5B03A

Structure of moen5-sso7d fusion protein in complex with geranyl pyrophosphate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
264
structure length
264
Chain Sequence
VDDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, dna binding protein
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
total genus 115
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b03A00
5EASA 4QXSF 4NKFA 5IM1A 3N49F 1HXGA 4GA3A 3VJ8A 3N0FA 3KRFA 2AETA 5ER8A 3G4FA 1YV5A 3LDWA 4UMJA 3VJEA 5A0IA 2AZJA 4LXWA 2ZCQA 4KVYA 3VJCA 3ID0A 5JUZF 4KVDA 4P0WA 5KSXF 3LSNA 4XQRF 5DGSF 4KPDA 4MC0A 3LG5A 1WL0A 1YHMA 4RXEA 3PYAA 5DJVF 1WL2A 3CC9A 1YYSA 1HXAA 1V4IA 2E8WA 3TS7A 3WCJA 1EZFA 4P0XA 5ILIA 1KIZA 2ZEUA 4P0VA 2ONHA 3WCGA 3WCAA 5IMPA 3ACWA 4E1EA 3G4DA 3KROA 4KQUA 2Z4XA 2EWGA 1KIYA 3KROB 4RXDA 2Q80A 5IVGA 3DYGA 3KB9A 5B0MA 2Z4YA 3WCIA 3EZ3A 4RNQA 1N21A 5ILHA 3VJAA 3N1WF 5JV2F 3SDVA 2E92A 1YYRA 3M02A 4DHDA 5JV0F 3VJDA 4LZ0A 4H5DF 2Z7IA 3PDEA 3DYFA 5IK0A 1YYTA 2ZEVA 1JFGA 5B0LA 5B02A 1RQJA 3N1VF 4OKZA 3TFNA 3N0GA 5AELA 1RTRA 5IK6A 4LFGA 1WL3A 3WCBA 1HX9A 4KUXA 3WCMA 3AQCB 4LPHF 4Q23A 4F6XA 3S4JA 4KVIA 4F6VA 3WJNA 2OPNA 4LZ3A 3WSBA 4NG6A 3WE9A 2E90A 3QQVA 2I19A 1YHLA 3QKCA 4KK2A 1FPSA 5B0KA 2Z4VA 3LMDA 3N5HF 3LZ9A 3ACYA 5IK9A 4DXJA 3AQBB 3AE0A 2E8UA 2F7MF 1VG2A 1PS1A 2F8ZF 3VJ9A 4PVYF 2E8VA 4MC8A 3NF2A 3S9VA 4LLSA 3N3LF 4KQSA 5E8KA 3NPKA 3M00A 3PH7A 3NPRA 1WKZA 3DYHA 1HXCA 5HN7A 5ILZA 4FJQA 2E8XA 4N1ZF 1YYUA 5IMNA 3KRCA 5EATA 4DI5A 3IBAA 2FTZA 3KRCB 3N46F 2RAHA 2E95A 3LGKA 2ZCRA 4K10A 1HM7A 4JZBA 4L2XF 5HNAA 1UBVA 5IKAA 3KRAA 3UCAA 4NUAA 4JZXA 3SDQA 2Q58A 3M0GA 4H5EF 2DH4A 3KRAB 3B7LA 5ERNA 1UBYA 5DW7A 4E9UA 5E8LA 3ICKA 3N5JF 4LPGF 1DI1A 4OMGA 5C05A 5HN9A 1N1BA 5AHUB 3CKEA 4JXNA 1YQ7A 3Q2QA 4LA5A 2OGDA 2AZKA 4DZWA 3WCEA 3Q2ZA 3Q1OA 3APZA 2F89F 4XQSF 2Z50A 