4F6XA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with bph-1112
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
284
structure length
281
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title HIV-1 Integrase Inhibitor-Inspired Antibacterials Targeting Isoprenoid Biosynthesis.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 113
structure length 281
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4f6xA00
3V66A 3SAEA 3N3LF 3WCAA 4LPHF 2PS4A 3LK5A 3AE0A 1HX9A 5ILDA 5JV1F 3KRAA 4KQ5A 3NF2A 2E8XA 4KPDA 5DHIA 1UBVA 1UBYA 3M01A 4KVIA 2ZY1A 3V1VA 2E92A 5ILYA 1HM7A 4N1ZF 1YJ4A 3WCGA 3ID0A 3QQVA 3OABA 4P0WA 4JVJF 1UBXA 4LPGF 3LOMA 4KWDA 5IK6A 3KRFA 2OPMA 3N5HF 4E9UA 4EA1A 2AELA 4H5EF 3LJIA 3WEGA 4LA6A 3SDVA 2VF6A 4LXWA 5IL3A 2P1CA 3WCLA 3Q30A 3VJ8A 5IN8A 3NPKA 3VJAA 4KQSA 2Z4ZA 4LLSA 1YHLA 3ZCDA 5A0JA 3ADZA 3P8RA 3ACXA 5EAUA 3ZMCA 3LGZB 4K10A 5DJPF 4EA0A 3VJDA 2Z4WA 3UCAA 1V4IA 2OPNA 4KPJA 4UMJA 2OA6A 5DZ2A 4F6XA 3WEKA 1ZW5A 2ZEVA 2AZLA 3EZ3A 3N6KF 2Q9YA 1WL3A 3ASXA 1YV5A 2Z50A 2E91A 3SDTA 2RAHA 4DHDA 3TFNA 4FP4A 2ZCRA 5DJVF 5EASA 3WJKA 3OACB 3WCIA 3LLWA 1FPSA 5H9DA 3KRPB 3KROA 3WSAA 4XQRF 5DGNF 3WCFA 5IL8A 3TC1A 3ACYA 3LEEA 2Z4YA 5B0JA 2AZKA 3Q2ZA 3WEJA 2Z4VA 2F7MF 5B0MA 2Q9ZA 3CKEA 2E90A 3RYWA 3N0FA 2EWGA 4NKEA 5AELA 1KIZA 3AQCB 3OACA 3AQ0A 5HN7A 1VG4A 3WJOA 3ACWA 3RYEA 3WCJA 3RBMA 3LG5A 5ERMA 2AEKA 2Z7HA 4FJQA 3IPIA 5DW7A 4LTZA 3N3DA 4H5DF 3N49F 4KQUA 3CP6A 1YYUA 1V4EA 2E8TA 3B7LA 3LZ9A 2Z7IA 3N45F 3VJEA 3G4FA 3PDEA 3ZMBA 3QKCA 4MC3A 3DYFA 2QISA 3APZA 2FORA 4P0XA 3WCCA 4QPFA 5IKAA 4JXNA 4MC8A 4KVDA 3SDQA 2E95A 4WK5A 1VG3A 1YHKA 1DI1A 2Z52A 3PH7A 2Q58A 3CC9A 3P5PA 4PVXF 3WCEA 3WCMA 2Q80A 3N5JF 5ILZA 3VJCA 4QXSF 3M0GA 3M02A 3S9VA 5E8HA 1HXGA 2H8OA 5ILJA 2E94A 5CG5A 3WEHA 1YYTA 4NUAA 5JV0F 4RXCA 4LIXA 2DH4A 2F8ZF 4LZ0A 3KB9A 5DGSF 1N20A 1HM4A 1V4HA 4H5CF 5IK9A 3W7FA 2E8VA 2PS8A 5AYPA 5IK0A 1VG6A 3N1VF 2J1OA 3DYGA 4KUXA 2I19A 4KK2A 1RQIA 4JYXA 1V4JA 4DEMF 5DGMF 1EZFA 1N23A 4L2XF 4DWBA 4RXEA 3TFPA 1DGPA 1JFAA 5ERNA 3WCDA 5E8KA 3ZL6A 3MAVA 3KRCB 4LUUA 1WKZA 5CG6A 4OGUA 3ICMA 5B02A 3ICNA 5IKHA 2ONHA 2E93A 3KRPA 4KVYA 1VG7A 5DHKA 2J5CA 1WL0A 5ER8A 3TS7A 4F6VA 5I1UA 4LFEA 3PYAA 3VJBA 4NG6A 2E8UA 2AETA 3SDUA 2F89F 3TFVA 3LDWA 2F8CF 4ZQ8A 4KKMA 4EA2A 1N1ZA 4LFGA 1WL1A 3KRCA 5HNAA 5ILHA 5B01A 3N0GA 4RXAA 5A0KA 3EGTA 3KRFB 3WCHA 3P41A 5EATA 3P8LA 1PS1A 4LA5A 4P0VA 2AZJA 4NFIF 5DJRF 4RXDA 2J1PA 2Z4XA 4GP2A 1KIYA 1YYQA 1WMWA 3P5RA 2ZEUA 5AHUB 4LOBA 5ILIA 5JV2F 4JXYA 4NFJF 5IVGA 2ZCQA 3ZOUA 1YHMA 4OKZA 2PS6A 5EROA 4OMGA 4GAXA 2ZCSA 1JFGA 4LTVA 3BNXA 4GA3A 3LGKA 3ICKA 2E4OA 5JA0F 3WE9A 1YQ7A 5ILKA 3S4JA 3N46F 4LFVF 4JZXA 4LZCA 3NRIA 3WEIA 3G4DA 2PS7A 3MZVA 3WSBA 3KROB 3AQBB 3LVSA 3KBKA 1UBWA 3DYHA 3EFQA 4HD1A 4DI5A 4XQSF 1HXCA 4E1EA 3PYBA 1WY0A 