Q2QA 5ILZA 3LGKA 3W7FA 4LPHF 1WL0A 1WL1A 4EA0A 5A0JA 3LOMA 2ZEVA 5E8LA 5ERNA 5I1UA 3TFPA 3PDEA 3VJBA 4LFEA 3ICZA 4XQRF 5DHIA 5AYPA 4OMGA 2E8TA 3WJOA 1YYTA 3WC9A 1VG4A 5B00A 3SDQA 3TFVA 5IMIA 3OYRA 2E8WA 5EASA 2OA6A 5ILHA 1N20A 4KUXA 5IM1A 4H5EF 5ILYA 4KVWA 2AZJA 2I19A 2ONGA 2F8ZF 3P5PA 2AELA 2F7MF 3N3DA 2E95A 1YYSA 3N1VF 4LA5A 4RXCA 5DIQF 4LUUA 5DGNF 2J1OA 2RAHA 3KRCB 4KVYA 4N1ZF 1DGPA 5IK9A 4LTVA 5JUZF 2E8XA 1WL2A
chains in the Genus database with same CATH superfamily
3VJ8A 3WCFA 1KIYA 4LOBA 4DEMF 3SAEA 3KRFA 1N1ZA 2Z7IA 5B0JA 4H5DF 3G4FA 5AHUB 1UBWA 4QPFA 3M02A 4LPGF 5IL8A 5ER8A 1WKZA 5E8KA 4LZ0A 1V4JA 3VJAA 3WCLA 4KQ5A 4DXJA 3N0GA 1V4KA 1VG3A 2J1PA 5IL3A 1VG6A 3V66A 1RQIA 1RTRA 5IK0A 3PKOA 3P8RA 4EA1A 1KIZA 2J5CA 5IMPA 4DZWA 3OABA 4JZXA 2Z7HA 3N0FA 4NG6A 5A0IA 3WCDA 2QISA 5IN8A 1WY0A 2ZCRA 3KROB 4KQUA 3WEJA 2Z4VA 3WCEA 2P1CA 3KROA 3SDUA 5HN9A 1N23A 1DI1A 4DHDA 5HN7A 1WMWA 5JV0F 1N21A 3ZCDA 4PVYF 5IK6A 4FP4A 3KRPB 2Z4WA 3CP6A 3KRPA 2Q9ZA 3BNXA 4OMHA 4E9UA 4F6VA 3SDTA 3N5JF 2OPMA 4GP2A 2F8CF 5KSXF 4LTZA 4GA3A 3S4JA 5DJPF 5H9DA 3PH7A 4PVXF 3IBAA 4DI5A 3B7LA 3Q2ZA 3P8LA 3TS7A 4LZ3A 5DJRF 3LLWA 3ACYA 3WCGA 3SDRA 2ZCSA 2AZKA 3LJIA 4P0VA 3ICKA 1YYQA 1V4IA 4RYPA 4LXWA 3S9VA 3ICNA 3AQ0A 5DZ2A 3IPIA 2E90A 3Q30A 3M01A 3DYHA 2E93A 2FORA 4JXYA 2F94F 4KVIA 4OGUA 3WEIA 1YJ4A 3QKCA 4NFKF 5EROA 1PS1A 2PS7A 1YYUA 3P5RA 4NFJF 1HM7A 5ERMA 3APZA 2F9KF 2E92A 2E94A 4MC0A 1RQJA 5IVGA 5IKHA 3ACXA 4DWGA 3ACWA 3KRFB 4RXAA 1HM4A 4RNQA 3N6KF 5IMNA 1FPSA 3ICMA 1UBXA 3N1WF 5IKAA 3WCAA 4NKFA 3ZL6A 1N1BA 4P0XA 4UMJA 3WCJA 4WK5A 4KVDA 4ZQ8A 4XQSF 4LIXA 1YHKA 1HX9A 3VJEA 2F89F 1N24A 2Z4ZA 5DGMF 1YYRA 4E9ZA 3WJKA 2Z4YA 2PS4A 4OKZA 2H8OA 5EATA 4HD1A 2AZLA 3ZMCA 1VG7A 3OABB 3VJ9A 3LMDA 5ILIA 3DYGA 4N9UA 3LVSA 5HN8A 5E8HA 3WE9A 5DJVF 3OACA 5AFXA 3M9UA 5CG6A 3V1XA 4MC8A 2Q9YA 3KB9A 5ILKA 2Q80A 3NPKA 3MAVA 4GAXA 5CG5A 4K10A 2Z50A 4L2XF 2FTZA 4LA6A 5DHKA 3WCMA 2Z78A 5B02A 3LEEA 3LDWA 4QXSF 3QQVA 2E8UA 3ID0A 4F6XA 3WCIA 3WJNA 4E1EA 2F92F 3RBMA 5ILDA 3N46F 3NRIA 4OKMA 3Q1OA 3P41A 4LLSA 4JVJF 3WEFA 5JA0F 3UCAA 3LZ9A 1YHLA 3WCBA 5B0MA 2AETA 2Z4XA 1JFGA 1HXGA 5AELA 5HNAA 5B03A 3LG5A 2PS5A 2Z52A 2E8VA 3NPRA 5C05A 1VG2A 1UBYA 3AQCB 3TC1A 4KWDA 3TFNA 3VJCA 2ZCOA 1YQ7A 1HXAA 3M00A 4F62A 3LSNA 4RXDA 3SDVA 3V1VA 2E91A 2ZEUA 4KPJA 2OGDA 1JFAA 5B01A 3AQBB 3ZMBA 3ASXA 3VJDA 4LZCA 3ZOUA 4XQTF 3EFQA 3RMGA 2Q58A 3WEKA 4JYXA 3DYFA 4LFGA 3N45F 4Q23A 4NUAA 4NKEA 