5AELA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-597
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
367
structure length
357
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FARNESYL PYROPHOSPHATE SYNTHASE
publication title Inhibition of Trypanosoma Brucei Cell Growth by Lipophilic Bisphosphonates: An in Vitro and in Vivo Investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 148
structure length 357
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2014-12-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5aelA00
3IPIA 4RXCA 4LTZA 5DW7A 3P5RA 2J5CA 4KQUA 1N20A 5EASA 4F6VA 3S4JA 4OGUA 3WCMA 3VJ9A 3M00A 2OPMA 1V4EA 3WCDA 4XQRF 1JFGA 2J1PA 3VJDA 1YQ7A 2E8WA 3DYGA 4JZXA 4KK2A 2F8CF 3RMGA 2ZCOA 3CP6A 4UMJA 4JYXA 4E9ZA 2E8UA 1DGPA 4NKFA 2QISA 3WJOA 3Q30A 3SDRA 5I1UA 3WCJA 5IM1A 2E92A 5ILKA 3ZCDA 3QKCA 3ACXA 3SAEA 5HN7A 5KSXF 3TS7A 3LSNA 4ZQ8A 5DJPF 1JFAA 5DHKA 4EA0A 2Q9ZA 3KROB 5IVGA 3M02A 1VG4A 5AYPA 4KVIA 3DYFA 4LTVA 3KRCB 1HX9A 2DH4A 1WL1A 1WY0A 4H5CF 3KROA 3N1WF 2O1OA 2E8VA 4PVXF 1N1ZA 3WEJA 3LEEA 5IL8A 1WKZA 3P41A 4KFAA 3N0FA 3LZ9A 4Q23A 3G4FA 5B0MA 2E8TA 1YYRA 3CKEA 2Z4YA 3EGTA 3WCFA 5B00A 5IMPA 5B03A 2ZY1A 5AELA 3OACA 3WSBA 4OKMA 3WJKA 5IMIA 3ACWA 1HXCA 2ZEVA 1N21A 3OABA 5JV1F 5A0IA 3N6KF 2ZCRA 2H8OA 4LLSA 4GP1A 2Z4XA 5CG5A 3M0GA 4KPJA 4MC3A 3N3LF 4EA2A 5HNAA 3AQ0A 3S9VA 3LOMA 3LDWA 3LVSA 5AFXA 3VJBA 3W7FA 2AZLA 5ILIA 4L2XF 3ICZA 4H5EF 2P1CA 5DIQF 3KB9A 5B0KA 2VF6A 4F6XA 4KPDA 2EWGA 5ILHA 4QXSF 1WL0A 3APZA 3WCBA 2F92F 4DZWA 2OGDA 3N5HF 4OMHA 4DI5A 5IK6A 3ICKA 1N1BA 2PS6A 2Z78A 3M01A 3WCCA 4MC8A 1VG7A 1ZW5A 3AQCB 3B7LA 1YYQA 2F94F 4KKMA 3ASXA 3LLWA 2F89F 4DXJA 4NG6A 2OPNA 3NRIA 1YYUA 3TC1A 4LFGA 5ILJA 4OKZA 2I19A 3V1XA 3VJEA 5JA0F 3KRFB 2PS8A 4DEMF 1YV5A 5EATA 2Q58A 3AQBB 4LZ0A 3WCIA 4LA5A 3SDQA 5DHIA 3EZ3A 1N22A 1RTRA 5ILZA 3P8RA 3NF2A 2F7MF 1V4HA 5B02A 1PS1A 3QQVA 5JUZF 3VJ8A 1HM7A 4N1ZF 2Q9YA 5IN8A 3Q2QA 1V4IA 4LXWA 1KIZA 1VG3A 4KUXA 1HXGA 3G4DA 3KBKA 4LPGF 3KRCA 3VJCA 4F62A 1V4KA 5CG6A 2Z4ZA 3VJAA 3SDVA 5ILDA 4NFKF 3OYRA 2Z7HA 4NKEA 3N5JF 5ER8A 3MAVA 3ADZA 2FORA 3LMDA 4LFVF 4N9UA 2RAHA 4JVJF 1YYTA 5JV2F 4GA3A 4KQ5A 5E8LA 2E90A 3ICMA 5ERNA 2E4OA 3PH7A 3NPRA 1UBXA 2Z4WA 3RBMA 2AZKA 4KVYA 4LOBA 4JZBA 3KRAB 4GAXA 5DJVF 3V66A 5ERMA 2OA6A 3LJIA 3MZVA 5DGNF 3WJNA 4H5DF 4XQSF 1V4JA 3DYHA 2PS4A 5EAUA 5IK0A 3WCLA 3PYAA 4P0VA 5B01A 3WC9A 3WEIA 3N45F 2E91A 2ZCSA 3SDTA 4RXEA 3KRPB 2ZCQA 1UBYA 4LZ3A 1WL3A 1VG6A 4KWDA 5B0IA 2F8ZF 3NPKA 2AELA 1WMWA 3PDEA 3LGZB 1HM4A 1HXAA 2AEKA 3WEFA 3N1VF 1VG2A 3Q1OA 5AHUB 3RYEA 5HN9A 4LZCA 4KVDA 4QPFA 1WL2A 3LK5A 2ONGA 3EFQA 4RXDA 5IMNA 2J1OA 4KQSA 4LPHF 4NUAA 3TFPA 5A0JA 5IL3A 3KRFA 4HD1A 1N24A 3ZL6A 3IBAA 4WK5A 3ID0A 3Q2ZA 1UBWA 5DGSF 1YHLA 3V1VA 4JXNA 3ACYA 4NFIF 3N49F 4RYPA 5DJRF 3WCAA 2Q80A 2ONHA 4EA1A 