5B01A

Structure of a prenyltransferase in its unbound form
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
262
structure length
262
Chain Sequence
YFQSMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MoeN5
publication title Structure and function of a prenyltransferase
rcsb
source organism Streptomyces ghanaensis
total genus 114
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b01A00
3M9UA 1UBYA 5DJVF 1VG2A 1N23A 4KUXA 4QXSF 3TFNA 4JXYA 3NRIA 4KQSA 3EFQA 3KRCA 4GP2A 4FJQA 3TFPA 2E90A 4GA3A 3LGZB 1WY0A 4RXAA 2E94A 4LIXA 1HXAA 3ACYA 4XQSF 4DZWA 4KVDA 4KVYA 3IBAA 4DI5A 4F6VA 3WCCA 1JFAA 1PS1A 4OMHA 3LVSA 5ERNA 2E8UA 3VJEA 1N22A 3LMDA 4E1EA 4NG6A 3OABA 1HM4A 3OYRA 4KK2A 5JV1F 3APZA 3VJDA 5ILIA 1HXGA 1VG4A 3WCGA 4PVXF 3M00A 2PS5A 5HN7A 3WCLA 2F89F 3IPIA 3LZ9A 4NFKF 3AQCB 2O1OA 3G4DA 4H5EF 4DWGA 4LA5A 5ILYA 3KRPB 4LXWA 2ZCRA 5ILKA 1VG6A 3ZCDA 4E9ZA 4K10A 5ER8A 3ZL6A 4LFGA 3Q30A 1WMWA 2ZY1A 3N46F 4NFIF 1KIYA 3ZOUA 5I1UA 1YYQA 3W7FA 4N9UA 2Z52A 1YYTA 5A0IA 1N1ZA 2E8VA 3PKOA 1WL2A 3BNYA 4KVIA 3WEKA 2AZLA 5ILDA 2ZCOA 3P8LA 3QQVA 5B0LA 3LDWA 3N3DA 3N5JF 3KRFB 4P0VA 3BNXA 1WKZA 4XQTF 3ADZA 3P5RA 3MAVA 4MC3A 3CP6A 4NKFA 4LZ0A 1JFGA 2F7MF 4FP4A 3NF2A 5KSXF 4OMGA 5EROA 2PS6A 3RYEA 2E8WA 3SDQA 2I19A 4KKMA 2E93A 2VF6A 2J1PA 2E95A 3NPKA 3S9VA 4LZ3A 3LK5A 3DYGA 5EASA 3SDVA 3MZVA 2ONHA 5AELA 3WEHA 3WCFA 4NFJF 2ONGA 5IVGA 5JUZF 3KRPA 1N20A 3AQ0A 5IMPA 3N5HF 4P0XA 5HN8A 3ICZA 2Z7HA 1YQ7A 5DHKA 5E8KA 5H9DA 1HX9A 5IM1A 5ERMA 3WCDA 4MC8A 5IN8A 3WSBA 4LA6A 2ZCQA 3WCEA 5DGMF 3ICNA 2PS8A 2F8CF 2RAHA 4GAXA 3KBKA 3ICKA 4H5CF 4KQUA 4WK5A 3WC9A 3V1VA 3M0GA 3KRFA 3ICMA 3ID0A 5IK9A 3P8RA 3TS7A 3LOMA 3RYWA 3NPRA 2Z4WA 2E8TA 4LLTA 4E9UA 5E8HA 3N0FA 2PS7A 3PYAA 3OACA 2E92A 2Q58A 2AETA 5HN9A 2Q9YA 2QISA 3AE0A 1WL0A 4XQRF 4F6XA 4ZQ8A 3AQBB 2OA6A 5CG5A 3N1WF 1KIZA 2AELA 2Z7IA 1YYSA 5B03A 2EWGA 2F94F 3EZ3A 1V4HA 2AEKA 1WL1A 3LG5A 1N21A 4JZBA 4L2XF 5AFXA 4OKMA 1HXCA 3PH7A 3KB9A 5ILHA 1RQJA 4GP1A 4JXNA 3N45F 3WCIA 4RXEA 4LUUA 3V1XA 2Z4VA 4RXDA 5AYPA 5B0JA 5EATA 5EAUA 4N1ZF 4EA1A 4LTVA 2J5CA 5B02A 3WCJA 2E91A 2FTZA 5HNAA 3N3LF 3LLWA 3PYBA 4LPGF 3WEIA 3Q2ZA 2OPMA 2H8OA 1YV5A 3WCBA 1ZW5A 4JZXA 2Q80A 5JV2F 3N6KF 1V4JA 2ZCSA 3ACWA 4KQ5A 4KPJA 3RMGA 4KPDA 4HD1A 3VJ8A 1DI1A 3LEEA 3CC9A 2DH4A 3SDRA 4EA0A 3ACXA 1V4IA 1VG3A 3KRAB 1YYRA 5DHIA 2Z4YA 4LTZA 4KWDA 1V4KA 2Z4XA 4DWBA 5CG6A 2J1OA 4LOBA 5E8LA 4KFAA 4UMJA 1DGPA 2OGDA 5ILZA 3LJIA 2Z4ZA 2P1CA 4JVJF 4LPHF 5A0KA 5B0MA 3WJOA 2Z78A 1WL3A 5JA0F 3ASXA 4RYPA 3UCAA 2F92F 1EZFA 5B0KA 2OPNA 3VJ9A 3M02A 1YJ4A 3KROB 5IKAA 3G4FA 1YHMA 5DGNF 4NKEA 3CKEA 5DZ2A 3WCHA 3Q2QA 4LFVF 4MC0A 4NUAA 3ZMBA 3N49F 1V4EA 2F9KF 3WCMA 2Q9ZA 1UBVA 5B01A 4DXJA 4LFEA 1VG7A 2ZEVA 4OGUA 3S4JA 5IL3A 5IK6A 3WE9A 3N0GA 5AHUB 1N24A 4PVYF 3KRAA 1UBXA 3WEFA 4JYXA 2E4OA 