3BNYA 3LK5A 3AE0A 5JV1F 3NF2A 2O1OA 5JV2F 3KRCA 2DH4A 2VF6A 4DWBA 4LLTA 2E4OA 5DW7A 3N5HF 4KKMA 3WSBA 3CC9A 2AEKA 3N3LF 4LFVF 1ZW5A 1YV5A 3WSAA 4MC3A 2OPNA 1YHMA 4EA2A 3KBKA 5ILJA 4H5CF 3EZ3A 1N22A 2ZY1A 1UBVA 3OACB 5B0IA 3RYEA 2ZCQA 3LGZB 2PS8A 4JXNA 3PYBA 4FJQA 4P0WA 2ONHA 3WCCA 4KFAA 5EAUA 3CKEA 3PYAA 1EZFA 1HXCA 3KRAB 3EGTA 4KK2A 1WL3A 3KRAA 3M0GA 4KPDA 3WCHA 3N49F 2PS6A 3WEHA 4JZBA 2EWGA 4RXEA 4KQSA 3RYWA 4GP1A 1V4EA 5B0KA 3G4DA 5A0KA 5B0LA 3ADZA 4NFIF 3WEGA 5DGSF 1V4HA 3MZVA 3Q2QA 5ILZA 3LGKA 3W7FA 4LPHF 1WL0A 1WL1A 4EA0A 5A0JA 3LOMA 2ZEVA 5E8LA 5ERNA 5I1UA 3TFPA 3PDEA 3VJBA 4LFEA 3ICZA 4XQRF 5DHIA 5AYPA 4OMGA 2E8TA 3WJOA 1YYTA 3WC9A 1VG4A 5B00A 3SDQA 3TFVA 5IMIA 3OYRA 2E8WA 5EASA 2OA6A 5ILHA 1N20A 4KUXA 5IM1A 4H5EF 5ILYA 4KVWA 2AZJA 2I19A 2ONGA 2F8ZF 3P5PA 2AELA 2F7MF 3N3DA 2E95A 1YYSA 3N1VF 4LA5A 4RXCA 5DIQF 4LUUA 5DGNF 2J1OA 2RAHA 3KRCB 4KVYA 4N1ZF 1DGPA 5IK9A 4LTVA 5JUZF 2E8XA 1WL2A
chains in the Genus database with same CATH topology
3VJ8A 3WCFA 1KIYA 4LOBA 4DEMF 3SAEA 3KRFA 1N1ZA 2Z7IA 5B0JA 4H5DF 3G4FA 5AHUB 1UBWA 4QPFA 3M02A 4LPGF 5IL8A 5ER8A 1WKZA 5E8KA 4LZ0A 1V4JA 3VJAA 3WCLA 4KQ5A 4DXJA 3N0GA 1V4KA 1VG3A 2J1PA 5IL3A 1VG6A 3V66A 1RQIA 1RTRA 5IK0A 3PKOA 3P8RA 4EA1A 1KIZA 2J5CA 5IMPA 4DZWA 3OABA 4JZXA 2Z7HA 3N0FA 4NG6A 5A0IA 3WCDA 2QISA 5IN8A 1WY0A 2ZCRA 3KROB 4KQUA 3WEJA 2Z4VA 3WCEA 2P1CA 3KROA 3SDUA 5HN9A 1N23A 1DI1A 4DHDA 5HN7A 1WMWA 5JV0F 1N21A 3ZCDA 4PVYF 5IK6A 4FP4A 3KRPB 2Z4WA 3CP6A 3KRPA 2Q9ZA 3BNXA 4OMHA 4E9UA 4F6VA 3SDTA 3N5JF 2OPMA 4GP2A 2F8CF 5KSXF 4LTZA 4GA3A 3S4JA 5DJPF 5H9DA 3PH7A 4PVXF 3IBAA 4DI5A 3B7LA 3Q2ZA 3P8LA 3TS7A 4LZ3A 5DJRF 3LLWA 3ACYA 3WCGA 3SDRA 2ZCSA 2AZKA 3LJIA 4P0VA 3ICKA 1YYQA 1V4IA 4RYPA 4LXWA 3S9VA 3ICNA 3AQ0A 5DZ2A 3IPIA 2E90A 3Q30A 3M01A 3DYHA 2E93A 2FORA 4JXYA 2F94F 4KVIA 4OGUA 3WEIA 1YJ4A 3QKCA 4NFKF 5EROA 1PS1A 2PS7A 1YYUA 3P5RA 4NFJF 1HM7A 5ERMA 3APZA 2F9KF 2E92A 2E94A 4MC0A 1RQJA 5IVGA 5IKHA 3ACXA 4DWGA 3ACWA 3KRFB 4RXAA 1HM4A 4RNQA 3N6KF 5IMNA 1FPSA 3ICMA 1UBXA 3N1WF 5IKAA 3WCAA 4NKFA 3ZL6A 1N1BA 4P0XA 4UMJA 3WCJA 4WK5A 4KVDA 4ZQ8A 4XQSF 4LIXA 1YHKA 1HX9A 3VJEA 2F89F 1N24A 2Z4ZA 5DGMF 1YYRA 4E9ZA 3WJKA 2Z4YA 2PS4A 4OKZA 2H8OA 5EATA 4HD1A 2AZLA 3ZMCA 1VG7A 3OABB 3VJ9A 3LMDA 5ILIA 3DYGA 4N9UA 3LVSA 5HN8A 5E8HA 3WE9A 5DJVF 3OACA 5AFXA 3M9UA 5CG6A 3V1XA 4MC8A 2Q9YA 3KB9A 5ILKA 2Q80A 3NPKA 3MAVA 4GAXA 5CG5A 4K10A 2Z50A 4L2XF 2FTZA 4LA6A 5DHKA 3WCMA 2Z78A 5B02A 