5C05A 4P0XA 5A0KA 3BNXA 2E95A 5H9DA 2Z4VA 3LGKA 3N0GA 3LG5A 4OMGA 4FJQA 3SDUA 3PYBA 2Z52A 4RXAA 3CC9A 3ICNA 4LFEA 4E1EA 4GP2A 5EROA 1KIYA 2AETA 5HN8A 3WCEA 1UBVA 5B0JA 2ZEUA 3OACB 4KVWA 3WEGA 4P0WA 3RYWA 3TFVA 2Z50A 5IKAA 1N23A 2E94A 4E9UA 1YHMA 2Z7IA 5ILYA 3WEKA 3OABB 4DWGA 3ZOUA 4DHDA 3WEHA 3AE0A 3BNYA 2E93A 1DI1A 2PS7A 3WE9A 1RQJA 3P8LA 4XQTF 3M9UA 1RQIA 3P5PA 4LLTA 3KRAA 3PKOA 1FPSA 4MC0A 2PS5A 5IKHA 3WSAA 4RNQA 1EZFA 3WCGA 4LUUA 5JV0F 3UCAA 2AZJA 4JXYA 4LIXA 3ZMBA 4LA6A 4DWBA 3N46F 4FP4A 5DZ2A 4NFJF 3TFNA 3WCHA 2FTZA 5E8KA 5E8HA 5DGMF 4K10A 1YJ4A 4PVYF 1YHKA 3KRPA 2F9KF 2E8XA 3ZMCA 5B0LA 3N3DA 1YYSA 5IK9A
chains in the Genus database with same CATH superfamily
3IPIA 4RXCA 4LTZA 5DW7A 3P5RA 2J5CA 4KQUA 1N20A 5EASA 4F6VA 3S4JA 4OGUA 3WCMA 3VJ9A 3M00A 2OPMA 1V4EA 3WCDA 4XQRF 1JFGA 2J1PA 3VJDA 1YQ7A 2E8WA 3DYGA 4JZXA 4KK2A 2F8CF 3RMGA 2ZCOA 3CP6A 4UMJA 4JYXA 4E9ZA 2E8UA 1DGPA 4NKFA 2QISA 3WJOA 3Q30A 3SDRA 5I1UA 3WCJA 5IM1A 2E92A 5ILKA 3ZCDA 3QKCA 3ACXA 3SAEA 5HN7A 5KSXF 3TS7A 3LSNA 4ZQ8A 5DJPF 1JFAA 5DHKA 4EA0A 2Q9ZA 3KROB 5IVGA 3M02A 1VG4A 5AYPA 4KVIA 3DYFA 4LTVA 3KRCB 1HX9A 2DH4A 1WL1A 1WY0A 4H5CF 3KROA 3N1WF 2O1OA 2E8VA 4PVXF 1N1ZA 3WEJA 3LEEA 5IL8A 1WKZA 3P41A 4KFAA 3N0FA 3LZ9A 4Q23A 3G4FA 5B0MA 2E8TA 1YYRA 3CKEA 2Z4YA 3EGTA 3WCFA 5B00A 5IMPA 5B03A 2ZY1A 5AELA 3OACA 3WSBA 4OKMA 3WJKA 5IMIA 3ACWA 1HXCA 2ZEVA 1N21A 3OABA 5JV1F 5A0IA 3N6KF 2ZCRA 2H8OA 4LLSA 4GP1A 2Z4XA 5CG5A 3M0GA 4KPJA 4MC3A 3N3LF 4EA2A 5HNAA 3AQ0A 3S9VA 3LOMA 3LDWA 3LVSA 5AFXA 3VJBA 3W7FA 2AZLA 5ILIA 4L2XF 3ICZA 4H5EF 2P1CA 5DIQF 3KB9A 5B0KA 2VF6A 4F6XA 4KPDA 2EWGA 5ILHA 4QXSF 1WL0A 3APZA 3WCBA 2F92F 4DZWA 2OGDA 3N5HF 4OMHA 4DI5A 5IK6A 3ICKA 1N1BA 2PS6A 2Z78A 3M01A 3WCCA 4MC8A 1VG7A 1ZW5A 3AQCB 3B7LA 1YYQA 2F94F 4KKMA 3ASXA 3LLWA 2F89F 4DXJA 4NG6A 2OPNA 3NRIA 1YYUA 3TC1A 4LFGA 5ILJA 4OKZA 2I19A 3V1XA 3VJEA 5JA0F 3KRFB 2PS8A 4DEMF 1YV5A 5EATA 2Q58A 3AQBB 4LZ0A 3WCIA 4LA5A 3SDQA 5DHIA 3EZ3A 1N22A 1RTRA 5ILZA 3P8RA 3NF2A 2F7MF 1V4HA 5B02A 1PS1A 3QQVA 5JUZF 3VJ8A 1HM7A 4N1ZF 2Q9YA 5IN8A 3Q2QA 1V4IA 4LXWA 1KIZA 1VG3A 4KUXA 1HXGA 3G4DA 3KBKA 4LPGF 3KRCA 3VJCA 4F62A 1V4KA 5CG6A 2Z4ZA 3VJAA 3SDVA 5ILDA 4NFKF 3OYRA 2Z7HA 4NKEA 3N5JF 5ER8A 3MAVA 3ADZA 2FORA 3LMDA 4LFVF 4N9UA 2RAHA 4JVJF 1YYTA 5JV2F 4GA3A 4KQ5A 5E8LA 2E90A 3ICMA 5ERNA 2E4OA 3PH7A 3NPRA 1UBXA 2Z4WA 3RBMA 2AZKA 4KVYA 4LOBA 4JZBA 3KRAB 4GAXA 5DJVF 3V66A 5ERMA 2OA6A 3LJIA 3MZVA 5DGNF 3WJNA 4H5DF 4XQSF 1V4JA 3DYHA 2PS4A 5EAUA 5IK0A 3WCLA 3PYAA 4P0VA 5B01A 3WC9A 3WEIA 3N45F 2E91A 2ZCSA 3SDTA 4RXEA 3KRPB 2ZCQA 1UBYA 4LZ3A 1WL3A 1VG6A 4KWDA 5B0IA 2F8ZF 3NPKA 2AELA 1WMWA 3PDEA 3LGZB 1HM4A 1HXAA 2AEKA 3WEFA 3N1VF 1VG2A 3Q1OA 5AHUB 3RYEA 5HN9A 4LZCA 4KVDA 4QPFA 1WL2A 3LK5A 2ONGA 3EFQA 4RXDA 5IMNA 2J1OA 4KQSA 4LPHF 4NUAA 3TFPA 5A0JA 5IL3A 3KRFA 4HD1A 