4Q23A 3IBAA 4NKFA 4MC0A 1YYSA 3VJ9A 1RQJA 3WJNA 3Q2QA 2F94F 4PVYF 2OGDA 3WEFA 5IMPA 5B00A 4GP1A 1RTRA 4OMHA 2F9KF 5KSXF 4KFAA 3OYRA 3SDRA 2PS5A 4XQTF 3N1WF 5E8LA 4E9ZA 4JZBA 3Q1OA 4N9UA 3LMDA 3NPRA 4RYPA 1HXAA 5B0IA 5IMIA 5JUZF 2ONGA 1N22A 5B03A 4LZ3A 4F62A 4KVWA 2E8WA 3WCBA 1YYRA 3M9UA 3LSNA 4RNQA 3RMGA 3KRAB 3PKOA 4LLTA 4DZWA 5IMNA 2O1OA 3BNYA 3V1XA 4DWGA 1N24A 3ICZA 1WL2A 5C05A 1VG2A 2FTZA 3M00A 4DXJA 5IM1A 5DIQF 3OABB 5AFXA 2Z78A 3WC9A 5HN9A 5B0LA 5B0KA 2ZCOA 5HN8A 1N1BA 1V4KA 5A0IA 2F92F 4OKMA 4NFKF 1N21A
chains in the Genus database with same CATH superfamily
3V66A 3SAEA 3N3LF 3WCAA 4LPHF 2PS4A 3LK5A 3AE0A 1HX9A 5ILDA 5JV1F 3KRAA 4KQ5A 3NF2A 2E8XA 4KPDA 5DHIA 1UBVA 1UBYA 3M01A 4KVIA 2ZY1A 3V1VA 2E92A 5ILYA 1HM7A 4N1ZF 1YJ4A 3WCGA 3ID0A 3QQVA 3OABA 4P0WA 4JVJF 1UBXA 4LPGF 3LOMA 4KWDA 5IK6A 3KRFA 2OPMA 3N5HF 4E9UA 4EA1A 2AELA 4H5EF 3LJIA 3WEGA 4LA6A 3SDVA 2VF6A 4LXWA 5IL3A 2P1CA 3WCLA 3Q30A 3VJ8A 5IN8A 3NPKA 3VJAA 4KQSA 2Z4ZA 4LLSA 1YHLA 3ZCDA 5A0JA 3ADZA 3P8RA 3ACXA 5EAUA 3ZMCA 3LGZB 4K10A 5DJPF 4EA0A 3VJDA 2Z4WA 3UCAA 1V4IA 2OPNA 4KPJA 4UMJA 2OA6A 5DZ2A 4F6XA 3WEKA 1ZW5A 2ZEVA 2AZLA 3EZ3A 3N6KF 2Q9YA 1WL3A 3ASXA 1YV5A 2Z50A 2E91A 3SDTA 2RAHA 4DHDA 3TFNA 4FP4A 2ZCRA 5DJVF 5EASA 3WJKA 3OACB 3WCIA 3LLWA 1FPSA 5H9DA 3KRPB 3KROA 3WSAA 4XQRF 5DGNF 3WCFA 5IL8A 3TC1A 3ACYA 3LEEA 2Z4YA 5B0JA 2AZKA 3Q2ZA 3WEJA 2Z4VA 2F7MF 5B0MA 2Q9ZA 3CKEA 2E90A 3RYWA 3N0FA 2EWGA 4NKEA 5AELA 1KIZA 3AQCB 3OACA 3AQ0A 5HN7A 1VG4A 3WJOA 3ACWA 3RYEA 3WCJA 3RBMA 3LG5A 5ERMA 2AEKA 2Z7HA 4FJQA 3IPIA 5DW7A 4LTZA 3N3DA 4H5DF 3N49F 4KQUA 3CP6A 1YYUA 1V4EA 2E8TA 3B7LA 3LZ9A 2Z7IA 3N45F 3VJEA 3G4FA 3PDEA 3ZMBA 3QKCA 4MC3A 3DYFA 2QISA 3APZA 2FORA 4P0XA 3WCCA 4QPFA 5IKAA 4JXNA 4MC8A 4KVDA 3SDQA 2E95A 4WK5A 1VG3A 1YHKA 1DI1A 2Z52A 3PH7A 2Q58A 3CC9A 3P5PA 4PVXF 3WCEA 3WCMA 2Q80A 3N5JF 5ILZA 3VJCA 4QXSF 3M0GA 3M02A 3S9VA 5E8HA 1HXGA 2H8OA 5ILJA 2E94A 5CG5A 3WEHA 1YYTA 4NUAA 5JV0F 4RXCA 4LIXA 2DH4A 2F8ZF 4LZ0A 3KB9A 5DGSF 1N20A 1HM4A 1V4HA 4H5CF 5IK9A 3W7FA 2E8VA 2PS8A 5AYPA 5IK0A 1VG6A 3N1VF 2J1OA 3DYGA 4KUXA 2I19A 4KK2A 1RQIA 4JYXA 1V4JA 4DEMF 5DGMF 1EZFA 1N23A 4L2XF 4DWBA 4RXEA 3TFPA 1DGPA 1JFAA 5ERNA 3WCDA 5E8KA 3ZL6A 3MAVA 3KRCB 4LUUA 1WKZA 5CG6A 4OGUA 3ICMA 5B02A 3ICNA 5IKHA 2ONHA 2E93A 3KRPA 4KVYA 1VG7A 5DHKA 2J5CA 1WL0A 5ER8A 3TS7A 4F6VA 5I1UA 4LFEA 3PYAA 3VJBA 4NG6A 2E8UA 2AETA 3SDUA 2F89F 3TFVA 3LDWA 2F8CF 4ZQ8A 4KKMA 4EA2A 1N1ZA 4LFGA 1WL1A 3KRCA 5HNAA 5ILHA 5B01A 3N0GA 4RXAA 5A0KA 3EGTA 3KRFB 3WCHA 3P41A 5EATA 3P8LA 1PS1A 4LA5A 4P0VA 2AZJA 4NFIF 5DJRF 4RXDA 2J1PA 2Z4XA 4GP2A 1KIYA 1YYQA 1WMWA 3P5RA 2ZEUA 5AHUB 4LOBA 5ILIA 5JV2F 4JXYA 4NFJF 5IVGA 2ZCQA 3ZOUA 1YHMA 4OKZA 2PS6A 5EROA 4OMGA 4GAXA 2ZCSA 1JFGA 4LTVA 3BNXA 4GA3A 3LGKA 3ICKA 2E4OA 5JA0F 3WE9A 1YQ7A 5ILKA 3S4JA 3N46F 4LFVF 