3LEEA 3LDWA 4QXSF 3QQVA 2E8UA 3ID0A 4F6XA 3WCIA 3WJNA 4E1EA 2F92F 3RBMA 5ILDA 3N46F 3NRIA 4OKMA 3Q1OA 3P41A 4LLSA 4JVJF 3WEFA 5JA0F 3UCAA 3LZ9A 1YHLA 3WCBA 5B0MA 2AETA 2Z4XA 1JFGA 1HXGA 5AELA 5HNAA 5B03A 3LG5A 2PS5A 2Z52A 2E8VA 3NPRA 5C05A 1VG2A 1UBYA 3AQCB 3TC1A 4KWDA 3TFNA 3VJCA 2ZCOA 1YQ7A 1HXAA 3M00A 4F62A 3LSNA 4RXDA 3SDVA 3V1VA 2E91A 2ZEUA 4KPJA 2OGDA 1JFAA 5B01A 3AQBB 3ZMBA 3ASXA 3VJDA 4LZCA 3ZOUA 4XQTF 3EFQA 3RMGA 2Q58A 3WEKA 4JYXA 3DYFA 4LFGA 3N45F 4Q23A 4NUAA 4NKEA 3BNYA 3LK5A 3AE0A 5JV1F 3NF2A 2O1OA 5JV2F 3KRCA 2DH4A 2VF6A 4DWBA 4LLTA 2E4OA 5DW7A 3N5HF 4KKMA 3WSBA 3CC9A 2AEKA 3N3LF 4LFVF 1ZW5A 1YV5A 3WSAA 4MC3A 2OPNA 1YHMA 4EA2A 3KBKA 5ILJA 4H5CF 3EZ3A 1N22A 2ZY1A 1UBVA 3OACB 5B0IA 3RYEA 2ZCQA 3LGZB 2PS8A 4JXNA 3PYBA 4FJQA 4P0WA 2ONHA 3WCCA 4KFAA 5EAUA 3CKEA 3PYAA 1EZFA 1HXCA 3KRAB 3EGTA 4KK2A 1WL3A 3KRAA 3M0GA 4KPDA 3WCHA 3N49F 2PS6A 3WEHA 4JZBA 2EWGA 4RXEA 4KQSA 3RYWA 4GP1A 1V4EA 5B0KA 3G4DA 5A0KA 5B0LA 3ADZA 4NFIF 3WEGA 5DGSF 1V4HA 3MZVA 3Q2QA 5ILZA 3LGKA 3W7FA 4LPHF 1WL0A 1WL1A 4EA0A 5A0JA 3LOMA 2ZEVA 5E8LA 5ERNA 5I1UA 3TFPA 3PDEA 3VJBA 4LFEA 3ICZA 4XQRF 5DHIA 5AYPA 4OMGA 2E8TA 3WJOA 1YYTA 3WC9A 1VG4A 5B00A 3SDQA 3TFVA 5IMIA 3OYRA 2E8WA 5EASA 2OA6A 5ILHA 1N20A 4KUXA 5IM1A 4H5EF 5ILYA 4KVWA 2AZJA 2I19A 2ONGA 2F8ZF 3P5PA 2AELA 2F7MF 3N3DA 2E95A 1YYSA 3N1VF 4LA5A 4RXCA 5DIQF 4LUUA 5DGNF 2J1OA 2RAHA 3KRCB 4KVYA 4N1ZF 1DGPA 5IK9A 4LTVA 5JUZF 2E8XA 1WL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VJ8 A;  3WCF A;  1KIY A;  4LOB A;  4DEM F;  3SAE A;  3KRF A;  1N1Z A;  2Z7I A;  5B0J A;  4H5D F;  3G4F A;  5AHU B;  1UBW A;  4QPF A;  3M02 A;  4LPG F;  5IL8 A;  5ER8 A;  1WKZ A;  5E8K A;  4LZ0 A;  1V4J A;  3VJA A;  3WCL A;  4KQ5 A;  4DXJ A;  3N0G A;  1V4K A;  1VG3 A;  2J1P A;  5IL3 A;  1VG6 A;  3V66 A;  1RQI A;  1RTR A;  5IK0 A;  3PKO A;  3P8R A;  4EA1 A;  1KIZ A;  2J5C A;  5IMP A;  4DZW A;  3OAB A;  4JZX A;  2Z7H A;  3N0F A;  4NG6 A;  5A0I A;  3WCD A;  2QIS A;  5IN8 A;  1WY0 A;  2ZCR A;  3KRO B;  4KQU A;  3WEJ A;  2Z4V A;  3WCE A;  2P1C A;  3KRO A;  3SDU A;  5HN9 A;  1N23 A;  1DI1 A;  4DHD A;  5HN7 A;  1WMW A;  5JV0 F;  1N21 A;  3ZCD A;  4PVY F;  5IK6 A;  4FP4 A;  3KRP B;  2Z4W A;  3CP6 A;  3KRP A;  2Q9Z A;  3BNX A;  4OMH A;  4E9U A;  4F6V A;  3SDT A;  3N5J F;  2OPM A;  4GP2 A;  2F8C F;  5KSX F;  4LTZ A;  4GA3 A;  3S4J A;  5DJP F;  5H9D A;  3PH7 A;  4PVX F;  3IBA A;  4DI5 A;  3B7L A;  3Q2Z A;  3P8L