4EA2A 4F62A 3SDUA 1UBWA 1RTRA 3DYFA 5JV0F 1YYUA 5IKHA 4P0WA 1N1BA 1YHLA 2FORA 1RQIA 2E8XA 3B7LA 3SDTA 4RXCA 5IMIA 3LSNA 3KRCB 2AZKA 3TC1A 4DHDA 3EGTA 5IMNA 4OKZA 4H5DF 5IL8A 2AZJA 3WSAA 3KROA 1HM7A 3ZMCA 5A0JA 2F8ZF 3WJKA 3WEJA 5IK0A 3SAEA 4RNQA 3VJBA 1YHKA 5DW7A 5DGSF 3DYHA 3N1VF 5B00A 3OABB 4QPFA 4DEMF 5ILJA 3RBMA 3P41A 1FPSA 3PDEA 3QKCA 5B0IA 2ZEUA 3OACB 3WCAA 4KVWA 3LGKA 5DJPF 3V66A 5C05A 3P5PA 3M01A 4LZCA 3VJCA 2Z50A 4LLSA 3Q1OA 5DIQF 3WEGA 3VJAA 3WJNA 3TFVA 2PS4A 4Q23A 5DJRF
chains in the Genus database with same CATH superfamily
3M9UA 1UBYA 5DJVF 1VG2A 1N23A 4KUXA 4QXSF 3TFNA 4JXYA 3NRIA 4KQSA 3EFQA 3KRCA 4GP2A 4FJQA 3TFPA 2E90A 4GA3A 3LGZB 1WY0A 4RXAA 2E94A 4LIXA 1HXAA 3ACYA 4XQSF 4DZWA 4KVDA 4KVYA 3IBAA 4DI5A 4F6VA 3WCCA 1JFAA 1PS1A 4OMHA 3LVSA 5ERNA 2E8UA 3VJEA 1N22A 3LMDA 4E1EA 4NG6A 3OABA 1HM4A 3OYRA 4KK2A 5JV1F 3APZA 3VJDA 5ILIA 1HXGA 1VG4A 3WCGA 4PVXF 3M00A 2PS5A 5HN7A 3WCLA 2F89F 3IPIA 3LZ9A 4NFKF 3AQCB 2O1OA 3G4DA 4H5EF 4DWGA 4LA5A 5ILYA 3KRPB 4LXWA 2ZCRA 5ILKA 1VG6A 3ZCDA 4E9ZA 4K10A 5ER8A 3ZL6A 4LFGA 3Q30A 1WMWA 2ZY1A 3N46F 4NFIF 1KIYA 3ZOUA 5I1UA 1YYQA 3W7FA 4N9UA 2Z52A 1YYTA 5A0IA 1N1ZA 2E8VA 3PKOA 1WL2A 3BNYA 4KVIA 3WEKA 2AZLA 5ILDA 2ZCOA 3P8LA 3QQVA 5B0LA 3LDWA 3N3DA 3N5JF 3KRFB 4P0VA 3BNXA 1WKZA 4XQTF 3ADZA 3P5RA 3MAVA 4MC3A 3CP6A 4NKFA 4LZ0A 1JFGA 2F7MF 4FP4A 3NF2A 5KSXF 4OMGA 5EROA 2PS6A 3RYEA 2E8WA 3SDQA 2I19A 4KKMA 2E93A 2VF6A 2J1PA 2E95A 3NPKA 3S9VA 4LZ3A 3LK5A 3DYGA 5EASA 3SDVA 3MZVA 2ONHA 5AELA 3WEHA 3WCFA 4NFJF 2ONGA 5IVGA 5JUZF 3KRPA 1N20A 3AQ0A 5IMPA 3N5HF 4P0XA 5HN8A 3ICZA 2Z7HA 1YQ7A 5DHKA 5E8KA 5H9DA 1HX9A 5IM1A 5ERMA 3WCDA 4MC8A 5IN8A 3WSBA 4LA6A 2ZCQA 3WCEA 5DGMF 3ICNA 2PS8A 2F8CF 2RAHA 4GAXA 3KBKA 3ICKA 4H5CF 4KQUA 4WK5A 3WC9A 3V1VA 3M0GA 3KRFA 3ICMA 3ID0A 5IK9A 3P8RA 3TS7A 3LOMA 3RYWA 3NPRA 2Z4WA 2E8TA 4LLTA 4E9UA 5E8HA 3N0FA 2PS7A 3PYAA 3OACA 2E92A 2Q58A 2AETA 5HN9A 2Q9YA 2QISA 3AE0A 1WL0A 4XQRF 4F6XA 4ZQ8A 3AQBB 2OA6A 5CG5A 3N1WF 1KIZA 2AELA 2Z7IA 1YYSA 5B03A 2EWGA 2F94F 3EZ3A 1V4HA 2AEKA 1WL1A 3LG5A 1N21A 4JZBA 4L2XF 5AFXA 4OKMA 1HXCA 3PH7A 3KB9A 5ILHA 1RQJA 4GP1A 4JXNA 3N45F 3WCIA 4RXEA 4LUUA 3V1XA 2Z4VA 4RXDA 5AYPA 5B0JA 5EATA 5EAUA 4N1ZF 4EA1A 4LTVA 2J5CA 5B02A 3WCJA 2E91A 2FTZA 5HNAA 3N3LF 3LLWA 3PYBA 4LPGF 3WEIA 3Q2ZA 2OPMA 2H8OA 1YV5A 3WCBA 1ZW5A 4JZXA 2Q80A 5JV2F 3N6KF 1V4JA 2ZCSA 3ACWA 4KQ5A 4KPJA 3RMGA 4KPDA 4HD1A 3VJ8A 1DI1A 3LEEA 3CC9A 2DH4A 3SDRA 4EA0A 3ACXA 1V4IA 1VG3A 3KRAB 1YYRA 5DHIA 2Z4YA 4LTZA 4KWDA 1V4KA 2Z4XA 4DWBA 5CG6A 2J1OA 4LOBA 5E8LA 4KFAA 4UMJA 1DGPA 2OGDA 5ILZA 3LJIA 2Z4ZA 2P1CA 4JVJF 4LPHF 5A0KA 5B0MA 3WJOA 2Z78A 1WL3A 5JA0F 3ASXA 4RYPA 3UCAA 2F92F 1EZFA 5B0KA 2OPNA 3VJ9A 3M02A 1YJ4A 3KROB 5IKAA 3G4FA 1YHMA 5DGNF 4NKEA 3CKEA 5DZ2A 3WCHA 3Q2QA 4LFVF 4MC0A 4NUAA 3ZMBA 3N49F 1V4EA 