1N24A 3ZL6A 3IBAA 4WK5A 3ID0A 3Q2ZA 1UBWA 5DGSF 1YHLA 3V1VA 4JXNA 3ACYA 4NFIF 3N49F 4RYPA 5DJRF 3WCAA 2Q80A 2ONHA 4EA1A 5C05A 4P0XA 5A0KA 3BNXA 2E95A 5H9DA 2Z4VA 3LGKA 3N0GA 3LG5A 4OMGA 4FJQA 3SDUA 3PYBA 2Z52A 4RXAA 3CC9A 3ICNA 4LFEA 4E1EA 4GP2A 5EROA 1KIYA 2AETA 5HN8A 3WCEA 1UBVA 5B0JA 2ZEUA 3OACB 4KVWA 3WEGA 4P0WA 3RYWA 3TFVA 2Z50A 5IKAA 1N23A 2E94A 4E9UA 1YHMA 2Z7IA 5ILYA 3WEKA 3OABB 4DWGA 3ZOUA 4DHDA 3WEHA 3AE0A 3BNYA 2E93A 1DI1A 2PS7A 3WE9A 1RQJA 3P8LA 4XQTF 3M9UA 1RQIA 3P5PA 4LLTA 3KRAA 3PKOA 1FPSA 4MC0A 2PS5A 5IKHA 3WSAA 4RNQA 1EZFA 3WCGA 4LUUA 5JV0F 3UCAA 2AZJA 4JXYA 4LIXA 3ZMBA 4LA6A 4DWBA 3N46F 4FP4A 5DZ2A 4NFJF 3TFNA 3WCHA 2FTZA 5E8KA 5E8HA 5DGMF 4K10A 1YJ4A 4PVYF 1YHKA 3KRPA 2F9KF 2E8XA 3ZMCA 5B0LA 3N3DA 1YYSA 5IK9A
chains in the Genus database with same CATH topology
3IPIA 4RXCA 4LTZA 5DW7A 3P5RA 2J5CA 4KQUA 1N20A 5EASA 4F6VA 3S4JA 4OGUA 3WCMA 3VJ9A 3M00A 2OPMA 1V4EA 3WCDA 4XQRF 1JFGA 2J1PA 3VJDA 1YQ7A 2E8WA 3DYGA 4JZXA 4KK2A 2F8CF 3RMGA 2ZCOA 3CP6A 4UMJA 4JYXA 4E9ZA 2E8UA 1DGPA 4NKFA 2QISA 3WJOA 3Q30A 3SDRA 5I1UA 3WCJA 5IM1A 2E92A 5ILKA 3ZCDA 3QKCA 3ACXA 3SAEA 5HN7A 5KSXF 3TS7A 3LSNA 4ZQ8A 5DJPF 1JFAA 5DHKA 4EA0A 2Q9ZA 3KROB 5IVGA 3M02A 1VG4A 5AYPA 4KVIA 3DYFA 4LTVA 3KRCB 1HX9A 2DH4A 1WL1A 1WY0A 4H5CF 3KROA 3N1WF 2O1OA 2E8VA 4PVXF 1N1ZA 3WEJA 3LEEA 5IL8A 1WKZA 3P41A 4KFAA 3N0FA 3LZ9A 4Q23A 3G4FA 5B0MA 2E8TA 1YYRA 3CKEA 2Z4YA 3EGTA 3WCFA 5B00A 5IMPA 5B03A 2ZY1A 5AELA 3OACA 3WSBA 4OKMA 3WJKA 5IMIA 3ACWA 1HXCA 2ZEVA 1N21A 3OABA 5JV1F 5A0IA 3N6KF 2ZCRA 2H8OA 4LLSA 4GP1A 2Z4XA 5CG5A 3M0GA 4KPJA 4MC3A 3N3LF 4EA2A 5HNAA 3AQ0A 3S9VA 3LOMA 3LDWA 3LVSA 5AFXA 3VJBA 3W7FA 2AZLA 5ILIA 4L2XF 3ICZA 4H5EF 2P1CA 5DIQF 3KB9A 5B0KA 2VF6A 4F6XA 4KPDA 2EWGA 5ILHA 4QXSF 1WL0A 3APZA 3WCBA 2F92F 4DZWA 2OGDA 3N5HF 4OMHA 4DI5A 5IK6A 3ICKA 1N1BA 2PS6A 2Z78A 3M01A 3WCCA 4MC8A 1VG7A 1ZW5A 3AQCB 3B7LA 1YYQA 2F94F 4KKMA 3ASXA 3LLWA 2F89F 4DXJA 4NG6A 2OPNA 3NRIA 1YYUA 3TC1A 4LFGA 5ILJA 4OKZA 2I19A 3V1XA 3VJEA 5JA0F 3KRFB 2PS8A 4DEMF 1YV5A 5EATA 2Q58A 3AQBB 4LZ0A 3WCIA 4LA5A 3SDQA 5DHIA 3EZ3A 1N22A 1RTRA 5ILZA 3P8RA 3NF2A 2F7MF 1V4HA 5B02A 1PS1A 3QQVA 5JUZF 3VJ8A 1HM7A 4N1ZF 2Q9YA 5IN8A 3Q2QA 1V4IA 4LXWA 1KIZA 1VG3A 4KUXA 1HXGA 3G4DA 3KBKA 4LPGF 3KRCA 3VJCA 4F62A 1V4KA 5CG6A 2Z4ZA 3VJAA 3SDVA 5ILDA 4NFKF 3OYRA 2Z7HA 4NKEA 3N5JF 5ER8A 3MAVA 3ADZA 2FORA 3LMDA 4LFVF 4N9UA 2RAHA 4JVJF 1YYTA 5JV2F 4GA3A 4KQ5A 5E8LA 2E90A 3ICMA 5ERNA 2E4OA 3PH7A 3NPRA 1UBXA 2Z4WA 3RBMA 2AZKA 4KVYA 4LOBA 4JZBA 3KRAB 4GAXA 5DJVF 3V66A 5ERMA 2OA6A 3LJIA 3MZVA 5DGNF 3WJNA 4H5DF 4XQSF 1V4JA 3DYHA 2PS4A 5EAUA 5IK0A 3WCLA 3PYAA 4P0VA 5B01A 3WC9A 3WEIA 3N45F 2E91A 2ZCSA 3SDTA 4RXEA 3KRPB 2ZCQA 1UBYA 4LZ3A 1WL3A 1VG6A 4KWDA 5B0IA 2F8ZF 3NPKA 2AELA 1WMWA 3PDEA 3LGZB 1HM4A 1HXAA 2AEKA 3WEFA 3N1VF 1VG2A 3Q1OA 5AHUB 