4JZXA 4LZCA 3NRIA 3WEIA 3G4DA 2PS7A 3MZVA 3WSBA 3KROB 3AQBB 3LVSA 3KBKA 1UBWA 3DYHA 3EFQA 4HD1A 4DI5A 4XQSF 1HXCA 4E1EA 3PYBA 1WY0A 4Q23A 3IBAA 4NKFA 4MC0A 1YYSA 3VJ9A 1RQJA 3WJNA 3Q2QA 2F94F 4PVYF 2OGDA 3WEFA 5IMPA 5B00A 4GP1A 1RTRA 4OMHA 2F9KF 5KSXF 4KFAA 3OYRA 3SDRA 2PS5A 4XQTF 3N1WF 5E8LA 4E9ZA 4JZBA 3Q1OA 4N9UA 3LMDA 3NPRA 4RYPA 1HXAA 5B0IA 5IMIA 5JUZF 2ONGA 1N22A 5B03A 4LZ3A 4F62A 4KVWA 2E8WA 3WCBA 1YYRA 3M9UA 3LSNA 4RNQA 3RMGA 3KRAB 3PKOA 4LLTA 4DZWA 5IMNA 2O1OA 3BNYA 3V1XA 4DWGA 1N24A 3ICZA 1WL2A 5C05A 1VG2A 2FTZA 3M00A 4DXJA 5IM1A 5DIQF 3OABB 5AFXA 2Z78A 3WC9A 5HN9A 5B0LA 5B0KA 2ZCOA 5HN8A 1N1BA 1V4KA 5A0IA 2F92F 4OKMA 4NFKF 1N21A
chains in the Genus database with same CATH topology
3V66A 3SAEA 3N3LF 3WCAA 4LPHF 2PS4A 3LK5A 3AE0A 1HX9A 5ILDA 5JV1F 3KRAA 4KQ5A 3NF2A 2E8XA 4KPDA 5DHIA 1UBVA 1UBYA 3M01A 4KVIA 2ZY1A 3V1VA 2E92A 5ILYA 1HM7A 4N1ZF 1YJ4A 3WCGA 3ID0A 3QQVA 3OABA 4P0WA 4JVJF 1UBXA 4LPGF 3LOMA 4KWDA 5IK6A 3KRFA 2OPMA 3N5HF 4E9UA 4EA1A 2AELA 4H5EF 3LJIA 3WEGA 4LA6A 3SDVA 2VF6A 4LXWA 5IL3A 2P1CA 3WCLA 3Q30A 3VJ8A 5IN8A 3NPKA 3VJAA 4KQSA 2Z4ZA 4LLSA 1YHLA 3ZCDA 5A0JA 3ADZA 3P8RA 3ACXA 5EAUA 3ZMCA 3LGZB 4K10A 5DJPF 4EA0A 3VJDA 2Z4WA 3UCAA 1V4IA 2OPNA 4KPJA 4UMJA 2OA6A 5DZ2A 4F6XA 3WEKA 1ZW5A 2ZEVA 2AZLA 3EZ3A 3N6KF 2Q9YA 1WL3A 3ASXA 1YV5A 2Z50A 2E91A 3SDTA 2RAHA 4DHDA 3TFNA 4FP4A 2ZCRA 5DJVF 5EASA 3WJKA 3OACB 3WCIA 3LLWA 1FPSA 5H9DA 3KRPB 3KROA 3WSAA 4XQRF 5DGNF 3WCFA 5IL8A 3TC1A 3ACYA 3LEEA 2Z4YA 5B0JA 2AZKA 3Q2ZA 3WEJA 2Z4VA 2F7MF 5B0MA 2Q9ZA 3CKEA 2E90A 3RYWA 3N0FA 2EWGA 4NKEA 5AELA 1KIZA 3AQCB 3OACA 3AQ0A 5HN7A 1VG4A 3WJOA 3ACWA 3RYEA 3WCJA 3RBMA 3LG5A 5ERMA 2AEKA 2Z7HA 4FJQA 3IPIA 5DW7A 4LTZA 3N3DA 4H5DF 3N49F 4KQUA 3CP6A 1YYUA 1V4EA 2E8TA 3B7LA 3LZ9A 2Z7IA 3N45F 3VJEA 3G4FA 3PDEA 3ZMBA 3QKCA 4MC3A 3DYFA 2QISA 3APZA 2FORA 4P0XA 3WCCA 4QPFA 5IKAA 4JXNA 4MC8A 4KVDA 3SDQA 2E95A 4WK5A 1VG3A 1YHKA 1DI1A 2Z52A 3PH7A 2Q58A 3CC9A 3P5PA 4PVXF 3WCEA 3WCMA 2Q80A 3N5JF 5ILZA 3VJCA 4QXSF 3M0GA 3M02A 3S9VA 5E8HA 1HXGA 2H8OA 5ILJA 2E94A 5CG5A 3WEHA 1YYTA 4NUAA 5JV0F 4RXCA 4LIXA 2DH4A 2F8ZF 4LZ0A 3KB9A 5DGSF 1N20A 1HM4A 1V4HA 4H5CF 5IK9A 3W7FA 2E8VA 2PS8A 5AYPA 5IK0A 1VG6A 3N1VF 2J1OA 3DYGA 4KUXA 2I19A 4KK2A 1RQIA 4JYXA 1V4JA 4DEMF 5DGMF 1EZFA 1N23A 4L2XF 4DWBA 4RXEA 3TFPA 1DGPA 1JFAA 5ERNA 3WCDA 5E8KA 3ZL6A 3MAVA 3KRCB 4LUUA 1WKZA 5CG6A 4OGUA 3ICMA 5B02A 3ICNA 5IKHA 2ONHA 2E93A 3KRPA 4KVYA 1VG7A 5DHKA 2J5CA 1WL0A 5ER8A 3TS7A 4F6VA 5I1UA 4LFEA 3PYAA 3VJBA 4NG6A 2E8UA 2AETA 3SDUA 2F89F 3TFVA 3LDWA 2F8CF 4ZQ8A 4KKMA 4EA2A 1N1ZA 4LFGA 1WL1A 3KRCA 5HNAA 5ILHA 5B01A 3N0GA 4RXAA 5A0KA 3EGTA 3KRFB 3WCHA 3P41A 5EATA 3P8LA 1PS1A 4LA5A 4P0VA 2AZJA 4NFIF 5DJRF 4RXDA 2J1PA 2Z4XA 4GP2A 1KIYA 1YYQA 1WMWA 3P5RA 2ZEUA 5AHUB 4LOBA 5ILIA 5JV2F 4JXYA 4NFJF 5IVGA 2ZCQA 