2F9KF 3WCMA 2Q9ZA 1UBVA 5B01A 4DXJA 4LFEA 1VG7A 2ZEVA 4OGUA 3S4JA 5IL3A 5IK6A 3WE9A 3N0GA 5AHUB 1N24A 4PVYF 3KRAA 1UBXA 3WEFA 4JYXA 2E4OA 4EA2A 4F62A 3SDUA 1UBWA 1RTRA 3DYFA 5JV0F 1YYUA 5IKHA 4P0WA 1N1BA 1YHLA 2FORA 1RQIA 2E8XA 3B7LA 3SDTA 4RXCA 5IMIA 3LSNA 3KRCB 2AZKA 3TC1A 4DHDA 3EGTA 5IMNA 4OKZA 4H5DF 5IL8A 2AZJA 3WSAA 3KROA 1HM7A 3ZMCA 5A0JA 2F8ZF 3WJKA 3WEJA 5IK0A 3SAEA 4RNQA 3VJBA 1YHKA 5DW7A 5DGSF 3DYHA 3N1VF 5B00A 3OABB 4QPFA 4DEMF 5ILJA 3RBMA 3P41A 1FPSA 3PDEA 3QKCA 5B0IA 2ZEUA 3OACB 3WCAA 4KVWA 3LGKA 5DJPF 3V66A 5C05A 3P5PA 3M01A 4LZCA 3VJCA 2Z50A 4LLSA 3Q1OA 5DIQF 3WEGA 3VJAA 3WJNA 3TFVA 2PS4A 4Q23A 5DJRF
chains in the Genus database with same CATH topology
3M9UA 1UBYA 5DJVF 1VG2A 1N23A 4KUXA 4QXSF 3TFNA 4JXYA 3NRIA 4KQSA 3EFQA 3KRCA 4GP2A 4FJQA 3TFPA 2E90A 4GA3A 3LGZB 1WY0A 4RXAA 2E94A 4LIXA 1HXAA 3ACYA 4XQSF 4DZWA 4KVDA 4KVYA 3IBAA 4DI5A 4F6VA 3WCCA 1JFAA 1PS1A 4OMHA 3LVSA 5ERNA 2E8UA 3VJEA 1N22A 3LMDA 4E1EA 4NG6A 3OABA 1HM4A 3OYRA 4KK2A 5JV1F 3APZA 3VJDA 5ILIA 1HXGA 1VG4A 3WCGA 4PVXF 3M00A 2PS5A 5HN7A 3WCLA 2F89F 3IPIA 3LZ9A 4NFKF 3AQCB 2O1OA 3G4DA 4H5EF 4DWGA 4LA5A 5ILYA 3KRPB 4LXWA 2ZCRA 5ILKA 1VG6A 3ZCDA 4E9ZA 4K10A 5ER8A 3ZL6A 4LFGA 3Q30A 1WMWA 2ZY1A 3N46F 4NFIF 1KIYA 3ZOUA 5I1UA 1YYQA 3W7FA 4N9UA 2Z52A 1YYTA 5A0IA 1N1ZA 2E8VA 3PKOA 1WL2A 3BNYA 4KVIA 3WEKA 2AZLA 5ILDA 2ZCOA 3P8LA 3QQVA 5B0LA 3LDWA 3N3DA 3N5JF 3KRFB 4P0VA 3BNXA 1WKZA 4XQTF 3ADZA 3P5RA 3MAVA 4MC3A 3CP6A 4NKFA 4LZ0A 1JFGA 2F7MF 4FP4A 3NF2A 5KSXF 4OMGA 5EROA 2PS6A 3RYEA 2E8WA 3SDQA 2I19A 4KKMA 2E93A 2VF6A 2J1PA 2E95A 3NPKA 3S9VA 4LZ3A 3LK5A 3DYGA 5EASA 3SDVA 3MZVA 2ONHA 5AELA 3WEHA 3WCFA 4NFJF 2ONGA 5IVGA 5JUZF 3KRPA 1N20A 3AQ0A 5IMPA 3N5HF 4P0XA 5HN8A 3ICZA 2Z7HA 1YQ7A 5DHKA 5E8KA 5H9DA 1HX9A 5IM1A 5ERMA 3WCDA 4MC8A 5IN8A 3WSBA 4LA6A 2ZCQA 3WCEA 5DGMF 3ICNA 2PS8A 2F8CF 2RAHA 4GAXA 3KBKA 3ICKA 4H5CF 4KQUA 4WK5A 3WC9A 3V1VA 3M0GA 3KRFA 3ICMA 3ID0A 5IK9A 3P8RA 3TS7A 3LOMA 3RYWA 3NPRA 2Z4WA 2E8TA 4LLTA 4E9UA 5E8HA 3N0FA 2PS7A 3PYAA 3OACA 2E92A 2Q58A 2AETA 5HN9A 2Q9YA 2QISA 3AE0A 1WL0A 4XQRF 4F6XA 4ZQ8A 3AQBB 2OA6A 5CG5A 3N1WF 1KIZA 2AELA 2Z7IA 1YYSA 5B03A 2EWGA 2F94F 3EZ3A 1V4HA 2AEKA 1WL1A 3LG5A 1N21A 4JZBA 4L2XF 5AFXA 4OKMA 1HXCA 3PH7A 3KB9A 5ILHA 1RQJA 4GP1A 4JXNA 3N45F 3WCIA 4RXEA 4LUUA 3V1XA 2Z4VA 4RXDA 5AYPA 5B0JA 5EATA 5EAUA 4N1ZF 4EA1A 4LTVA 2J5CA 5B02A 3WCJA 2E91A 2FTZA 5HNAA 3N3LF 3LLWA 3PYBA 4LPGF 3WEIA 3Q2ZA 2OPMA 2H8OA 1YV5A 3WCBA 1ZW5A 4JZXA 2Q80A 5JV2F 3N6KF 1V4JA 2ZCSA 3ACWA 4KQ5A 4KPJA 3RMGA 4KPDA 4HD1A 3VJ8A 1DI1A 3LEEA 3CC9A 2DH4A 3SDRA 4EA0A 3ACXA 1V4IA 1VG3A 3KRAB 1YYRA 5DHIA 2Z4YA 4LTZA 4KWDA 1V4KA 2Z4XA 4DWBA 5CG6A 2J1OA 4LOBA 5E8LA 4KFAA 4UMJA 1DGPA 2OGDA 5ILZA 3LJIA 2Z4ZA 2P1CA 4JVJF 4LPHF 5A0KA 5B0MA 3WJOA 2Z78A 1WL3A 5JA0F 3ASXA 4RYPA 3UCAA 