3RYEA 5HN9A 4LZCA 4KVDA 4QPFA 1WL2A 3LK5A 2ONGA 3EFQA 4RXDA 5IMNA 2J1OA 4KQSA 4LPHF 4NUAA 3TFPA 5A0JA 5IL3A 3KRFA 4HD1A 1N24A 3ZL6A 3IBAA 4WK5A 3ID0A 3Q2ZA 1UBWA 5DGSF 1YHLA 3V1VA 4JXNA 3ACYA 4NFIF 3N49F 4RYPA 5DJRF 3WCAA 2Q80A 2ONHA 4EA1A 5C05A 4P0XA 5A0KA 3BNXA 2E95A 5H9DA 2Z4VA 3LGKA 3N0GA 3LG5A 4OMGA 4FJQA 3SDUA 3PYBA 2Z52A 4RXAA 3CC9A 3ICNA 4LFEA 4E1EA 4GP2A 5EROA 1KIYA 2AETA 5HN8A 3WCEA 1UBVA 5B0JA 2ZEUA 3OACB 4KVWA 3WEGA 4P0WA 3RYWA 3TFVA 2Z50A 5IKAA 1N23A 2E94A 4E9UA 1YHMA 2Z7IA 5ILYA 3WEKA 3OABB 4DWGA 3ZOUA 4DHDA 3WEHA 3AE0A 3BNYA 2E93A 1DI1A 2PS7A 3WE9A 1RQJA 3P8LA 4XQTF 3M9UA 1RQIA 3P5PA 4LLTA 3KRAA 3PKOA 1FPSA 4MC0A 2PS5A 5IKHA 3WSAA 4RNQA 1EZFA 3WCGA 4LUUA 5JV0F 3UCAA 2AZJA 4JXYA 4LIXA 3ZMBA 4LA6A 4DWBA 3N46F 4FP4A 5DZ2A 4NFJF 3TFNA 3WCHA 2FTZA 5E8KA 5E8HA 5DGMF 4K10A 1YJ4A 4PVYF 1YHKA 3KRPA 2F9KF 2E8XA 3ZMCA 5B0LA 3N3DA 1YYSA 5IK9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPI A;  4RXC A;  4LTZ A;  5DW7 A;  3P5R A;  2J5C A;  4KQU A;  1N20 A;  5EAS A;  4F6V A;  3S4J A;  4OGU A;  3WCM A;  3VJ9 A;  3M00 A;  2OPM A;  1V4E A;  3WCD A;  4XQR F;  1JFG A;  2J1P A;  3VJD A;  1YQ7 A;  2E8W A;  3DYG A;  4JZX A;  4KK2 A;  2F8C F;  3RMG A;  2ZCO A;  3CP6 A;  4UMJ A;  4JYX A;  4E9Z A;  2E8U A;  1DGP A;  4NKF A;  2QIS A;  3WJO A;  3Q30 A;  3SDR A;  5I1U A;  3WCJ A;  5IM1 A;  2E92 A;  5ILK A;  3ZCD A;  3QKC A;  3ACX A;  3SAE A;  5HN7 A;  5KSX F;  3TS7 A;  3LSN A;  4ZQ8 A;  5DJP F;  1JFA A;  5DHK A;  4EA0 A;  2Q9Z A;  3KRO B;  5IVG A;  3M02 A;  1VG4 A;  5AYP A;  4KVI A;  3DYF A;  4LTV A;  3KRC B;  1HX9 A;  2DH4 A;  1WL1 A;  1WY0 A;  4H5C F;  3KRO A;  3N1W F;  2O1O A;  2E8V A;  4PVX F;  1N1Z A;  3WEJ A;  3LEE A;  5IL8 A;  1WKZ A;  3P41 A;  4KFA A;  3N0F A;  3LZ9 A;  4Q23 A;  3G4F A;  5B0M A;  2E8T A;  1YYR A;  3CKE A;  2Z4Y A;  3EGT A;  3WCF A;  5B00 A;  5IMP A;  5B03 A;  2ZY1 A;  5AEL A;  3OAC A;  3WSB A;  4OKM A;  3WJK A;  5IMI A;  3ACW A;  1HXC A;  2ZEV A;  1N21 A;  3OAB A;  5JV1 F;  5A0I A;  3N6K F;  2ZCR A;  2H8O A;  4LLS A;  4GP1 A;  2Z4X A;  5CG5 A;  3M0G A;  4KPJ A;  4MC3 A;  3N3L F;  4EA2 A;  5HNA A;  3AQ0 A;  3S9V A;  3LOM A;  3LDW A;  3LVS A;  5AFX A;  3VJB A;  3W7F A;  2AZL A;  5ILI A;  4L2X F;  3ICZ A;  4H5E F;  2P1C A;  5DIQ F;  3KB9 A;  5B0K A;  2VF6 A;  4F6X A;  4KPD A;  2EWG A;  5ILH A;  4QXS F;  1WL0 A;  3APZ A;  3WCB A;  2F92 F;  4DZW A;  2OGD A;  3N5H F;  4OMH A;  4DI5 A;  5IK6 A;  3ICK A;  1N1B A;  2PS6 A;  2Z78 A;  3M01 A;  3WCC A;  4MC8 A;  1VG7 A;  1ZW5 A;  3AQC B;  3B7L A;  1YYQ A;  2F94 F;  4KKM A;  3ASX A;  3LLW A;  2F89 F;  4DXJ A;  4NG6 A;  2OPN A;  3NRI A;  1YYU A;  3TC1 A;  4LFG A;  5ILJ A;  4OKZ A;  2I19 A;  3V1X A;  3VJE A;  5JA0 F;  3KRF B;  2PS8 A;  4DEM F;  1YV5 A;  5EAT A;  2Q58 A;  3AQB B;  4LZ0 A;  3WCI A;  4LA5 A;  3SDQ A;  