A;  3TS7 A;  4LZ3 A;  5DJR F;  3LLW A;  3ACY A;  3WCG A;  3SDR A;  2ZCS A;  2AZK A;  3LJI A;  4P0V A;  3ICK A;  1YYQ A;  1V4I A;  4RYP A;  4LXW A;  3S9V A;  3ICN A;  3AQ0 A;  5DZ2 A;  3IPI A;  2E90 A;  3Q30 A;  3M01 A;  3DYH A;  2E93 A;  2FOR A;  4JXY A;  2F94 F;  4KVI A;  4OGU A;  3WEI A;  1YJ4 A;  3QKC A;  4NFK F;  5ERO A;  1PS1 A;  2PS7 A;  1YYU A;  3P5R A;  4NFJ F;  1HM7 A;  5ERM A;  3APZ A;  2F9K F;  2E92 A;  2E94 A;  4MC0 A;  1RQJ A;  5IVG A;  5IKH A;  3ACX A;  4DWG A;  3ACW A;  3KRF B;  4RXA A;  1HM4 A;  4RNQ A;  3N6K F;  5IMN A;  1FPS A;  3ICM A;  1UBX A;  3N1W F;  5IKA A;  3WCA A;  4NKF A;  3ZL6 A;  1N1B A;  4P0X A;  4UMJ A;  3WCJ A;  4WK5 A;  4KVD A;  4ZQ8 A;  4XQS F;  4LIX A;  1YHK A;  1HX9 A;  3VJE A;  2F89 F;  1N24 A;  2Z4Z A;  5DGM F;  1YYR A;  4E9Z A;  3WJK A;  2Z4Y A;  2PS4 A;  4OKZ A;  2H8O A;  5EAT A;  4HD1 A;  2AZL A;  3ZMC A;  1VG7 A;  3OAB B;  3VJ9 A;  3LMD A;  5ILI A;  3DYG A;  4N9U A;  3LVS A;  5HN8 A;  5E8H A;  3WE9 A;  5DJV F;  3OAC A;  5AFX A;  3M9U A;  5CG6 A;  3V1X A;  4MC8 A;  2Q9Y A;  3KB9 A;  5ILK A;  2Q80 A;  3NPK A;  3MAV A;  4GAX A;  5CG5 A;  4K10 A;  2Z50 A;  4L2X F;  2FTZ A;  4LA6 A;  5DHK A;  3WCM A;  2Z78 A;  5B02 A;  3LEE A;  3LDW A;  4QXS F;  3QQV A;  2E8U A;  3ID0 A;  4F6X A;  3WCI A;  3WJN A;  4E1E A;  2F92 F;  3RBM A;  5ILD A;  3N46 F;  3NRI A;  4OKM A;  3Q1O A;  3P41 A;  4LLS A;  4JVJ F;  3WEF A;  5JA0 F;  3UCA A;  3LZ9 A;  1YHL A;  3WCB A;  5B0M A;  2AET A;  2Z4X A;  1JFG A;  1HXG A;  5AEL A;  5HNA A;  5B03 A;  3LG5 A;  2PS5 A;  2Z52 A;  2E8V A;  3NPR A;  5C05 A;  1VG2 A;  1UBY A;  3AQC B;  3TC1 A;  4KWD A;  3TFN A;  3VJC A;  2ZCO A;  1YQ7 A;  1HXA A;  3M00 A;  4F62 A;  3LSN A;  4RXD A;  3SDV A;  3V1V A;  2E91 A;  2ZEU A;  4KPJ A;  2OGD A;  1JFA A;  5B01 A;  3AQB B;  3ZMB A;  3ASX A;  3VJD A;  4LZC A;  3ZOU A;  4XQT F;  3EFQ A;  3RMG A;  2Q58 A;  3WEK A;  4JYX A;  3DYF A;  4LFG A;  3N45 F;  4Q23 A;  4NUA A;  4NKE A;  3BNY A;  3LK5 A;  3AE0 A;  5JV1 F;  3NF2 A;  2O1O A;  5JV2 F;  3KRC A;  2DH4 A;  2VF6 A;  4DWB A;  4LLT A;  2E4O A;  5DW7 A;  3N5H F;  4KKM A;  3WSB A;  3CC9 A;  2AEK A;  3N3L F;  4LFV F;  1ZW5 A;  1YV5 A;  3WSA A;  4MC3 A;  2OPN A;  1YHM A;  4EA2 A;  3KBK A;  5ILJ A;  4H5C F;  3EZ3 A;  1N22 A;  2ZY1 A;  1UBV A;  3OAC B;  5B0I A;  3RYE A;  2ZCQ A;  3LGZ B;  2PS8 A;  4JXN A;  3PYB A;  4FJQ A;  4P0W A;  2ONH A;  3WCC A;  4KFA A;  5EAU A;  3CKE A;  3PYA