2F92F 1EZFA 5B0KA 2OPNA 3VJ9A 3M02A 1YJ4A 3KROB 5IKAA 3G4FA 1YHMA 5DGNF 4NKEA 3CKEA 5DZ2A 3WCHA 3Q2QA 4LFVF 4MC0A 4NUAA 3ZMBA 3N49F 1V4EA 2F9KF 3WCMA 2Q9ZA 1UBVA 5B01A 4DXJA 4LFEA 1VG7A 2ZEVA 4OGUA 3S4JA 5IL3A 5IK6A 3WE9A 3N0GA 5AHUB 1N24A 4PVYF 3KRAA 1UBXA 3WEFA 4JYXA 2E4OA 4EA2A 4F62A 3SDUA 1UBWA 1RTRA 3DYFA 5JV0F 1YYUA 5IKHA 4P0WA 1N1BA 1YHLA 2FORA 1RQIA 2E8XA 3B7LA 3SDTA 4RXCA 5IMIA 3LSNA 3KRCB 2AZKA 3TC1A 4DHDA 3EGTA 5IMNA 4OKZA 4H5DF 5IL8A 2AZJA 3WSAA 3KROA 1HM7A 3ZMCA 5A0JA 2F8ZF 3WJKA 3WEJA 5IK0A 3SAEA 4RNQA 3VJBA 1YHKA 5DW7A 5DGSF 3DYHA 3N1VF 5B00A 3OABB 4QPFA 4DEMF 5ILJA 3RBMA 3P41A 1FPSA 3PDEA 3QKCA 5B0IA 2ZEUA 3OACB 3WCAA 4KVWA 3LGKA 5DJPF 3V66A 5C05A 3P5PA 3M01A 4LZCA 3VJCA 2Z50A 4LLSA 3Q1OA 5DIQF 3WEGA 3VJAA 3WJNA 3TFVA 2PS4A 4Q23A 5DJRF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M9U A;  1UBY A;  5DJV F;  1VG2 A;  1N23 A;  4KUX A;  4QXS F;  3TFN A;  4JXY A;  3NRI A;  4KQS A;  3EFQ A;  3KRC A;  4GP2 A;  4FJQ A;  3TFP A;  2E90 A;  4GA3 A;  3LGZ B;  1WY0 A;  4RXA A;  2E94 A;  4LIX A;  1HXA A;  3ACY A;  4XQS F;  4DZW A;  4KVD A;  4KVY A;  3IBA A;  4DI5 A;  4F6V A;  3WCC A;  1JFA A;  1PS1 A;  4OMH A;  3LVS A;  5ERN A;  2E8U A;  3VJE A;  1N22 A;  3LMD A;  4E1E A;  4NG6 A;  3OAB A;  1HM4 A;  3OYR A;  4KK2 A;  5JV1 F;  3APZ A;  3VJD A;  5ILI A;  1HXG A;  1VG4 A;  3WCG A;  4PVX F;  3M00 A;  2PS5 A;  5HN7 A;  3WCL A;  2F89 F;  3IPI A;  3LZ9 A;  4NFK F;  3AQC B;  2O1O A;  3G4D A;  4H5E F;  4DWG A;  4LA5 A;  5ILY A;  3KRP B;  4LXW A;  2ZCR A;  5ILK A;  1VG6 A;  3ZCD A;  4E9Z A;  4K10 A;  5ER8 A;  3ZL6 A;  4LFG A;  3Q30 A;  1WMW A;  2ZY1 A;  3N46 F;  4NFI F;  1KIY A;  3ZOU A;  5I1U A;  1YYQ A;  3W7F A;  4N9U A;  2Z52 A;  1YYT A;  5A0I A;  1N1Z A;  2E8V A;  3PKO A;  1WL2 A;  3BNY A;  4KVI A;  3WEK A;  2AZL A;  5ILD A;  2ZCO A;  3P8L A;  3QQV A;  5B0L A;  3LDW A;  3N3D A;  3N5J F;  3KRF B;  4P0V A;  3BNX A;  1WKZ A;  4XQT F;  3ADZ A;  3P5R A;  3MAV A;  4MC3 A;  3CP6 A;  4NKF A;  4LZ0 A;  1JFG A;  2F7M F;  4FP4 A;  3NF2 A;  5KSX F;  4OMG A;  5ERO A;  2PS6 A;  3RYE A;  2E8W A;  3SDQ A;  2I19 A;  4KKM A;  2E93 A;  2VF6 A;  2J1P A;  2E95 A;  3NPK A;  3S9V A;  4LZ3 A;  3LK5 A;  3DYG A;  5EAS A;  3SDV A;  3MZV A;  2ONH A;  5AEL A;  3WEH A;  3WCF A;  4NFJ F;  2ONG A;  5IVG A;  5JUZ F;  3KRP A;  1N20 A;  3AQ0 A;  5IMP A;  3N5H F;  4P0X A;  5HN8 A;  3ICZ A;  2Z7H A;  1YQ7 A;  5DHK A;  5E8K A;  5H9D A;  1HX9 A;  5IM1 A;  5ERM A;  3WCD A;  4MC8 A;  5IN8 A;  3WSB A;  4LA6 A;  2ZCQ A;  3WCE A;  5DGM F;  3ICN A;  2PS8 A;  2F8C F;  2RAH A;  4GAX A;  3KBK A;  3ICK A;  4H5C F;  4KQU A;  4WK5 A;  3WC9 A;  3V1V A;  3M0G A;  3KRF A;  3ICM A;  3ID0 A;  5IK9 A;  3P8R A;  3TS7 A;  3LOM A;  3RYW A;  3NPR A;  2Z4W A;  2E8T A;  4LLT A;  4E9U A;  5E8H A;  3N0F A;  