3ZOUA 1YHMA 4OKZA 2PS6A 5EROA 4OMGA 4GAXA 2ZCSA 1JFGA 4LTVA 3BNXA 4GA3A 3LGKA 3ICKA 2E4OA 5JA0F 3WE9A 1YQ7A 5ILKA 3S4JA 3N46F 4LFVF 4JZXA 4LZCA 3NRIA 3WEIA 3G4DA 2PS7A 3MZVA 3WSBA 3KROB 3AQBB 3LVSA 3KBKA 1UBWA 3DYHA 3EFQA 4HD1A 4DI5A 4XQSF 1HXCA 4E1EA 3PYBA 1WY0A 4Q23A 3IBAA 4NKFA 4MC0A 1YYSA 3VJ9A 1RQJA 3WJNA 3Q2QA 2F94F 4PVYF 2OGDA 3WEFA 5IMPA 5B00A 4GP1A 1RTRA 4OMHA 2F9KF 5KSXF 4KFAA 3OYRA 3SDRA 2PS5A 4XQTF 3N1WF 5E8LA 4E9ZA 4JZBA 3Q1OA 4N9UA 3LMDA 3NPRA 4RYPA 1HXAA 5B0IA 5IMIA 5JUZF 2ONGA 1N22A 5B03A 4LZ3A 4F62A 4KVWA 2E8WA 3WCBA 1YYRA 3M9UA 3LSNA 4RNQA 3RMGA 3KRAB 3PKOA 4LLTA 4DZWA 5IMNA 2O1OA 3BNYA 3V1XA 4DWGA 1N24A 3ICZA 1WL2A 5C05A 1VG2A 2FTZA 3M00A 4DXJA 5IM1A 5DIQF 3OABB 5AFXA 2Z78A 3WC9A 5HN9A 5B0LA 5B0KA 2ZCOA 5HN8A 1N1BA 1V4KA 5A0IA 2F92F 4OKMA 4NFKF 1N21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V66 A;  3SAE A;  3N3L F;  3WCA A;  4LPH F;  2PS4 A;  3LK5 A;  3AE0 A;  1HX9 A;  5ILD A;  5JV1 F;  3KRA A;  4KQ5 A;  3NF2 A;  2E8X A;  4KPD A;  5DHI A;  1UBV A;  1UBY A;  3M01 A;  4KVI A;  2ZY1 A;  3V1V A;  2E92 A;  5ILY A;  1HM7 A;  4N1Z F;  1YJ4 A;  3WCG A;  3ID0 A;  3QQV A;  3OAB A;  4P0W A;  4JVJ F;  1UBX A;  4LPG F;  3LOM A;  4KWD A;  5IK6 A;  3KRF A;  2OPM A;  3N5H F;  4E9U A;  4EA1 A;  2AEL A;  4H5E F;  3LJI A;  3WEG A;  4LA6 A;  3SDV A;  2VF6 A;  4LXW A;  5IL3 A;  2P1C A;  3WCL A;  3Q30 A;  3VJ8 A;  5IN8 A;  3NPK A;  3VJA A;  4KQS A;  2Z4Z A;  4LLS A;  1YHL A;  3ZCD A;  5A0J A;  3ADZ A;  3P8R A;  3ACX A;  5EAU A;  3ZMC A;  3LGZ B;  4K10 A;  5DJP F;  4EA0 A;  3VJD A;  2Z4W A;  3UCA A;  1V4I A;  2OPN A;  4KPJ A;  4UMJ A;  2OA6 A;  5DZ2 A;  4F6X A;  3WEK A;  1ZW5 A;  2ZEV A;  2AZL A;  3EZ3 A;  3N6K F;  2Q9Y A;  1WL3 A;  3ASX A;  1YV5 A;  2Z50 A;  2E91 A;  3SDT A;  2RAH A;  4DHD A;  3TFN A;  4FP4 A;  2ZCR A;  5DJV F;  5EAS A;  3WJK A;  3OAC B;  3WCI A;  3LLW A;  1FPS A;  5H9D A;  3KRP B;  3KRO A;  3WSA A;  4XQR F;  5DGN F;  3WCF A;  5IL8 A;  3TC1 A;  3ACY A;  3LEE A;  2Z4Y A;  5B0J A;  2AZK A;  3Q2Z A;  3WEJ A;  2Z4V A;  2F7M F;  5B0M A;  2Q9Z A;  3CKE A;  2E90 A;  3RYW A;  3N0F A;  2EWG A;  4NKE A;  5AEL A;  1KIZ A;  3AQC B;  3OAC A;  3AQ0 A;  5HN7 A;  1VG4 A;  3WJO A;  3ACW A;  3RYE A;  3WCJ A;  3RBM A;  3LG5 A;  5ERM A;  2AEK A;  2Z7H A;  4FJQ A;  3IPI A;  5DW7 A;  4LTZ A;  3N3D A;  4H5D F;  3N49 F;  4KQU A;  3CP6 A;  1YYU A;  1V4E A;  2E8T A;  3B7L A;  3LZ9 A;  2Z7I A;  3N45 F;  3VJE A;  3G4F A;  3PDE A;  3ZMB A;  3QKC A;  4MC3 A;  3DYF A;  2QIS A;  3APZ A;  2FOR A;  4P0X A;  3WCC A;  4QPF A;  5IKA A;  4JXN A;  4MC8 A;  4KVD A;  3SDQ A;  2E95 A;  4WK5 A;  1VG3 A;  1YHK A;  1DI1 A;  2Z52 A;  3PH7 A;  2Q58 A;  3CC9 A;  3P5P A;  4PVX F;  3WCE A;  3WCM A;  2Q80 A;  3N5J F;  5ILZ A;  3VJC A;  4QXS F;  3M0G A;  3M02 A;  3S9V A;  5E8H