A;  1EZF A;  1HXC A;  3KRA B;  3EGT A;  4KK2 A;  1WL3 A;  3KRA A;  3M0G A;  4KPD A;  3WCH A;  3N49 F;  2PS6 A;  3WEH A;  4JZB A;  2EWG A;  4RXE A;  4KQS A;  3RYW A;  4GP1 A;  1V4E A;  5B0K A;  3G4D A;  5A0K A;  5B0L A;  3ADZ A;  4NFI F;  3WEG A;  5DGS F;  1V4H A;  3MZV A;  3Q2Q A;  5ILZ A;  3LGK A;  3W7F A;  4LPH F;  1WL0 A;  1WL1 A;  4EA0 A;  5A0J A;  3LOM A;  2ZEV A;  5E8L A;  5ERN A;  5I1U A;  3TFP A;  3PDE A;  3VJB A;  4LFE A;  3ICZ A;  4XQR F;  5DHI A;  5AYP A;  4OMG A;  2E8T A;  3WJO A;  1YYT A;  3WC9 A;  1VG4 A;  5B00 A;  3SDQ A;  3TFV A;  5IMI A;  3OYR A;  2E8W A;  5EAS A;  2OA6 A;  5ILH A;  1N20 A;  4KUX A;  5IM1 A;  4H5E F;  5ILY A;  4KVW A;  2AZJ A;  2I19 A;  2ONG A;  2F8Z F;  3P5P A;  2AEL A;  2F7M F;  3N3D A;  2E95 A;  1YYS A;  3N1V F;  4LA5 A;  4RXC A;  5DIQ F;  4LUU A;  5DGN F;  2J1O A;  2RAH A;  3KRC B;  4KVY A;  4N1Z F;  1DGP A;  5IK9 A;  4LTV A;  5JUZ F;  2E8X A;  1WL2 A; 
#chains in the Genus database with same CATH topology
 3VJ8 A;  3WCF A;  1KIY A;  4LOB A;  4DEM F;  3SAE A;  3KRF A;  1N1Z A;  2Z7I A;  5B0J A;  4H5D F;  3G4F A;  5AHU B;  1UBW A;  4QPF A;  3M02 A;  4LPG F;  5IL8 A;  5ER8 A;  1WKZ A;  5E8K A;  4LZ0 A;  1V4J A;  3VJA A;  3WCL A;  4KQ5 A;  4DXJ A;  3N0G A;  1V4K A;  1VG3 A;  2J1P A;  5IL3 A;  1VG6 A;  3V66 A;  1RQI A;  1RTR A;  5IK0 A;  3PKO A;  3P8R A;  4EA1 A;  1KIZ A;  2J5C A;  5IMP A;  4DZW A;  3OAB A;  4JZX A;  2Z7H A;  3N0F A;  4NG6 A;  5A0I A;  3WCD A;  2QIS A;  5IN8 A;  1WY0 A;  2ZCR A;  3KRO B;  4KQU A;  3WEJ A;  2Z4V A;  3WCE A;  2P1C A;  3KRO A;  3SDU A;  5HN9 A;  1N23 A;  1DI1 A;  4DHD A;  5HN7 A;  1WMW A;  5JV0 F;  1N21 A;  3ZCD A;  4PVY F;  5IK6 A;  4FP4 A;  3KRP B;  2Z4W A;  3CP6 A;  3KRP A;  2Q9Z A;  3BNX A;  4OMH A;  4E9U A;  4F6V A;  3SDT A;  3N5J F;  2OPM A;  4GP2 A;  2F8C F;  5KSX F;  4LTZ A;  4GA3 A;  3S4J A;  5DJP F;  5H9D A;  3PH7 A;  4PVX F;  3IBA A;  4DI5 A;  3B7L A;  3Q2Z A;  3P8L A;  3TS7 A;  4LZ3 A;  5DJR F;  3LLW A;  3ACY A;  3WCG A;  3SDR A;  2ZCS A;  2AZK A;  3LJI A;  4P0V A;  3ICK A;  1YYQ A;  1V4I A;  4RYP A;  4LXW A;  3S9V A;  3ICN A;  3AQ0 A;  5DZ2 A;  3IPI A;  2E90 A;  3Q30 A;  3M01 A;  3DYH A;  2E93 A;  2FOR A;  4JXY A;  2F94 F;  4KVI A;  4OGU A;  3WEI A;  1YJ4 A;  3QKC A;  4NFK F;  5ERO A;  1PS1 A;  2PS7 A;  1YYU A;  3P5R A;  4NFJ F;  1HM7 A;  5ERM A;  3APZ A;  2F9K F;  2E92 A;  2E94 A;  4MC0 A;  1RQJ A;  5IVG A;  5IKH A;  3ACX A;  4DWG