2PS7 A;  3PYA A;  3OAC A;  2E92 A;  2Q58 A;  2AET A;  5HN9 A;  2Q9Y A;  2QIS A;  3AE0 A;  1WL0 A;  4XQR F;  4F6X A;  4ZQ8 A;  3AQB B;  2OA6 A;  5CG5 A;  3N1W F;  1KIZ A;  2AEL A;  2Z7I A;  1YYS A;  5B03 A;  2EWG A;  2F94 F;  3EZ3 A;  1V4H A;  2AEK A;  1WL1 A;  3LG5 A;  1N21 A;  4JZB A;  4L2X F;  5AFX A;  4OKM A;  1HXC A;  3PH7 A;  3KB9 A;  5ILH A;  1RQJ A;  4GP1 A;  4JXN A;  3N45 F;  3WCI A;  4RXE A;  4LUU A;  3V1X A;  2Z4V A;  4RXD A;  5AYP A;  5B0J A;  5EAT A;  5EAU A;  4N1Z F;  4EA1 A;  4LTV A;  2J5C A;  5B02 A;  3WCJ A;  2E91 A;  2FTZ A;  5HNA A;  3N3L F;  3LLW A;  3PYB A;  4LPG F;  3WEI A;  3Q2Z A;  2OPM A;  2H8O A;  1YV5 A;  3WCB A;  1ZW5 A;  4JZX A;  2Q80 A;  5JV2 F;  3N6K F;  1V4J A;  2ZCS A;  3ACW A;  4KQ5 A;  4KPJ A;  3RMG A;  4KPD A;  4HD1 A;  3VJ8 A;  1DI1 A;  3LEE A;  3CC9 A;  2DH4 A;  3SDR A;  4EA0 A;  3ACX A;  1V4I A;  1VG3 A;  3KRA B;  1YYR A;  5DHI A;  2Z4Y A;  4LTZ A;  4KWD A;  1V4K A;  2Z4X A;  4DWB A;  5CG6 A;  2J1O A;  4LOB A;  5E8L A;  4KFA A;  4UMJ A;  1DGP A;  2OGD A;  5ILZ A;  3LJI A;  2Z4Z A;  2P1C A;  4JVJ F;  4LPH F;  5A0K A;  5B0M A;  3WJO A;  2Z78 A;  1WL3 A;  5JA0 F;  3ASX A;  4RYP A;  3UCA A;  2F92 F;  1EZF A;  5B0K A;  2OPN A;  3VJ9 A;  3M02 A;  1YJ4 A;  3KRO B;  5IKA A;  3G4F A;  1YHM A;  5DGN F;  4NKE A;  3CKE A;  5DZ2 A;  3WCH A;  3Q2Q A;  4LFV F;  4MC0 A;  4NUA A;  3ZMB A;  3N49 F;  1V4E A;  2F9K F;  3WCM A;  2Q9Z A;  1UBV A;  5B01 A;  4DXJ A;  4LFE A;  1VG7 A;  2ZEV A;  4OGU A;  3S4J A;  5IL3 A;  5IK6 A;  3WE9 A;  3N0G A;  5AHU B;  1N24 A;  4PVY F;  3KRA A;  1UBX A;  3WEF A;  4JYX A;  2E4O A;  4EA2 A;  4F62 A;  3SDU A;  1UBW A;  1RTR A;  3DYF A;  5JV0 F;  1YYU A;  5IKH A;  4P0W A;  1N1B A;  1YHL A;  2FOR A;  1RQI A;  2E8X A;  3B7L A;  3SDT A;  4RXC A;  5IMI A;  3LSN A;  3KRC B;  2AZK A;  3TC1 A;  4DHD A;  3EGT A;  5IMN A;  4OKZ A;  4H5D F;  5IL8 A;  2AZJ A;  3WSA A;  3KRO A;  1HM7 A;  3ZMC A;  5A0J A;  2F8Z F;  3WJK A;  3WEJ A;  5IK0 A;  3SAE A;  4RNQ A;  3VJB A;  1YHK A;  5DW7 A;  5DGS F;  3DYH A;  3N1V F;  5B00 A;  3OAB B;  4QPF A;  4DEM F;  5ILJ A;  3RBM A;  3P41 A;  1FPS A;  3PDE A;  3QKC A;  5B0I A;  2ZEU A;  3OAC B;  3WCA A;  4KVW A;  3LGK A;  5DJP F;  3V66 A;  5C05 A;  3P5P A;  3M01 A;  4LZC A;  3VJC A;  2Z50 A;  4LLS A;  3Q1O A;  5DIQ F;  3WEG A;  3VJA A;  3WJN A;  3TFV A;  2PS4 A;  4Q23 A;  5DJR F; 
#chains in the Genus database with same CATH topology