A;  1HXG A;  2H8O A;  5ILJ A;  2E94 A;  5CG5 A;  3WEH A;  1YYT A;  4NUA A;  5JV0 F;  4RXC A;  4LIX A;  2DH4 A;  2F8Z F;  4LZ0 A;  3KB9 A;  5DGS F;  1N20 A;  1HM4 A;  1V4H A;  4H5C F;  5IK9 A;  3W7F A;  2E8V A;  2PS8 A;  5AYP A;  5IK0 A;  1VG6 A;  3N1V F;  2J1O A;  3DYG A;  4KUX A;  2I19 A;  4KK2 A;  1RQI A;  4JYX A;  1V4J A;  4DEM F;  5DGM F;  1EZF A;  1N23 A;  4L2X F;  4DWB A;  4RXE A;  3TFP A;  1DGP A;  1JFA A;  5ERN A;  3WCD A;  5E8K A;  3ZL6 A;  3MAV A;  3KRC B;  4LUU A;  1WKZ A;  5CG6 A;  4OGU A;  3ICM A;  5B02 A;  3ICN A;  5IKH A;  2ONH A;  2E93 A;  3KRP A;  4KVY A;  1VG7 A;  5DHK A;  2J5C A;  1WL0 A;  5ER8 A;  3TS7 A;  4F6V A;  5I1U A;  4LFE A;  3PYA A;  3VJB A;  4NG6 A;  2E8U A;  2AET A;  3SDU A;  2F89 F;  3TFV A;  3LDW A;  2F8C F;  4ZQ8 A;  4KKM A;  4EA2 A;  1N1Z A;  4LFG A;  1WL1 A;  3KRC A;  5HNA A;  5ILH A;  5B01 A;  3N0G A;  4RXA A;  5A0K A;  3EGT A;  3KRF B;  3WCH A;  3P41 A;  5EAT A;  3P8L A;  1PS1 A;  4LA5 A;  4P0V A;  2AZJ A;  4NFI F;  5DJR F;  4RXD A;  2J1P A;  2Z4X A;  4GP2 A;  1KIY A;  1YYQ A;  1WMW A;  3P5R A;  2ZEU A;  5AHU B;  4LOB A;  5ILI A;  5JV2 F;  4JXY A;  4NFJ F;  5IVG A;  2ZCQ A;  3ZOU A;  1YHM A;  4OKZ A;  2PS6 A;  5ERO A;  4OMG A;  4GAX A;  2ZCS A;  1JFG A;  4LTV A;  3BNX A;  4GA3 A;  3LGK A;  3ICK A;  2E4O A;  5JA0 F;  3WE9 A;  1YQ7 A;  5ILK A;  3S4J A;  3N46 F;  4LFV F;  4JZX A;  4LZC A;  3NRI A;  3WEI A;  3G4D A;  2PS7 A;  3MZV A;  3WSB A;  3KRO B;  3AQB B;  3LVS A;  3KBK A;  1UBW A;  3DYH A;  3EFQ A;  4HD1 A;  4DI5 A;  4XQS F;  1HXC A;  4E1E A;  3PYB A;  1WY0 A;  4Q23 A;  3IBA A;  4NKF A;  4MC0 A;  1YYS A;  3VJ9 A;  1RQJ A;  3WJN A;  3Q2Q A;  2F94 F;  4PVY F;  2OGD A;  3WEF A;  5IMP A;  5B00 A;  4GP1 A;  1RTR A;  4OMH A;  2F9K F;  5KSX F;  4KFA A;  3OYR A;  3SDR A;  2PS5 A;  4XQT F;  3N1W F;  5E8L A;  4E9Z A;  4JZB A;  3Q1O A;  4N9U A;  3LMD A;  3NPR A;  4RYP A;  1HXA A;  5B0I A;  5IMI A;  5JUZ F;  2ONG A;  1N22 A;  5B03 A;  4LZ3 A;  4F62 A;  4KVW A;  2E8W A;  3WCB A;  1YYR A;  3M9U A;  3LSN A;  4RNQ A;  3RMG A;  3KRA B;  3PKO A;  4LLT A;  4DZW A;  5IMN A;  2O1O A;  3BNY A;  3V1X A;  4DWG A;  1N24 A;  3ICZ A;  1WL2 A;  5C05 A;  1VG2 A;  2FTZ A;  3M00 A;  4DXJ A;  5IM1 A;  5DIQ F;  3OAB B;  5AFX A;  2Z78 A;  3WC9 A;  5HN9 A;  5B0L A;  5B0K A;  2ZCO A;  5HN8 A;  1N1B A;  1V4K A;  5A0I A;  2F92 F;  4OKM A;  4NFK F;  1N21 A; 
#chains in the Genus database with same CATH topology