A;  3ACW A;  3KRF B;  4RXA A;  1HM4 A;  4RNQ A;  3N6K F;  5IMN A;  1FPS A;  3ICM A;  1UBX A;  3N1W F;  5IKA A;  3WCA A;  4NKF A;  3ZL6 A;  1N1B A;  4P0X A;  4UMJ A;  3WCJ A;  4WK5 A;  4KVD A;  4ZQ8 A;  4XQS F;  4LIX A;  1YHK A;  1HX9 A;  3VJE A;  2F89 F;  1N24 A;  2Z4Z A;  5DGM F;  1YYR A;  4E9Z A;  3WJK A;  2Z4Y A;  2PS4 A;  4OKZ A;  2H8O A;  5EAT A;  4HD1 A;  2AZL A;  3ZMC A;  1VG7 A;  3OAB B;  3VJ9 A;  3LMD A;  5ILI A;  3DYG A;  4N9U A;  3LVS A;  5HN8 A;  5E8H A;  3WE9 A;  5DJV F;  3OAC A;  5AFX A;  3M9U A;  5CG6 A;  3V1X A;  4MC8 A;  2Q9Y A;  3KB9 A;  5ILK A;  2Q80 A;  3NPK A;  3MAV A;  4GAX A;  5CG5 A;  4K10 A;  2Z50 A;  4L2X F;  2FTZ A;  4LA6 A;  5DHK A;  3WCM A;  2Z78 A;  5B02 A;  3LEE A;  3LDW A;  4QXS F;  3QQV A;  2E8U A;  3ID0 A;  4F6X A;  3WCI A;  3WJN A;  4E1E A;  2F92 F;  3RBM A;  5ILD A;  3N46 F;  3NRI A;  4OKM A;  3Q1O A;  3P41 A;  4LLS A;  4JVJ F;  3WEF A;  5JA0 F;  3UCA A;  3LZ9 A;  1YHL A;  3WCB A;  5B0M A;  2AET A;  2Z4X A;  1JFG A;  1HXG A;  5AEL A;  5HNA A;  5B03 A;  3LG5 A;  2PS5 A;  2Z52 A;  2E8V A;  3NPR A;  5C05 A;  1VG2 A;  1UBY A;  3AQC B;  3TC1 A;  4KWD A;  3TFN A;  3VJC A;  2ZCO A;  1YQ7 A;  1HXA A;  3M00 A;  4F62 A;  3LSN A;  4RXD A;  3SDV A;  3V1V A;  2E91 A;  2ZEU A;  4KPJ A;  2OGD A;  1JFA A;  5B01 A;  3AQB B;  3ZMB A;  3ASX A;  3VJD A;  4LZC A;  3ZOU A;  4XQT F;  3EFQ A;  3RMG A;  2Q58 A;  3WEK A;  4JYX A;  3DYF A;  4LFG A;  3N45 F;  4Q23 A;  4NUA A;  4NKE A;  3BNY A;  3LK5 A;  3AE0 A;  5JV1 F;  3NF2 A;  2O1O A;  5JV2 F;  3KRC A;  2DH4 A;  2VF6 A;  4DWB A;  4LLT A;  2E4O A;  5DW7 A;  3N5H F;  4KKM A;  3WSB A;  3CC9 A;  2AEK A;  3N3L F;  4LFV F;  1ZW5 A;  1YV5 A;  3WSA A;  4MC3 A;  2OPN A;  1YHM A;  4EA2 A;  3KBK A;  5ILJ A;  4H5C F;  3EZ3 A;  1N22 A;  2ZY1 A;  1UBV A;  3OAC B;  5B0I A;  3RYE A;  2ZCQ A;  3LGZ B;  2PS8 A;  4JXN A;  3PYB A;  4FJQ A;  4P0W A;  2ONH A;  3WCC A;  4KFA A;  5EAU A;  3CKE A;  3PYA A;  1EZF A;  1HXC A;  3KRA B;  3EGT A;  4KK2 A;  1WL3 A;  3KRA A;  3M0G A;  4KPD A;  3WCH A;  3N49 F;  2PS6 A;  3WEH A;  4JZB A;  2EWG A;  4RXE A;  4KQS A;  3RYW A;  4GP1 A;  1V4E A;  5B0K A;  3G4D A;  5A0K A;  5B0L A;  3ADZ A;  4NFI F;  3WEG A;  5DGS F;  1V4H A;  3MZV A;  3Q2Q A;  5ILZ A;  3LGK A;  3W7F A;  4LPH F;  1WL0 A;  1WL1 A;  4EA0 A;  5A0J A;  3LOM A;  2ZEV A;  5E8L A;  5ERN A;  5I1U A;  3TFP A;  3PDE A;  3VJB A;  4LFE A;  3ICZ A;  4XQR F;  5DHI A;  5AYP A;  4OMG