 3M9U A;  1UBY A;  5DJV F;  1VG2 A;  1N23 A;  4KUX A;  4QXS F;  3TFN A;  4JXY A;  3NRI A;  4KQS A;  3EFQ A;  3KRC A;  4GP2 A;  4FJQ A;  3TFP A;  2E90 A;  4GA3 A;  3LGZ B;  1WY0 A;  4RXA A;  2E94 A;  4LIX A;  1HXA A;  3ACY A;  4XQS F;  4DZW A;  4KVD A;  4KVY A;  3IBA A;  4DI5 A;  4F6V A;  3WCC A;  1JFA A;  1PS1 A;  4OMH A;  3LVS A;  5ERN A;  2E8U A;  3VJE A;  1N22 A;  3LMD A;  4E1E A;  4NG6 A;  3OAB A;  1HM4 A;  3OYR A;  4KK2 A;  5JV1 F;  3APZ A;  3VJD A;  5ILI A;  1HXG A;  1VG4 A;  3WCG A;  4PVX F;  3M00 A;  2PS5 A;  5HN7 A;  3WCL A;  2F89 F;  3IPI A;  3LZ9 A;  4NFK F;  3AQC B;  2O1O A;  3G4D A;  4H5E F;  4DWG A;  4LA5 A;  5ILY A;  3KRP B;  4LXW A;  2ZCR A;  5ILK A;  1VG6 A;  3ZCD A;  4E9Z A;  4K10 A;  5ER8 A;  3ZL6 A;  4LFG A;  3Q30 A;  1WMW A;  2ZY1 A;  3N46 F;  4NFI F;  1KIY A;  3ZOU A;  5I1U A;  1YYQ A;  3W7F A;  4N9U A;  2Z52 A;  1YYT A;  5A0I A;  1N1Z A;  2E8V A;  3PKO A;  1WL2 A;  3BNY A;  4KVI A;  3WEK A;  2AZL A;  5ILD A;  2ZCO A;  3P8L A;  3QQV A;  5B0L A;  3LDW A;  3N3D A;  3N5J F;  3KRF B;  4P0V A;  3BNX A;  1WKZ A;  4XQT F;  3ADZ A;  3P5R A;  3MAV A;  4MC3 A;  3CP6 A;  4NKF A;  4LZ0 A;  1JFG A;  2F7M F;  4FP4 A;  3NF2 A;  5KSX F;  4OMG A;  5ERO A;  2PS6 A;  3RYE A;  2E8W A;  3SDQ A;  2I19 A;  4KKM A;  2E93 A;  2VF6 A;  2J1P A;  2E95 A;  3NPK A;  3S9V A;  4LZ3 A;  3LK5 A;  3DYG A;  5EAS A;  3SDV A;  3MZV A;  2ONH A;  5AEL A;  3WEH A;  3WCF A;  4NFJ F;  2ONG A;  5IVG A;  5JUZ F;  3KRP A;  1N20 A;  3AQ0 A;  5IMP A;  3N5H F;  4P0X A;  5HN8 A;  3ICZ A;  2Z7H A;  1YQ7 A;  5DHK A;  5E8K A;  5H9D A;  1HX9 A;  5IM1 A;  5ERM A;  3WCD A;  4MC8 A;  5IN8 A;  3WSB A;  4LA6 A;  2ZCQ A;  3WCE A;  5DGM F;  3ICN A;  2PS8 A;  2F8C F;  2RAH A;  4GAX A;  3KBK A;  3ICK A;  4H5C F;  4KQU A;  4WK5 A;  3WC9 A;  3V1V A;  3M0G A;  3KRF A;  3ICM A;  3ID0 A;  5IK9 A;  3P8R A;  3TS7 A;  3LOM A;  3RYW A;  3NPR A;  2Z4W A;  2E8T A;  4LLT A;  4E9U A;  5E8H A;  3N0F A;  2PS7 A;  3PYA A;  3OAC A;  2E92 A;  2Q58 A;  2AET A;  5HN9 A;  2Q9Y A;  2QIS A;  3AE0 A;  1WL0 A;  4XQR F;  4F6X A;  4ZQ8 A;  3AQB B;  2OA6 A;  5CG5 A;  3N1W F;  1KIZ A;  2AEL A;  2Z7I A;  1YYS A;  5B03 A;  2EWG A;  2F94 F;  3EZ3 A;  1V4H A;  2AEK A;  1WL1 A;  3LG5 A;  1N21 A;  4JZB A;  4L2X F;  5AFX A;  4OKM A;  1HXC A;  3PH7 A;  3KB9 A;  5ILH A;  1RQJ A;  4GP1 A;  4JXN A;  3N45 F;  3WCI A;  4RXE A;  4LUU A;  3V1X A;  2Z4V A;  4RXD A;  5AYP A;  5B0J A;  5EAT A;  5EAU A;  4N1Z F;  4EA1 A;  4LTV A;  2J5C A;  5B02 A;  3WCJ A;  2E91 A;  2FTZ A;  5HNA A;  3N3L F;  3LLW A;  3PYB A;  4LPG F;  3WEI A;  3Q2Z A;  2OPM A;  2H8O A;  1YV5 A;  3WCB A;  1ZW5 A;  4JZX A;  2Q80 A;  5JV2 F;  3N6K F;  1V4J A;  2ZCS A;  3ACW A;  4KQ5 A;  4KPJ A;  3RMG A;  4KPD A;  4HD1 A;  3VJ8 A;  1DI1 A;  3LEE A;  3CC9 A;  2DH4 A;  3SDR A;  4EA0 A;  3ACX A;  1V4I A;  1VG3 A;  3KRA B;  1YYR A;  5DHI A;  2Z4Y A;  4LTZ A;  4KWD A;  1V4K A;  2Z4X A;  4DWB A;  5CG6 A;  2J1O A;  4LOB A;  5E8L A;  4KFA A;  4UMJ A;  1DGP A;  2OGD A;  5ILZ A;  3LJI A;  2Z4Z A;  2P1C A;  4JVJ F;  4LPH F;  5A0K A;  5B0M A;  3WJO A;  2Z78 A;  1WL3 A;  5JA0 F;  3ASX A;  4RYP A;  3UCA A;  2F92 F;  1EZF A;  5B0K A;  