4KVWA 2ZCSA 5ERMA 2Z52A 3LGZB 3SDUA 2Z78A 2F92F 3M01A 3OACA 1YJ4A 3LEEA 3WJOA 4N9UA 3MAVA 1VG4A 5ILYA 3MZVA 3ZCDA 3OACB 5HN8A 4XQTF 1WL1A 1ZW5A 2ZY1A 3BNYA 5IN8A 2H8OA 2ZCOA 2FORA 4OKMA 3ICMA 5DJRF 4EA2A 4LOBA 4FP4A 2PS4A 1V4JA 3N45F 4JXYA 4H5CF 3TFPA 4RXCA 3SAEA 3LOMA 4LLTA 1N22A 2PS7A 5DGNF 5IL8A 2PS6A 5B00A 5IKHA 2QISA 2F9KF 3LJIA 3WCFA 1V4EA 4OMHA 1DGPA 3WEJA 5DHIA 1N1ZA 3WJKA 3RBMA 4GAXA 3ZMBA 2AZLA 3Q30A 4KFAA 2Q9ZA 3BNXA 3ICZA 4EA0A 4WK5A 3N6KF 3EGTA 5DZ2A 2F8CF 3SDRA 4NFIF 2PS5A 5B0JA 3WCLA 5ILKA 4QPFA 4F62A 3KRPA 4DEMF 3TFVA 3ADZA 1UBXA 2Z7HA 1N24A 4LIXA 4LTVA 3KRPB 3LVSA 3M9UA 4PVXF 3V66A 5B03A 5A0JA 3W7FA 3ZL6A 3LK5A 3V1VA 2AEKA 2F94F 2E91A 4E9ZA 3WC9A 3WEGA 4DWBA 2E4OA 4LTZA 3KRFB 3CP6A 3ACXA 3IPIA 4NFJF 1VG3A 3VJBA 2ONGA 3TC1A 1RQIA 3ASXA 4JVJF 3SDTA 4LUUA 5JV1F 5B0IA 3LLWA 2J1PA 4GP1A 5EAUA 3WEFA 4JYXA 3P5PA 3P8RA 3WCDA 3OABA 2PS8A 3ZMCA 5I1UA 1VG6A 4RXAA 3V1XA 5DHKA 3P8LA 3N3DA 1VG7A 3OABB 1UBWA 1YHKA 4KQ5A 4MC3A 5DGMF 4LFEA 5CG6A 5JA0F 3RMGA 3EFQA 2E8TA 3WSAA 5H9DA 4KWDA 5CG5A 1JFAA 5ILDA 3RYEA 3PYBA 2O1OA 3OYRA 2Z4ZA 5IMIA 1HM4A 4ZQ8A 5ILJA 2VF6A 3PKOA 3WEIA 3WCCA 5A0KA 2E93A 2E94A 3P5RA 1V4HA 2P1CA 3NRIA 3KBKA 1V4KA 4LA6A 2Z4WA 3WEKA 2OA6A 4RYPA 3AQ0A 2Q9YA 2J1OA 3P41A 1N20A 4KPJA 5IL3A 3WCHA 4OGUA 1YYQA 4EA1A 5B01A 5AYPA 3ICNA 1N23A 5DJPF 5E8HA 2OPMA 5EROA 3WEHA 1WY0A 4DWGA 1WMWA 2J5CA 4NKEA 4KKMA 4HD1A 5DIQF 4NFKF 4GP2A 3RYWA 5AFXA 2AELA 3ZOUA 4LFVF 4LZCA
chains in the Genus database with same CATH superfamily
5EASA 4QXSF 4NKFA 5IM1A 3N49F 1HXGA 4GA3A 3VJ8A 3N0FA 3KRFA 2AETA 5ER8A 3G4FA 1YV5A 3LDWA 4UMJA 3VJEA 5A0IA 2AZJA 4LXWA 2ZCQA 4KVYA 3VJCA 3ID0A 5JUZF 4KVDA 4P0WA 5KSXF 3LSNA 4XQRF 5DGSF 4KPDA 4MC0A 3LG5A 1WL0A 1YHMA 4RXEA 3PYAA 5DJVF 1WL2A 3CC9A 1YYSA 1HXAA 1V4IA 2E8WA 3TS7A 3WCJA 1EZFA 4P0XA 5ILIA 1KIZA 2ZEUA 