5DHI A;  3EZ3 A;  1N22 A;  1RTR A;  5ILZ A;  3P8R A;  3NF2 A;  2F7M F;  1V4H A;  5B02 A;  1PS1 A;  3QQV A;  5JUZ F;  3VJ8 A;  1HM7 A;  4N1Z F;  2Q9Y A;  5IN8 A;  3Q2Q A;  1V4I A;  4LXW A;  1KIZ A;  1VG3 A;  4KUX A;  1HXG A;  3G4D A;  3KBK A;  4LPG F;  3KRC A;  3VJC A;  4F62 A;  1V4K A;  5CG6 A;  2Z4Z A;  3VJA A;  3SDV A;  5ILD A;  4NFK F;  3OYR A;  2Z7H A;  4NKE A;  3N5J F;  5ER8 A;  3MAV A;  3ADZ A;  2FOR A;  3LMD A;  4LFV F;  4N9U A;  2RAH A;  4JVJ F;  1YYT A;  5JV2 F;  4GA3 A;  4KQ5 A;  5E8L A;  2E90 A;  3ICM A;  5ERN A;  2E4O A;  3PH7 A;  3NPR A;  1UBX A;  2Z4W A;  3RBM A;  2AZK A;  4KVY A;  4LOB A;  4JZB A;  3KRA B;  4GAX A;  5DJV F;  3V66 A;  5ERM A;  2OA6 A;  3LJI A;  3MZV A;  5DGN F;  3WJN A;  4H5D F;  4XQS F;  1V4J A;  3DYH A;  2PS4 A;  5EAU A;  5IK0 A;  3WCL A;  3PYA A;  4P0V A;  5B01 A;  3WC9 A;  3WEI A;  3N45 F;  2E91 A;  2ZCS A;  3SDT A;  4RXE A;  3KRP B;  2ZCQ A;  1UBY A;  4LZ3 A;  1WL3 A;  1VG6 A;  4KWD A;  5B0I A;  2F8Z F;  3NPK A;  2AEL A;  1WMW A;  3PDE A;  3LGZ B;  1HM4 A;  1HXA A;  2AEK A;  3WEF A;  3N1V F;  1VG2 A;  3Q1O A;  5AHU B;  3RYE A;  5HN9 A;  4LZC A;  4KVD A;  4QPF A;  1WL2 A;  3LK5 A;  2ONG A;  3EFQ A;  4RXD A;  5IMN A;  2J1O A;  4KQS A;  4LPH F;  4NUA A;  3TFP A;  5A0J A;  5IL3 A;  3KRF A;  4HD1 A;  1N24 A;  3ZL6 A;  3IBA A;  4WK5 A;  3ID0 A;  3Q2Z A;  1UBW A;  5DGS F;  1YHL A;  3V1V A;  4JXN A;  3ACY A;  4NFI F;  3N49 F;  4RYP A;  5DJR F;  3WCA A;  2Q80 A;  2ONH A;  4EA1 A;  5C05 A;  4P0X A;  5A0K A;  3BNX A;  2E95 A;  5H9D A;  2Z4V A;  3LGK A;  3N0G A;  3LG5 A;  4OMG A;  4FJQ A;  3SDU A;  3PYB A;  2Z52 A;  4RXA A;  3CC9 A;  3ICN A;  4LFE A;  4E1E A;  4GP2 A;  5ERO A;  1KIY A;  2AET A;  5HN8 A;  3WCE A;  1UBV A;  5B0J A;  2ZEU A;  3OAC B;  4KVW A;  3WEG A;  4P0W A;  3RYW A;  3TFV A;  2Z50 A;  5IKA A;  1N23 A;  2E94 A;  4E9U A;  1YHM A;  2Z7I A;  5ILY A;  3WEK A;  3OAB B;  4DWG A;  3ZOU A;  4DHD A;  3WEH A;  3AE0 A;  3BNY A;  2E93 A;  1DI1 A;  2PS7 A;  3WE9 A;  1RQJ A;  3P8L A;  4XQT F;  3M9U A;  1RQI A;  3P5P A;  4LLT A;  3KRA A;  3PKO A;  1FPS A;  4MC0 A;  2PS5 A;  5IKH A;  3WSA A;  4RNQ A;  1EZF A;  3WCG A;  4LUU A;  5JV0 F;  3UCA A;  2AZJ A;  4JXY A;  4LIX A;  3ZMB A;  4LA6 A;  4DWB A;  3N46 F;  4FP4 A;  5DZ2 A;  4NFJ F;  3TFN A;  3WCH A;  2FTZ A;  5E8K A;  5E8H A;  5DGM F;  4K10 A;  1YJ4 A;  4PVY F;  1YHK A;  3KRP A;  2F9K F;  2E8X A;  3ZMC A;  5B0L A;  3N3D A;  1YYS A;  5IK9 A; 
#chains in the Genus database with same CATH topology