 3V66 A;  3SAE A;  3N3L F;  3WCA A;  4LPH F;  2PS4 A;  3LK5 A;  3AE0 A;  1HX9 A;  5ILD A;  5JV1 F;  3KRA A;  4KQ5 A;  3NF2 A;  2E8X A;  4KPD A;  5DHI A;  1UBV A;  1UBY A;  3M01 A;  4KVI A;  2ZY1 A;  3V1V A;  2E92 A;  5ILY A;  1HM7 A;  4N1Z F;  1YJ4 A;  3WCG A;  3ID0 A;  3QQV A;  3OAB A;  4P0W A;  4JVJ F;  1UBX A;  4LPG F;  3LOM A;  4KWD A;  5IK6 A;  3KRF A;  2OPM A;  3N5H F;  4E9U A;  4EA1 A;  2AEL A;  4H5E F;  3LJI A;  3WEG A;  4LA6 A;  3SDV A;  2VF6 A;  4LXW A;  5IL3 A;  2P1C A;  3WCL A;  3Q30 A;  3VJ8 A;  5IN8 A;  3NPK A;  3VJA A;  4KQS A;  2Z4Z A;  4LLS A;  1YHL A;  3ZCD A;  5A0J A;  3ADZ A;  3P8R A;  3ACX A;  5EAU A;  3ZMC A;  3LGZ B;  4K10 A;  5DJP F;  4EA0 A;  3VJD A;  2Z4W A;  3UCA A;  1V4I A;  2OPN A;  4KPJ A;  4UMJ A;  2OA6 A;  5DZ2 A;  4F6X A;  3WEK A;  1ZW5 A;  2ZEV A;  2AZL A;  3EZ3 A;  3N6K F;  2Q9Y A;  1WL3 A;  3ASX A;  1YV5 A;  2Z50 A;  2E91 A;  3SDT A;  2RAH A;  4DHD A;  3TFN A;  4FP4 A;  2ZCR A;  5DJV F;  5EAS A;  3WJK A;  3OAC B;  3WCI A;  3LLW A;  1FPS A;  5H9D A;  3KRP B;  3KRO A;  3WSA A;  4XQR F;  5DGN F;  3WCF A;  5IL8 A;  3TC1 A;  3ACY A;  3LEE A;  2Z4Y A;  5B0J A;  2AZK A;  3Q2Z A;  3WEJ A;  2Z4V A;  2F7M F;  5B0M A;  2Q9Z A;  3CKE A;  2E90 A;  3RYW A;  3N0F A;  2EWG A;  4NKE A;  5AEL A;  1KIZ A;  3AQC B;  3OAC A;  3AQ0 A;  5HN7 A;  1VG4 A;  3WJO A;  3ACW A;  3RYE A;  3WCJ A;  3RBM A;  3LG5 A;  5ERM A;  2AEK A;  2Z7H A;  4FJQ A;  3IPI A;  5DW7 A;  4LTZ A;  3N3D A;  4H5D F;  3N49 F;  4KQU A;  3CP6 A;  1YYU A;  1V4E A;  2E8T A;  3B7L A;  3LZ9 A;  2Z7I A;  3N45 F;  3VJE A;  3G4F A;  3PDE A;  3ZMB A;  3QKC A;  4MC3 A;  3DYF A;  2QIS A;  3APZ A;  2FOR A;  4P0X A;  3WCC A;  4QPF A;  5IKA A;  4JXN A;  4MC8 A;  4KVD A;  3SDQ A;  2E95 A;  4WK5 A;  1VG3 A;  1YHK A;  1DI1 A;  2Z52 A;  3PH7 A;  2Q58 A;  3CC9 A;  3P5P A;  4PVX F;  3WCE A;  3WCM A;  2Q80 A;  3N5J F;  5ILZ A;  3VJC A;  4QXS F;  3M0G A;  3M02 A;  3S9V A;  5E8H A;  1HXG A;  2H8O A;  5ILJ A;  2E94 A;  5CG5 A;  3WEH A;  1YYT A;  4NUA A;  5JV0 F;  4RXC A;  4LIX A;  2DH4 A;  2F8Z F;  4LZ0 A;  3KB9 A;  5DGS F;  1N20 A;  1HM4 A;  1V4H A;  4H5C F;  5IK9 A;  3W7F A;  2E8V A;  2PS8 A;  5AYP A;  5IK0 A;  1VG6 A;  3N1V F;  2J1O A;  3DYG A;  4KUX A;  2I19 A;  4KK2 A;  1RQI A;  4JYX A;  1V4J A;  4DEM F;  5DGM F;  1EZF A;  1N23 A;  4L2X F;  4DWB A;  4RXE A;  3TFP A;  1DGP A;  1JFA A;  5ERN A;  3WCD A;  5E8K A;  3ZL6 A;  3MAV A;  3KRC B;  4LUU A;  1WKZ A;  5CG6 A;  4OGU A;  3ICM A;  5B02 A;  3ICN A;  5IKH A;  2ONH A;  2E93 A;  3KRP A;  4KVY A;  1VG7 A;  5DHK A;  2J5C A;  1WL0 A;  5ER8 A;  3TS7 A;  4F6V A;  5I1U A;  4LFE A;  3PYA A;  3VJB A;  4NG6 A;  2E8U A;  2AET A;  3SDU A;  2F89 F;  3TFV A;  3LDW A;  2F8C F;  4ZQ8 A;  4KKM A;  4EA2 A;  1N1Z A;  4LFG A;  1WL1 A;  3KRC A;  5HNA A;  5ILH A;  5B01 A;  3N0G A;  4RXA A;  5A0K A;  3EGT A;  3KRF B;  3WCH A;  3P41 A;  5EAT A;  3P8L A;  1PS1 A;  4LA5 A;  4P0V A;  2AZJ A;  4NFI F;  5DJR F;  4RXD A;  2J1P A;  2Z4X A;  4GP2 A;  1KIY A;  1YYQ A;  1WMW A;  3P5R A;  2ZEU A;  5AHU B;  4LOB A;  5ILI A;  5JV2 F;  4JXY A;  4NFJ F;  5IVG A;  2ZCQ A;  3ZOU A;  1YHM A;  4OKZ A;  2PS6 A;  5ERO A;  