4P0VA 2ONHA 3WCGA 3WCAA 5IMPA 3ACWA 4E1EA 3G4DA 3KROA 4KQUA 2Z4XA 2EWGA 1KIYA 3KROB 4RXDA 2Q80A 5IVGA 3DYGA 3KB9A 5B0MA 2Z4YA 3WCIA 3EZ3A 4RNQA 1N21A 5ILHA 3VJAA 3N1WF 5JV2F 3SDVA 2E92A 1YYRA 3M02A 4DHDA 5JV0F 3VJDA 4LZ0A 4H5DF 2Z7IA 3PDEA 3DYFA 5IK0A 1YYTA 2ZEVA 1JFGA 5B0LA 5B02A 1RQJA 3N1VF 4OKZA 3TFNA 3N0GA 5AELA 1RTRA 5IK6A 4LFGA 1WL3A 3WCBA 1HX9A 4KUXA 3WCMA 3AQCB 4LPHF 4Q23A 4F6XA 3S4JA 4KVIA 4F6VA 3WJNA 2OPNA 4LZ3A 3WSBA 4NG6A 3WE9A 2E90A 3QQVA 2I19A 1YHLA 3QKCA 4KK2A 1FPSA 5B0KA 2Z4VA 3LMDA 3N5HF 3LZ9A 3ACYA 5IK9A 4DXJA 3AQBB 3AE0A 2E8UA 2F7MF 1VG2A 1PS1A 2F8ZF 3VJ9A 4PVYF 2E8VA 4MC8A 3NF2A 3S9VA 4LLSA 3N3LF 4KQSA 5E8KA 3NPKA 3M00A 3PH7A 3NPRA 1WKZA 3DYHA 1HXCA 5HN7A 5ILZA 4FJQA 2E8XA 4N1ZF 1YYUA 5IMNA 3KRCA 5EATA 4DI5A 3IBAA 2FTZA 3KRCB 3N46F 2RAHA 2E95A 3LGKA 2ZCRA 4K10A 1HM7A 4JZBA 4L2XF 5HNAA 1UBVA 5IKAA 3KRAA 3UCAA 4NUAA 4JZXA 3SDQA 2Q58A 3M0GA 4H5EF 2DH4A 3KRAB 3B7LA 5ERNA 1UBYA 5DW7A 4E9UA 5E8LA 3ICKA 3N5JF 4LPGF 1DI1A 4OMGA 5C05A 5HN9A 1N1BA 5AHUB 3CKEA 4JXNA 1YQ7A 3Q2QA 4LA5A 2OGDA 2AZKA 4DZWA 3WCEA 3Q2ZA 3Q1OA 3APZA 2F89F 4XQSF 2Z50A 4KVWA 2ZCSA 5ERMA 2Z52A 3LGZB 3SDUA 2Z78A 2F92F 3M01A 3OACA 1YJ4A 3LEEA 3WJOA 4N9UA 3MAVA 1VG4A 5ILYA 3MZVA 3ZCDA 3OACB 5HN8A 4XQTF 1WL1A 1ZW5A 2ZY1A 3BNYA 5IN8A 2H8OA 2ZCOA 2FORA 4OKMA 3ICMA 5DJRF 4EA2A 4LOBA 4FP4A 2PS4A 1V4JA 3N45F 4JXYA 4H5CF 3TFPA 4RXCA 3SAEA 3LOMA 4LLTA 1N22A 2PS7A 5DGNF 5IL8A 2PS6A 5B00A 5IKHA 2QISA 2F9KF 3LJIA 3WCFA 1V4EA 4OMHA 1DGPA 3WEJA 5DHIA 1N1ZA 3WJKA 3RBMA 4GAXA 3ZMBA 2AZLA 3Q30A 4KFAA 2Q9ZA 3BNXA 3ICZA 4EA0A 4WK5A 3N6KF 3EGTA 5DZ2A 2F8CF 3SDRA 4NFIF 2PS5A 5B0JA 3WCLA 5ILKA 4QPFA 4F62A 3KRPA 4DEMF 3TFVA 3ADZA 1UBXA 2Z7HA 1N24A 4LIXA 4LTVA 3KRPB 3LVSA 3M9UA 4PVXF 3V66A 5B03A 5A0JA 3W7FA 3ZL6A 3LK5A 3V1VA 2AEKA 2F94F 2E91A 4E9ZA 3WC9A 3WEGA 4DWBA 2E4OA 4LTZA 