2OPN A;  3VJ9 A;  3M02 A;  1YJ4 A;  3KRO B;  5IKA A;  3G4F A;  1YHM A;  5DGN F;  4NKE A;  3CKE A;  5DZ2 A;  3WCH A;  3Q2Q A;  4LFV F;  4MC0 A;  4NUA A;  3ZMB A;  3N49 F;  1V4E A;  2F9K F;  3WCM A;  2Q9Z A;  1UBV A;  5B01 A;  4DXJ A;  4LFE A;  1VG7 A;  2ZEV A;  4OGU A;  3S4J A;  5IL3 A;  5IK6 A;  3WE9 A;  3N0G A;  5AHU B;  1N24 A;  4PVY F;  3KRA A;  1UBX A;  3WEF A;  4JYX A;  2E4O A;  4EA2 A;  4F62 A;  3SDU A;  1UBW A;  1RTR A;  3DYF A;  5JV0 F;  1YYU A;  5IKH A;  4P0W A;  1N1B A;  1YHL A;  2FOR A;  1RQI A;  2E8X A;  3B7L A;  3SDT A;  4RXC A;  5IMI A;  3LSN A;  3KRC B;  2AZK A;  3TC1 A;  4DHD A;  3EGT A;  5IMN A;  4OKZ A;  4H5D F;  5IL8 A;  2AZJ A;  3WSA A;  3KRO A;  1HM7 A;  3ZMC A;  5A0J A;  2F8Z F;  3WJK A;  3WEJ A;  5IK0 A;  3SAE A;  4RNQ A;  3VJB A;  1YHK A;  5DW7 A;  5DGS F;  3DYH A;  3N1V F;  5B00 A;  3OAB B;  4QPF A;  4DEM F;  5ILJ A;  3RBM A;  3P41 A;  1FPS A;  3PDE A;  3QKC A;  5B0I A;  2ZEU A;  3OAC B;  3WCA A;  4KVW A;  3LGK A;  5DJP F;  3V66 A;  5C05 A;  3P5P A;  3M01 A;  4LZC A;  3VJC A;  2Z50 A;  4LLS A;  3Q1O A;  5DIQ F;  3WEG A;  3VJA A;  3WJN A;  3TFV A;  2PS4 A;  4Q23 A;  5DJR F; 
#chains in the Genus database with same CATH homology
 3M9U A;  1UBY A;  5DJV F;  1VG2 A;  1N23 A;  4KUX A;  4QXS F;  3TFN A;  4JXY A;  3NRI A;  4KQS A;  3EFQ A;  3KRC A;  4GP2 A;  4FJQ A;  3TFP A;  2E90 A;  4GA3 A;  3LGZ B;  1WY0 A;  4RXA A;  2E94 A;  4LIX A;  1HXA A;  3ACY A;  4XQS F;  4DZW A;  4KVD A;  4KVY A;  3IBA A;  4DI5 A;  4F6V A;  3WCC A;  1JFA A;  1PS1 A;  4OMH A;  3LVS A;  5ERN A;  2E8U A;  3VJE A;  1N22 A;  3LMD A;  4E1E A;  4NG6 A;  3OAB A;  1HM4 A;  3OYR A;  4KK2 A;  5JV1 F;  3APZ A;  3VJD A;  5ILI A;  1HXG A;  1VG4 A;  3WCG A;  4PVX F;  3M00 A;  2PS5 A;  5HN7 A;  3WCL A;  2F89 F;  3IPI A;  3LZ9 A;  4NFK F;  3AQC B;  2O1O A;  3G4D A;  4H5E F;  4DWG A;  4LA5 A;  5ILY A;  3KRP B;  4LXW A;  2ZCR A;  5ILK A;  1VG6 A;  3ZCD A;  4E9Z A;  4K10 A;  5ER8 A;  3ZL6 A;  4LFG A;  3Q30 A;  1WMW A;  2ZY1 A;  3N46 F;  4NFI F;  1KIY A;  3ZOU A;  5I1U A;  1YYQ A;  3W7F A;  4N9U A;  2Z52 A;  1YYT A;  5A0I A;  1N1Z A;  2E8V A;  3PKO A;  1WL2 A;  3BNY A;  4KVI A;  3WEK A;  2AZL A;  5ILD A;  2ZCO A;  3P8L A;  3QQV A;  5B0L A;  3LDW A;  3N3D A;  3N5J F;  3KRF B;  4P0V A;  3BNX A;  1WKZ A;  4XQT F;  3ADZ A;  3P5R A;  3MAV A;  4MC3 A;  3CP6 A;  4NKF A;  4LZ0 A;  1JFG A;  2F7M F;  4FP4 A;  3NF2 A;  5KSX F;  4OMG A;  5ERO A;  2PS6 A;  3RYE A;  2E8W A;  3SDQ A;  2I19 A;  4KKM A;  2E93 A;  2VF6 A;  2J1P A;  2E95 A;  3NPK A;  3S9V A;  4LZ3 A;  3LK5 A;  3DYG A;  5EAS A;  3SDV A;  3MZV A;  2ONH A;  5AEL A;  3WEH A;  3WCF A;  4NFJ F;  2ONG A;  5IVG A;  5JUZ F;  3KRP A;  1N20 A;  3AQ0 A;  5IMP A;  3N5H F;  4P0X A;  5HN8 A;  3ICZ A;  2Z7H A;  1YQ7 A;  5DHK A;  5E8K A;  5H9D