 3IPI A;  4RXC A;  4LTZ A;  5DW7 A;  3P5R A;  2J5C A;  4KQU A;  1N20 A;  5EAS A;  4F6V A;  3S4J A;  4OGU A;  3WCM A;  3VJ9 A;  3M00 A;  2OPM A;  1V4E A;  3WCD A;  4XQR F;  1JFG A;  2J1P A;  3VJD A;  1YQ7 A;  2E8W A;  3DYG A;  4JZX A;  4KK2 A;  2F8C F;  3RMG A;  2ZCO A;  3CP6 A;  4UMJ A;  4JYX A;  4E9Z A;  2E8U A;  1DGP A;  4NKF A;  2QIS A;  3WJO A;  3Q30 A;  3SDR A;  5I1U A;  3WCJ A;  5IM1 A;  2E92 A;  5ILK A;  3ZCD A;  3QKC A;  3ACX A;  3SAE A;  5HN7 A;  5KSX F;  3TS7 A;  3LSN A;  4ZQ8 A;  5DJP F;  1JFA A;  5DHK A;  4EA0 A;  2Q9Z A;  3KRO B;  5IVG A;  3M02 A;  1VG4 A;  5AYP A;  4KVI A;  3DYF A;  4LTV A;  3KRC B;  1HX9 A;  2DH4 A;  1WL1 A;  1WY0 A;  4H5C F;  3KRO A;  3N1W F;  2O1O A;  2E8V A;  4PVX F;  1N1Z A;  3WEJ A;  3LEE A;  5IL8 A;  1WKZ A;  3P41 A;  4KFA A;  3N0F A;  3LZ9 A;  4Q23 A;  3G4F A;  5B0M A;  2E8T A;  1YYR A;  3CKE A;  2Z4Y A;  3EGT A;  3WCF A;  5B00 A;  5IMP A;  5B03 A;  2ZY1 A;  5AEL A;  3OAC A;  3WSB A;  4OKM A;  3WJK A;  5IMI A;  3ACW A;  1HXC A;  2ZEV A;  1N21 A;  3OAB A;  5JV1 F;  5A0I A;  3N6K F;  2ZCR A;  2H8O A;  4LLS A;  4GP1 A;  2Z4X A;  5CG5 A;  3M0G A;  4KPJ A;  4MC3 A;  3N3L F;  4EA2 A;  5HNA A;  3AQ0 A;  3S9V A;  3LOM A;  3LDW A;  3LVS A;  5AFX A;  3VJB A;  3W7F A;  2AZL A;  5ILI A;  4L2X F;  3ICZ A;  4H5E F;  2P1C A;  5DIQ F;  3KB9 A;  5B0K A;  2VF6 A;  4F6X A;  4KPD A;  2EWG A;  5ILH A;  4QXS F;  1WL0 A;  3APZ A;  3WCB A;  2F92 F;  4DZW A;  2OGD A;  3N5H F;  4OMH A;  4DI5 A;  5IK6 A;  3ICK A;  1N1B A;  2PS6 A;  2Z78 A;  3M01 A;  3WCC A;  4MC8 A;  1VG7 A;  1ZW5 A;  3AQC B;  3B7L A;  1YYQ A;  2F94 F;  4KKM A;  3ASX A;  3LLW A;  2F89 F;  4DXJ A;  4NG6 A;  2OPN A;  3NRI A;  1YYU A;  3TC1 A;  4LFG A;  5ILJ A;  4OKZ A;  2I19 A;  3V1X A;  3VJE A;  5JA0 F;  3KRF B;  2PS8 A;  4DEM F;  1YV5 A;  5EAT A;  2Q58 A;  3AQB B;  4LZ0 A;  3WCI A;  4LA5 A;  3SDQ A;  5DHI A;  3EZ3 A;  1N22 A;  1RTR A;  5ILZ A;  3P8R A;  3NF2 A;  2F7M F;  1V4H A;  5B02 A;  1PS1 A;  3QQV A;  5JUZ F;  3VJ8 A;  1HM7 A;  4N1Z F;  2Q9Y A;  5IN8 A;  3Q2Q A;  1V4I A;  4LXW A;  1KIZ A;  1VG3 A;  4KUX A;  1HXG A;  3G4D A;  3KBK A;  4LPG F;  3KRC A;  3VJC A;  4F62 A;  1V4K A;  5CG6 A;  2Z4Z A;  3VJA A;  3SDV A;  5ILD A;  4NFK F;  3OYR A;  2Z7H A;  4NKE A;  3N5J F;  5ER8 A;  3MAV A;  3ADZ A;  2FOR A;  3LMD A;  4LFV F;  4N9U A;  2RAH A;  4JVJ F;  1YYT A;  5JV2 F;  4GA3 A;  4KQ5 A;  5E8L A;  2E90 A;  3ICM A;  5ERN A;  2E4O A;  3PH7 A;  3NPR A;  1UBX A;  2Z4W A;  3RBM A;  2AZK A;  4KVY A;  4LOB A;  4JZB A;  3KRA B;  4GAX A;  5DJV F;  3V66 A;  5ERM A;  2OA6 A;  3LJI A;  3MZV A;  5DGN F;  3WJN A;  4H5D F;  4XQS F;  1V4J A;  3DYH A;  2PS4 A;  5EAU A;  5IK0 A;  3WCL A;  3PYA A;  4P0V A;  5B01 A;  3WC9 A;  3WEI A;  3N45 F;  2E91 A;  2ZCS A;  3SDT A;  4RXE A;  3KRP B;  2ZCQ A;  1UBY A;  4LZ3 A;  1WL3 A;  1VG6 A;  4KWD A;  5B0I A;  2F8Z F;  3NPK A;  2AEL A;  1WMW A;  3PDE A;  3LGZ B;  1HM4 A;  1HXA A;  2AEK A;  3WEF A;  3N1V F;  1VG2 A;  3Q1O A;  5AHU B;  3RYE A;  5HN9 A;  4LZC A;  4KVD A;  4QPF A;  1WL2 A;  3LK5 A;  2ONG A;  3EFQ A;  4RXD A;  5IMN A;  2J1O A;  4KQS A;  4LPH F;  4NUA A;  