3KRFB 3CP6A 3ACXA 3IPIA 4NFJF 1VG3A 3VJBA 2ONGA 3TC1A 1RQIA 3ASXA 4JVJF 3SDTA 4LUUA 5JV1F 5B0IA 3LLWA 2J1PA 4GP1A 5EAUA 3WEFA 4JYXA 3P5PA 3P8RA 3WCDA 3OABA 2PS8A 3ZMCA 5I1UA 1VG6A 4RXAA 3V1XA 5DHKA 3P8LA 3N3DA 1VG7A 3OABB 1UBWA 1YHKA 4KQ5A 4MC3A 5DGMF 4LFEA 5CG6A 5JA0F 3RMGA 3EFQA 2E8TA 3WSAA 5H9DA 4KWDA 5CG5A 1JFAA 5ILDA 3RYEA 3PYBA 2O1OA 3OYRA 2Z4ZA 5IMIA 1HM4A 4ZQ8A 5ILJA 2VF6A 3PKOA 3WEIA 3WCCA 5A0KA 2E93A 2E94A 3P5RA 1V4HA 2P1CA 3NRIA 3KBKA 1V4KA 4LA6A 2Z4WA 3WEKA 2OA6A 4RYPA 3AQ0A 2Q9YA 2J1OA 3P41A 1N20A 4KPJA 5IL3A 3WCHA 4OGUA 1YYQA 4EA1A 5B01A 5AYPA 3ICNA 1N23A 5DJPF 5E8HA 2OPMA 5EROA 3WEHA 1WY0A 4DWGA 1WMWA 2J5CA 4NKEA 4KKMA 4HD1A 5DIQF 4NFKF 4GP2A 3RYWA 5AFXA 2AELA 3ZOUA 4LFVF 4LZCA
chains in the Genus database with same CATH topology
5EASA 4QXSF 4NKFA 5IM1A 3N49F 1HXGA 4GA3A 3VJ8A 3N0FA 3KRFA 2AETA 5ER8A 3G4FA 1YV5A 3LDWA 4UMJA 3VJEA 5A0IA 2AZJA 4LXWA 2ZCQA 4KVYA 3VJCA 3ID0A 5JUZF 4KVDA 4P0WA 5KSXF 3LSNA 4XQRF 5DGSF 4KPDA 4MC0A 3LG5A 1WL0A 1YHMA 4RXEA 3PYAA 5DJVF 1WL2A 3CC9A 1YYSA 1HXAA 1V4IA 2E8WA 3TS7A 3WCJA 1EZFA 4P0XA 5ILIA 1KIZA 2ZEUA 4P0VA 2ONHA 3WCGA 3WCAA 5IMPA 3ACWA 4E1EA 3G4DA 3KROA 4KQUA 2Z4XA 2EWGA 1KIYA 3KROB 4RXDA 2Q80A 5IVGA 3DYGA 3KB9A 5B0MA 2Z4YA 3WCIA 3EZ3A 4RNQA 1N21A 5ILHA 3VJAA 3N1WF 5JV2F 3SDVA 2E92A 1YYRA 3M02A 4DHDA 5JV0F 3VJDA 4LZ0A 4H5DF 2Z7IA 3PDEA 3DYFA 5IK0A 1YYTA 2ZEVA 1JFGA 5B0LA 5B02A 1RQJA 3N1VF 4OKZA 3TFNA 3N0GA 5AELA 1RTRA 5IK6A 4LFGA 1WL3A 3WCBA 1HX9A 4KUXA 3WCMA 3AQCB 4LPHF 4Q23A 4F6XA 3S4JA 4KVIA 4F6VA 3WJNA 2OPNA 4LZ3A 3WSBA 4NG6A 3WE9A 2E90A 3QQVA 2I19A 1YHLA 3QKCA 4KK2A 1FPSA 5B0KA 2Z4VA 3LMDA 3N5HF 3LZ9A 3ACYA 5IK9A 4DXJA 3AQBB 3AE0A 2E8UA 2F7MF 1VG2A 1PS1A 2F8ZF 3VJ9A 4PVYF 2E8VA 4MC8A 3NF2A 3S9VA 4LLSA 3N3LF 4KQSA 5E8KA 3NPKA 3M00A 3PH7A 3NPRA 1WKZA 3DYHA 1HXCA 5HN7A 5ILZA 4FJQA 