A;  1HX9 A;  5IM1 A;  5ERM A;  3WCD A;  4MC8 A;  5IN8 A;  3WSB A;  4LA6 A;  2ZCQ A;  3WCE A;  5DGM F;  3ICN A;  2PS8 A;  2F8C F;  2RAH A;  4GAX A;  3KBK A;  3ICK A;  4H5C F;  4KQU A;  4WK5 A;  3WC9 A;  3V1V A;  3M0G A;  3KRF A;  3ICM A;  3ID0 A;  5IK9 A;  3P8R A;  3TS7 A;  3LOM A;  3RYW A;  3NPR A;  2Z4W A;  2E8T A;  4LLT A;  4E9U A;  5E8H A;  3N0F A;  2PS7 A;  3PYA A;  3OAC A;  2E92 A;  2Q58 A;  2AET A;  5HN9 A;  2Q9Y A;  2QIS A;  3AE0 A;  1WL0 A;  4XQR F;  4F6X A;  4ZQ8 A;  3AQB B;  2OA6 A;  5CG5 A;  3N1W F;  1KIZ A;  2AEL A;  2Z7I A;  1YYS A;  5B03 A;  2EWG A;  2F94 F;  3EZ3 A;  1V4H A;  2AEK A;  1WL1 A;  3LG5 A;  1N21 A;  4JZB A;  4L2X F;  5AFX A;  4OKM A;  1HXC A;  3PH7 A;  3KB9 A;  5ILH A;  1RQJ A;  4GP1 A;  4JXN A;  3N45 F;  3WCI A;  4RXE A;  4LUU A;  3V1X A;  2Z4V A;  4RXD A;  5AYP A;  5B0J A;  5EAT A;  5EAU A;  4N1Z F;  4EA1 A;  4LTV A;  2J5C A;  5B02 A;  3WCJ A;  2E91 A;  2FTZ A;  5HNA A;  3N3L F;  3LLW A;  3PYB A;  4LPG F;  3WEI A;  3Q2Z A;  2OPM A;  2H8O A;  1YV5 A;  3WCB A;  1ZW5 A;  4JZX A;  2Q80 A;  5JV2 F;  3N6K F;  1V4J A;  2ZCS A;  3ACW A;  4KQ5 A;  4KPJ A;  3RMG A;  4KPD A;  4HD1 A;  3VJ8 A;  1DI1 A;  3LEE A;  3CC9 A;  2DH4 A;  3SDR A;  4EA0 A;  3ACX A;  1V4I A;  1VG3 A;  3KRA B;  1YYR A;  5DHI A;  2Z4Y A;  4LTZ A;  4KWD A;  1V4K A;  2Z4X A;  4DWB A;  5CG6 A;  2J1O A;  4LOB A;  5E8L A;  4KFA A;  4UMJ A;  1DGP A;  2OGD A;  5ILZ A;  3LJI A;  2Z4Z A;  2P1C A;  4JVJ F;  4LPH F;  5A0K A;  5B0M A;  3WJO A;  2Z78 A;  1WL3 A;  5JA0 F;  3ASX A;  4RYP A;  3UCA A;  2F92 F;  1EZF A;  5B0K A;  2OPN A;  3VJ9 A;  3M02 A;  1YJ4 A;  3KRO B;  5IKA A;  3G4F A;  1YHM A;  5DGN F;  4NKE A;  3CKE A;  5DZ2 A;  3WCH A;  3Q2Q A;  4LFV F;  4MC0 A;  4NUA A;  3ZMB A;  3N49 F;  1V4E A;  2F9K F;  3WCM A;  2Q9Z A;  1UBV A;  5B01 A;  4DXJ A;  4LFE A;  1VG7 A;  2ZEV A;  4OGU A;  3S4J A;  5IL3 A;  5IK6 A;  3WE9 A;  3N0G A;  5AHU B;  1N24 A;  4PVY F;  3KRA A;  1UBX A;  3WEF A;  4JYX A;  2E4O A;  4EA2 A;  4F62 A;  3SDU A;  1UBW A;  1RTR A;  3DYF A;  5JV0 F;  1YYU A;  5IKH A;  4P0W A;  1N1B A;  1YHL A;  2FOR A;  1RQI A;  2E8X A;  3B7L A;  3SDT A;  4RXC A;  5IMI A;  3LSN A;  3KRC B;  2AZK A;  3TC1 A;  4DHD A;  3EGT A;  5IMN A;  4OKZ A;  4H5D F;  5IL8 A;  2AZJ A;  3WSA A;  3KRO A;  1HM7 A;  3ZMC A;  5A0J A;  2F8Z F;  3WJK A;  3WEJ A;  5IK0 A;  3SAE A;  4RNQ A;  3VJB A;  1YHK A;  5DW7 A;  5DGS F;  3DYH A;  3N1V F;  5B00 A;  3OAB B;  4QPF A;  4DEM F;  5ILJ A;  3RBM A;  3P41 A;  1FPS A;  3PDE A;  3QKC A;  5B0I A;  2ZEU A;  3OAC B;  3WCA A;  4KVW A;  3LGK A;  5DJP F;  3V66 A;  5C05 A;  3P5P A;  3M01 A;  4LZC A;  3VJC A;  2Z50 A;  4LLS A;  3Q1O A;  5DIQ F;  3WEG A;  3VJA A;  3WJN A;  3TFV A;  2PS4 A;  4Q23 A;  5DJR F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...