3TFP A;  5A0J A;  5IL3 A;  3KRF A;  4HD1 A;  1N24 A;  3ZL6 A;  3IBA A;  4WK5 A;  3ID0 A;  3Q2Z A;  1UBW A;  5DGS F;  1YHL A;  3V1V A;  4JXN A;  3ACY A;  4NFI F;  3N49 F;  4RYP A;  5DJR F;  3WCA A;  2Q80 A;  2ONH A;  4EA1 A;  5C05 A;  4P0X A;  5A0K A;  3BNX A;  2E95 A;  5H9D A;  2Z4V A;  3LGK A;  3N0G A;  3LG5 A;  4OMG A;  4FJQ A;  3SDU A;  3PYB A;  2Z52 A;  4RXA A;  3CC9 A;  3ICN A;  4LFE A;  4E1E A;  4GP2 A;  5ERO A;  1KIY A;  2AET A;  5HN8 A;  3WCE A;  1UBV A;  5B0J A;  2ZEU A;  3OAC B;  4KVW A;  3WEG A;  4P0W A;  3RYW A;  3TFV A;  2Z50 A;  5IKA A;  1N23 A;  2E94 A;  4E9U A;  1YHM A;  2Z7I A;  5ILY A;  3WEK A;  3OAB B;  4DWG A;  3ZOU A;  4DHD A;  3WEH A;  3AE0 A;  3BNY A;  2E93 A;  1DI1 A;  2PS7 A;  3WE9 A;  1RQJ A;  3P8L A;  4XQT F;  3M9U A;  1RQI A;  3P5P A;  4LLT A;  3KRA A;  3PKO A;  1FPS A;  4MC0 A;  2PS5 A;  5IKH A;  3WSA A;  4RNQ A;  1EZF A;  3WCG A;  4LUU A;  5JV0 F;  3UCA A;  2AZJ A;  4JXY A;  4LIX A;  3ZMB A;  4LA6 A;  4DWB A;  3N46 F;  4FP4 A;  5DZ2 A;  4NFJ F;  3TFN A;  3WCH A;  2FTZ A;  5E8K A;  5E8H A;  5DGM F;  4K10 A;  1YJ4 A;  4PVY F;  1YHK A;  3KRP A;  2F9K F;  2E8X A;  3ZMC A;  5B0L A;  3N3D A;  1YYS A;  5IK9 A; 
#chains in the Genus database with same CATH homology
 3IPI A;  4RXC A;  4LTZ A;  5DW7 A;  3P5R A;  2J5C A;  4KQU A;  1N20 A;  5EAS A;  4F6V A;  3S4J A;  4OGU A;  3WCM A;  3VJ9 A;  3M00 A;  2OPM A;  1V4E A;  3WCD A;  4XQR F;  1JFG A;  2J1P A;  3VJD A;  1YQ7 A;  2E8W A;  3DYG A;  4JZX A;  4KK2 A;  2F8C F;  3RMG A;  2ZCO A;  3CP6 A;  4UMJ A;  4JYX A;  4E9Z A;  2E8U A;  1DGP A;  4NKF A;  2QIS A;  3WJO A;  3Q30 A;  3SDR A;  5I1U A;  3WCJ A;  5IM1 A;  2E92 A;  5ILK A;  3ZCD A;  3QKC A;  3ACX A;  3SAE A;  5HN7 A;  5KSX F;  3TS7 A;  3LSN A;  4ZQ8 A;  5DJP F;  1JFA A;  5DHK A;  4EA0 A;  2Q9Z A;  3KRO B;  5IVG A;  3M02 A;  1VG4 A;  5AYP A;  4KVI A;  3DYF A;  4LTV A;  3KRC B;  1HX9 A;  2DH4 A;  1WL1 A;  1WY0 A;  4H5C F;  3KRO A;  3N1W F;  2O1O A;  2E8V A;  4PVX F;  1N1Z A;  3WEJ A;  3LEE A;  5IL8 A;  1WKZ A;  3P41 A;  4KFA A;  3N0F A;  3LZ9 A;  4Q23 A;  3G4F A;  5B0M A;  2E8T A;  1YYR A;  3CKE A;  2Z4Y A;  3EGT A;  3WCF A;  5B00 A;  5IMP A;  5B03 A;  2ZY1 A;  5AEL A;  3OAC A;  3WSB A;  4OKM A;  3WJK A;  5IMI A;  3ACW A;  1HXC A;  2ZEV A;  1N21 A;  3OAB A;  5JV1 F;  5A0I A;  3N6K F;  2ZCR A;  2H8O A;  4LLS A;  4GP1 A;  2Z4X A;  5CG5 A;  3M0G A;  4KPJ A;  4MC3 A;  3N3L F;  4EA2 A;  5HNA A;  3AQ0 A;  3S9V A;  3LOM A;  3LDW A;  3LVS A;  5AFX A;  3VJB A;  3W7F A;  2AZL A;  5ILI A;  4L2X F;  3ICZ A;  4H5E F;  2P1C A;  5DIQ F;  3KB9 A;  5B0K A;  2VF6 A;  4F6X A;  4KPD A;  2EWG A;  5ILH A;  4QXS F;  1WL0 A;  3APZ A;  3WCB A;  2F92 F;  4DZW A;  2OGD A;  3N5H F;  4OMH A;  4DI5 A;  5IK6 A;  3ICK A;  1N1B A;  2PS6 A;  2Z78 A;  3M01 A;  3WCC A;  4MC8 A;  