A;  2E8T A;  3WJO A;  1YYT A;  3WC9 A;  1VG4 A;  5B00 A;  3SDQ A;  3TFV A;  5IMI A;  3OYR A;  2E8W A;  5EAS A;  2OA6 A;  5ILH A;  1N20 A;  4KUX A;  5IM1 A;  4H5E F;  5ILY A;  4KVW A;  2AZJ A;  2I19 A;  2ONG A;  2F8Z F;  3P5P A;  2AEL A;  2F7M F;  3N3D A;  2E95 A;  1YYS A;  3N1V F;  4LA5 A;  4RXC A;  5DIQ F;  4LUU A;  5DGN F;  2J1O A;  2RAH A;  3KRC B;  4KVY A;  4N1Z F;  1DGP A;  5IK9 A;  4LTV A;  5JUZ F;  2E8X A;  1WL2 A; 
#chains in the Genus database with same CATH homology
 3VJ8 A;  3WCF A;  1KIY A;  4LOB A;  4DEM F;  3SAE A;  3KRF A;  1N1Z A;  2Z7I A;  5B0J A;  4H5D F;  3G4F A;  5AHU B;  1UBW A;  4QPF A;  3M02 A;  4LPG F;  5IL8 A;  5ER8 A;  1WKZ A;  5E8K A;  4LZ0 A;  1V4J A;  3VJA A;  3WCL A;  4KQ5 A;  4DXJ A;  3N0G A;  1V4K A;  1VG3 A;  2J1P A;  5IL3 A;  1VG6 A;  3V66 A;  1RQI A;  1RTR A;  5IK0 A;  3PKO A;  3P8R A;  4EA1 A;  1KIZ A;  2J5C A;  5IMP A;  4DZW A;  3OAB A;  4JZX A;  2Z7H A;  3N0F A;  4NG6 A;  5A0I A;  3WCD A;  2QIS A;  5IN8 A;  1WY0 A;  2ZCR A;  3KRO B;  4KQU A;  3WEJ A;  2Z4V A;  3WCE A;  2P1C A;  3KRO A;  3SDU A;  5HN9 A;  1N23 A;  1DI1 A;  4DHD A;  5HN7 A;  1WMW A;  5JV0 F;  1N21 A;  3ZCD A;  4PVY F;  5IK6 A;  4FP4 A;  3KRP B;  2Z4W A;  3CP6 A;  3KRP A;  2Q9Z A;  3BNX A;  4OMH A;  4E9U A;  4F6V A;  3SDT A;  3N5J F;  2OPM A;  4GP2 A;  2F8C F;  5KSX F;  4LTZ A;  4GA3 A;  3S4J A;  5DJP F;  5H9D A;  3PH7 A;  4PVX F;  3IBA A;  4DI5 A;  3B7L A;  3Q2Z A;  3P8L A;  3TS7 A;  4LZ3 A;  5DJR F;  3LLW A;  3ACY A;  3WCG A;  3SDR A;  2ZCS A;  2AZK A;  3LJI A;  4P0V A;  3ICK A;  1YYQ A;  1V4I A;  4RYP A;  4LXW A;  3S9V A;  3ICN A;  3AQ0 A;  5DZ2 A;  3IPI A;  2E90 A;  3Q30 A;  3M01 A;  3DYH A;  2E93 A;  2FOR A;  4JXY A;  2F94 F;  4KVI A;  4OGU A;  3WEI A;  1YJ4 A;  3QKC A;  4NFK F;  5ERO A;  1PS1 A;  2PS7 A;  1YYU A;  3P5R A;  4NFJ F;  1HM7 A;  5ERM A;  3APZ A;  2F9K F;  2E92 A;  2E94 A;  4MC0 A;  1RQJ A;  5IVG A;  5IKH A;  3ACX A;  4DWG A;  3ACW A;  3KRF B;  4RXA A;  1HM4 A;  4RNQ A;  3N6K F;  5IMN A;  1FPS A;  3ICM A;  1UBX A;  3N1W F;  5IKA A;  3WCA A;  4NKF A;  3ZL6 A;  1N1B A;  4P0X A;  4UMJ A;  3WCJ A;  4WK5 A;  4KVD A;  4ZQ8 A;  4XQS F;  4LIX A;  1YHK A;  1HX9 A;  3VJE A;  2F89 F;  1N24 A;  2Z4Z A;  5DGM F;  1YYR A;  4E9Z A;  3WJK A;  2Z4Y A;  2PS4 A;  4OKZ A;  2H8O A;  5EAT A;  4HD1 A;  2AZL A;  3ZMC A;  1VG7 A;  3OAB B;  3VJ9 A;  3LMD A;  5ILI A;  3DYG A;  4N9U A;  3LVS A;  5HN8 A;  5E8H A;  3WE9 