4OMG A;  4GAX A;  2ZCS A;  1JFG A;  4LTV A;  3BNX A;  4GA3 A;  3LGK A;  3ICK A;  2E4O A;  5JA0 F;  3WE9 A;  1YQ7 A;  5ILK A;  3S4J A;  3N46 F;  4LFV F;  4JZX A;  4LZC A;  3NRI A;  3WEI A;  3G4D A;  2PS7 A;  3MZV A;  3WSB A;  3KRO B;  3AQB B;  3LVS A;  3KBK A;  1UBW A;  3DYH A;  3EFQ A;  4HD1 A;  4DI5 A;  4XQS F;  1HXC A;  4E1E A;  3PYB A;  1WY0 A;  4Q23 A;  3IBA A;  4NKF A;  4MC0 A;  1YYS A;  3VJ9 A;  1RQJ A;  3WJN A;  3Q2Q A;  2F94 F;  4PVY F;  2OGD A;  3WEF A;  5IMP A;  5B00 A;  4GP1 A;  1RTR A;  4OMH A;  2F9K F;  5KSX F;  4KFA A;  3OYR A;  3SDR A;  2PS5 A;  4XQT F;  3N1W F;  5E8L A;  4E9Z A;  4JZB A;  3Q1O A;  4N9U A;  3LMD A;  3NPR A;  4RYP A;  1HXA A;  5B0I A;  5IMI A;  5JUZ F;  2ONG A;  1N22 A;  5B03 A;  4LZ3 A;  4F62 A;  4KVW A;  2E8W A;  3WCB A;  1YYR A;  3M9U A;  3LSN A;  4RNQ A;  3RMG A;  3KRA B;  3PKO A;  4LLT A;  4DZW A;  5IMN A;  2O1O A;  3BNY A;  3V1X A;  4DWG A;  1N24 A;  3ICZ A;  1WL2 A;  5C05 A;  1VG2 A;  2FTZ A;  3M00 A;  4DXJ A;  5IM1 A;  5DIQ F;  3OAB B;  5AFX A;  2Z78 A;  3WC9 A;  5HN9 A;  5B0L A;  5B0K A;  2ZCO A;  5HN8 A;  1N1B A;  1V4K A;  5A0I A;  2F92 F;  4OKM A;  4NFK F;  1N21 A; 
#chains in the Genus database with same CATH homology
 3V66 A;  3SAE A;  3N3L F;  3WCA A;  4LPH F;  2PS4 A;  3LK5 A;  3AE0 A;  1HX9 A;  5ILD A;  5JV1 F;  3KRA A;  4KQ5 A;  3NF2 A;  2E8X A;  4KPD A;  5DHI A;  1UBV A;  1UBY A;  3M01 A;  4KVI A;  2ZY1 A;  3V1V A;  2E92 A;  5ILY A;  1HM7 A;  4N1Z F;  1YJ4 A;  3WCG A;  3ID0 A;  3QQV A;  3OAB A;  4P0W A;  4JVJ F;  1UBX A;  4LPG F;  3LOM A;  4KWD A;  5IK6 A;  3KRF A;  2OPM A;  3N5H F;  4E9U A;  4EA1 A;  2AEL A;  4H5E F;  3LJI A;  3WEG A;  4LA6 A;  3SDV A;  2VF6 A;  4LXW A;  5IL3 A;  2P1C A;  3WCL A;  3Q30 A;  3VJ8 A;  5IN8 A;  3NPK A;  3VJA A;  4KQS A;  2Z4Z A;  4LLS A;  1YHL A;  3ZCD A;  5A0J A;  3ADZ A;  3P8R A;  3ACX A;  5EAU A;  3ZMC A;  3LGZ B;  4K10 A;  5DJP F;  4EA0 A;  3VJD A;  2Z4W A;  3UCA A;  1V4I A;  2OPN A;  4KPJ A;  4UMJ A;  2OA6 A;  5DZ2 A;  4F6X A;  3WEK A;  1ZW5 A;  2ZEV A;  2AZL A;  3EZ3 A;  3N6K F;  2Q9Y A;  1WL3 A;  3ASX A;  1YV5 A;  2Z50 A;  2E91 A;  3SDT A;  2RAH A;  4DHD A;  3TFN A;  4FP4 A;  2ZCR A;  5DJV F;  5EAS A;  3WJK A;  3OAC B;  3WCI A;  3LLW A;  1FPS A;  5H9D A;  3KRP B;  3KRO A;  3WSA A;  4XQR F;  5DGN F;  3WCF A;  5IL8 A;  3TC1 A;  3ACY A;  3LEE A;  2Z4Y A;  5B0J A;  2AZK A;  3Q2Z A;  3WEJ A;  2Z4V A;  2F7M F;  5B0M A;  2Q9Z A;  3CKE A;  2E90 A;  3RYW A;  3N0F A;  2EWG A;  4NKE A;  5AEL A;  1KIZ A;  3AQC B;  3OAC A;  3AQ0 A;  5HN7 A;  1VG4 A;  3WJO A;  3ACW A;  3RYE A;  3WCJ A;  3RBM A;  3LG5 A;  5ERM A;  2AEK A;  2Z7H A;  4FJQ A;  3IPI A;  5DW7 A;  4LTZ A;  3N3D A;  4H5D F;  3N49 F;  4KQU A;  3CP6 A;  1YYU A;  1V4E A;  2E8T A;  3B7L A;  3LZ9 A;  2Z7I A;  3N45 F;  3VJE A;  