1VG7 A;  1ZW5 A;  3AQC B;  3B7L A;  1YYQ A;  2F94 F;  4KKM A;  3ASX A;  3LLW A;  2F89 F;  4DXJ A;  4NG6 A;  2OPN A;  3NRI A;  1YYU A;  3TC1 A;  4LFG A;  5ILJ A;  4OKZ A;  2I19 A;  3V1X A;  3VJE A;  5JA0 F;  3KRF B;  2PS8 A;  4DEM F;  1YV5 A;  5EAT A;  2Q58 A;  3AQB B;  4LZ0 A;  3WCI A;  4LA5 A;  3SDQ A;  5DHI A;  3EZ3 A;  1N22 A;  1RTR A;  5ILZ A;  3P8R A;  3NF2 A;  2F7M F;  1V4H A;  5B02 A;  1PS1 A;  3QQV A;  5JUZ F;  3VJ8 A;  1HM7 A;  4N1Z F;  2Q9Y A;  5IN8 A;  3Q2Q A;  1V4I A;  4LXW A;  1KIZ A;  1VG3 A;  4KUX A;  1HXG A;  3G4D A;  3KBK A;  4LPG F;  3KRC A;  3VJC A;  4F62 A;  1V4K A;  5CG6 A;  2Z4Z A;  3VJA A;  3SDV A;  5ILD A;  4NFK F;  3OYR A;  2Z7H A;  4NKE A;  3N5J F;  5ER8 A;  3MAV A;  3ADZ A;  2FOR A;  3LMD A;  4LFV F;  4N9U A;  2RAH A;  4JVJ F;  1YYT A;  5JV2 F;  4GA3 A;  4KQ5 A;  5E8L A;  2E90 A;  3ICM A;  5ERN A;  2E4O A;  3PH7 A;  3NPR A;  1UBX A;  2Z4W A;  3RBM A;  2AZK A;  4KVY A;  4LOB A;  4JZB A;  3KRA B;  4GAX A;  5DJV F;  3V66 A;  5ERM A;  2OA6 A;  3LJI A;  3MZV A;  5DGN F;  3WJN A;  4H5D F;  4XQS F;  1V4J A;  3DYH A;  2PS4 A;  5EAU A;  5IK0 A;  3WCL A;  3PYA A;  4P0V A;  5B01 A;  3WC9 A;  3WEI A;  3N45 F;  2E91 A;  2ZCS A;  3SDT A;  4RXE A;  3KRP B;  2ZCQ A;  1UBY A;  4LZ3 A;  1WL3 A;  1VG6 A;  4KWD A;  5B0I A;  2F8Z F;  3NPK A;  2AEL A;  1WMW A;  3PDE A;  3LGZ B;  1HM4 A;  1HXA A;  2AEK A;  3WEF A;  3N1V F;  1VG2 A;  3Q1O A;  5AHU B;  3RYE A;  5HN9 A;  4LZC A;  4KVD A;  4QPF A;  1WL2 A;  3LK5 A;  2ONG A;  3EFQ A;  4RXD A;  5IMN A;  2J1O A;  4KQS A;  4LPH F;  4NUA A;  3TFP A;  5A0J A;  5IL3 A;  3KRF A;  4HD1 A;  1N24 A;  3ZL6 A;  3IBA A;  4WK5 A;  3ID0 A;  3Q2Z A;  1UBW A;  5DGS F;  1YHL A;  3V1V A;  4JXN A;  3ACY A;  4NFI F;  3N49 F;  4RYP A;  5DJR F;  3WCA A;  2Q80 A;  2ONH A;  4EA1 A;  5C05 A;  4P0X A;  5A0K A;  3BNX A;  2E95 A;  5H9D A;  2Z4V A;  3LGK A;  3N0G A;  3LG5 A;  4OMG A;  4FJQ A;  3SDU A;  3PYB A;  2Z52 A;  4RXA A;  3CC9 A;  3ICN A;  4LFE A;  4E1E A;  4GP2 A;  5ERO A;  1KIY A;  2AET A;  5HN8 A;  3WCE A;  1UBV A;  5B0J A;  2ZEU A;  3OAC B;  4KVW A;  3WEG A;  4P0W A;  3RYW A;  3TFV A;  2Z50 A;  5IKA A;  1N23 A;  2E94 A;  4E9U A;  1YHM A;  2Z7I A;  5ILY A;  3WEK A;  3OAB B;  4DWG A;  3ZOU A;  4DHD A;  3WEH A;  3AE0 A;  3BNY A;  2E93 A;  1DI1 A;  2PS7 A;  3WE9 A;  1RQJ A;  3P8L A;  4XQT F;  3M9U A;  1RQI A;  3P5P A;  4LLT A;  3KRA A;  3PKO A;  1FPS A;  4MC0 A;  2PS5 A;  5IKH A;  3WSA A;  4RNQ A;  1EZF A;  3WCG A;  4LUU A;  5JV0 F;  3UCA A;  2AZJ A;  4JXY A;  4LIX A;  3ZMB A;  4LA6 A;  4DWB A;  3N46 F;  4FP4 A;  5DZ2 A;  4NFJ F;  3TFN A;  3WCH A;  2FTZ A;  5E8K A;  5E8H A;  5DGM F;  4K10 A;  1YJ4 A;  4PVY F;  1YHK A;  3KRP A;  2F9K F;  2E8X A;  3ZMC A;  5B0L A;  3N3D A;  1YYS A;  5IK9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...