A;  5DJV F;  3OAC A;  5AFX A;  3M9U A;  5CG6 A;  3V1X A;  4MC8 A;  2Q9Y A;  3KB9 A;  5ILK A;  2Q80 A;  3NPK A;  3MAV A;  4GAX A;  5CG5 A;  4K10 A;  2Z50 A;  4L2X F;  2FTZ A;  4LA6 A;  5DHK A;  3WCM A;  2Z78 A;  5B02 A;  3LEE A;  3LDW A;  4QXS F;  3QQV A;  2E8U A;  3ID0 A;  4F6X A;  3WCI A;  3WJN A;  4E1E A;  2F92 F;  3RBM A;  5ILD A;  3N46 F;  3NRI A;  4OKM A;  3Q1O A;  3P41 A;  4LLS A;  4JVJ F;  3WEF A;  5JA0 F;  3UCA A;  3LZ9 A;  1YHL A;  3WCB A;  5B0M A;  2AET A;  2Z4X A;  1JFG A;  1HXG A;  5AEL A;  5HNA A;  5B03 A;  3LG5 A;  2PS5 A;  2Z52 A;  2E8V A;  3NPR A;  5C05 A;  1VG2 A;  1UBY A;  3AQC B;  3TC1 A;  4KWD A;  3TFN A;  3VJC A;  2ZCO A;  1YQ7 A;  1HXA A;  3M00 A;  4F62 A;  3LSN A;  4RXD A;  3SDV A;  3V1V A;  2E91 A;  2ZEU A;  4KPJ A;  2OGD A;  1JFA A;  5B01 A;  3AQB B;  3ZMB A;  3ASX A;  3VJD A;  4LZC A;  3ZOU A;  4XQT F;  3EFQ A;  3RMG A;  2Q58 A;  3WEK A;  4JYX A;  3DYF A;  4LFG A;  3N45 F;  4Q23 A;  4NUA A;  4NKE A;  3BNY A;  3LK5 A;  3AE0 A;  5JV1 F;  3NF2 A;  2O1O A;  5JV2 F;  3KRC A;  2DH4 A;  2VF6 A;  4DWB A;  4LLT A;  2E4O A;  5DW7 A;  3N5H F;  4KKM A;  3WSB A;  3CC9 A;  2AEK A;  3N3L F;  4LFV F;  1ZW5 A;  1YV5 A;  3WSA A;  4MC3 A;  2OPN A;  1YHM A;  4EA2 A;  3KBK A;  5ILJ A;  4H5C F;  3EZ3 A;  1N22 A;  2ZY1 A;  1UBV A;  3OAC B;  5B0I A;  3RYE A;  2ZCQ A;  3LGZ B;  2PS8 A;  4JXN A;  3PYB A;  4FJQ A;  4P0W A;  2ONH A;  3WCC A;  4KFA A;  5EAU A;  3CKE A;  3PYA A;  1EZF A;  1HXC A;  3KRA B;  3EGT A;  4KK2 A;  1WL3 A;  3KRA A;  3M0G A;  4KPD A;  3WCH A;  3N49 F;  2PS6 A;  3WEH A;  4JZB A;  2EWG A;  4RXE A;  4KQS A;  3RYW A;  4GP1 A;  1V4E A;  5B0K A;  3G4D A;  5A0K A;  5B0L A;  3ADZ A;  4NFI F;  3WEG A;  5DGS F;  1V4H A;  3MZV A;  3Q2Q A;  5ILZ A;  3LGK A;  3W7F A;  4LPH F;  1WL0 A;  1WL1 A;  4EA0 A;  5A0J A;  3LOM A;  2ZEV A;  5E8L A;  5ERN A;  5I1U A;  3TFP A;  3PDE A;  3VJB A;  4LFE A;  3ICZ A;  4XQR F;  5DHI A;  5AYP A;  4OMG A;  2E8T A;  3WJO A;  1YYT A;  3WC9 A;  1VG4 A;  5B00 A;  3SDQ A;  3TFV A;  5IMI A;  3OYR A;  2E8W A;  5EAS A;  2OA6 A;  5ILH A;  1N20 A;  4KUX A;  5IM1 A;  4H5E F;  5ILY A;  4KVW A;  2AZJ A;  2I19 A;  2ONG A;  2F8Z F;  3P5P A;  2AEL A;  2F7M F;  3N3D A;  2E95 A;  1YYS A;  3N1V F;  4LA5 A;  4RXC A;  5DIQ F;  4LUU A;  5DGN F;  2J1O A;  2RAH A;  3KRC B;  4KVY A;  4N1Z F;  1DGP A;  5IK9 A;  4LTV A;  5JUZ F;  2E8X A;  1WL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...