3G4F A;  3PDE A;  3ZMB A;  3QKC A;  4MC3 A;  3DYF A;  2QIS A;  3APZ A;  2FOR A;  4P0X A;  3WCC A;  4QPF A;  5IKA A;  4JXN A;  4MC8 A;  4KVD A;  3SDQ A;  2E95 A;  4WK5 A;  1VG3 A;  1YHK A;  1DI1 A;  2Z52 A;  3PH7 A;  2Q58 A;  3CC9 A;  3P5P A;  4PVX F;  3WCE A;  3WCM A;  2Q80 A;  3N5J F;  5ILZ A;  3VJC A;  4QXS F;  3M0G A;  3M02 A;  3S9V A;  5E8H A;  1HXG A;  2H8O A;  5ILJ A;  2E94 A;  5CG5 A;  3WEH A;  1YYT A;  4NUA A;  5JV0 F;  4RXC A;  4LIX A;  2DH4 A;  2F8Z F;  4LZ0 A;  3KB9 A;  5DGS F;  1N20 A;  1HM4 A;  1V4H A;  4H5C F;  5IK9 A;  3W7F A;  2E8V A;  2PS8 A;  5AYP A;  5IK0 A;  1VG6 A;  3N1V F;  2J1O A;  3DYG A;  4KUX A;  2I19 A;  4KK2 A;  1RQI A;  4JYX A;  1V4J A;  4DEM F;  5DGM F;  1EZF A;  1N23 A;  4L2X F;  4DWB A;  4RXE A;  3TFP A;  1DGP A;  1JFA A;  5ERN A;  3WCD A;  5E8K A;  3ZL6 A;  3MAV A;  3KRC B;  4LUU A;  1WKZ A;  5CG6 A;  4OGU A;  3ICM A;  5B02 A;  3ICN A;  5IKH A;  2ONH A;  2E93 A;  3KRP A;  4KVY A;  1VG7 A;  5DHK A;  2J5C A;  1WL0 A;  5ER8 A;  3TS7 A;  4F6V A;  5I1U A;  4LFE A;  3PYA A;  3VJB A;  4NG6 A;  2E8U A;  2AET A;  3SDU A;  2F89 F;  3TFV A;  3LDW A;  2F8C F;  4ZQ8 A;  4KKM A;  4EA2 A;  1N1Z A;  4LFG A;  1WL1 A;  3KRC A;  5HNA A;  5ILH A;  5B01 A;  3N0G A;  4RXA A;  5A0K A;  3EGT A;  3KRF B;  3WCH A;  3P41 A;  5EAT A;  3P8L A;  1PS1 A;  4LA5 A;  4P0V A;  2AZJ A;  4NFI F;  5DJR F;  4RXD A;  2J1P A;  2Z4X A;  4GP2 A;  1KIY A;  1YYQ A;  1WMW A;  3P5R A;  2ZEU A;  5AHU B;  4LOB A;  5ILI A;  5JV2 F;  4JXY A;  4NFJ F;  5IVG A;  2ZCQ A;  3ZOU A;  1YHM A;  4OKZ A;  2PS6 A;  5ERO A;  4OMG A;  4GAX A;  2ZCS A;  1JFG A;  4LTV A;  3BNX A;  4GA3 A;  3LGK A;  3ICK A;  2E4O A;  5JA0 F;  3WE9 A;  1YQ7 A;  5ILK A;  3S4J A;  3N46 F;  4LFV F;  4JZX A;  4LZC A;  3NRI A;  3WEI A;  3G4D A;  2PS7 A;  3MZV A;  3WSB A;  3KRO B;  3AQB B;  3LVS A;  3KBK A;  1UBW A;  3DYH A;  3EFQ A;  4HD1 A;  4DI5 A;  4XQS F;  1HXC A;  4E1E A;  3PYB A;  1WY0 A;  4Q23 A;  3IBA A;  4NKF A;  4MC0 A;  1YYS A;  3VJ9 A;  1RQJ A;  3WJN A;  3Q2Q A;  2F94 F;  4PVY F;  2OGD A;  3WEF A;  5IMP A;  5B00 A;  4GP1 A;  1RTR A;  4OMH A;  2F9K F;  5KSX F;  4KFA A;  3OYR A;  3SDR A;  2PS5 A;  4XQT F;  3N1W F;  5E8L A;  4E9Z A;  4JZB A;  3Q1O A;  4N9U A;  3LMD A;  3NPR A;  4RYP A;  1HXA A;  5B0I A;  5IMI A;  5JUZ F;  2ONG A;  1N22 A;  5B03 A;  4LZ3 A;  4F62 A;  4KVW A;  2E8W A;  3WCB A;  1YYR A;  3M9U A;  3LSN A;  4RNQ A;  3RMG A;  3KRA B;  3PKO A;  4LLT A;  4DZW A;  5IMN A;  2O1O A;  3BNY A;  3V1X A;  4DWG A;  1N24 A;  3ICZ A;  1WL2 A;  5C05 A;  1VG2 A;  2FTZ A;  3M00 A;  4DXJ A;  5IM1 A;  5DIQ F;  3OAB B;  5AFX A;  2Z78 A;  3WC9 A;  5HN9 A;  5B0L A;  5B0K A;  2ZCO A;  5HN8 A;  1N1B A;  1V4K A;  5A0I A;  2F92 F;  4OKM A;  4NFK F;  1N21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...