2E8XA 4N1ZF 1YYUA 5IMNA 3KRCA 5EATA 4DI5A 3IBAA 2FTZA 3KRCB 3N46F 2RAHA 2E95A 3LGKA 2ZCRA 4K10A 1HM7A 4JZBA 4L2XF 5HNAA 1UBVA 5IKAA 3KRAA 3UCAA 4NUAA 4JZXA 3SDQA 2Q58A 3M0GA 4H5EF 2DH4A 3KRAB 3B7LA 5ERNA 1UBYA 5DW7A 4E9UA 5E8LA 3ICKA 3N5JF 4LPGF 1DI1A 4OMGA 5C05A 5HN9A 1N1BA 5AHUB 3CKEA 4JXNA 1YQ7A 3Q2QA 4LA5A 2OGDA 2AZKA 4DZWA 3WCEA 3Q2ZA 3Q1OA 3APZA 2F89F 4XQSF 2Z50A 4KVWA 2ZCSA 5ERMA 2Z52A 3LGZB 3SDUA 2Z78A 2F92F 3M01A 3OACA 1YJ4A 3LEEA 3WJOA 4N9UA 3MAVA 1VG4A 5ILYA 3MZVA 3ZCDA 3OACB 5HN8A 4XQTF 1WL1A 1ZW5A 2ZY1A 3BNYA 5IN8A 2H8OA 2ZCOA 2FORA 4OKMA 3ICMA 5DJRF 4EA2A 4LOBA 4FP4A 2PS4A 1V4JA 3N45F 4JXYA 4H5CF 3TFPA 4RXCA 3SAEA 3LOMA 4LLTA 1N22A 2PS7A 5DGNF 5IL8A 2PS6A 5B00A 5IKHA 2QISA 2F9KF 3LJIA 3WCFA 1V4EA 4OMHA 1DGPA 3WEJA 5DHIA 1N1ZA 3WJKA 3RBMA 4GAXA 3ZMBA 2AZLA 3Q30A 4KFAA 2Q9ZA 3BNXA 3ICZA 4EA0A 4WK5A 3N6KF 3EGTA 5DZ2A 2F8CF 3SDRA 4NFIF 2PS5A 5B0JA 3WCLA 5ILKA 4QPFA 4F62A 3KRPA 4DEMF 3TFVA 3ADZA 1UBXA 2Z7HA 1N24A 4LIXA 4LTVA 3KRPB 3LVSA 3M9UA 4PVXF 3V66A 5B03A 5A0JA 3W7FA 3ZL6A 3LK5A 3V1VA 2AEKA 2F94F 2E91A 4E9ZA 3WC9A 3WEGA 4DWBA 2E4OA 4LTZA 3KRFB 3CP6A 3ACXA 3IPIA 4NFJF 1VG3A 3VJBA 2ONGA 3TC1A 1RQIA 3ASXA 4JVJF 3SDTA 4LUUA 5JV1F 5B0IA 3LLWA 2J1PA 4GP1A 5EAUA 3WEFA 4JYXA 3P5PA 3P8RA 3WCDA 3OABA 2PS8A 3ZMCA 5I1UA 1VG6A 4RXAA 3V1XA 5DHKA 3P8LA 3N3DA 1VG7A 3OABB 1UBWA 1YHKA 4KQ5A 4MC3A 5DGMF 4LFEA 5CG6A 5JA0F 3RMGA 3EFQA 2E8TA 3WSAA 5H9DA 4KWDA 5CG5A 1JFAA 5ILDA 3RYEA 3PYBA 2O1OA 3OYRA 2Z4ZA 5IMIA 1HM4A 4ZQ8A 5ILJA 2VF6A 3PKOA 3WEIA 3WCCA 5A0KA 2E93A 2E94A 3P5RA 1V4HA 2P1CA 3NRIA 3KBKA 1V4KA 4LA6A 2Z4WA 3WEKA 2OA6A 4RYPA 3AQ0A 2Q9YA 2J1OA 3P41A 1N20A 4KPJA 5IL3A 3WCHA 4OGUA 1YYQA 4EA1A 5B01A 5AYPA 3ICNA 1N23A 5DJPF 5E8HA 2OPMA 5EROA 3WEHA 1WY0A 4DWGA 1WMWA 2J5CA 4NKEA 4KKMA 4HD1A 5DIQF 4NFKF 4GP2A 3RYWA 5AFXA 2AELA 3ZOUA 4LFVF 4LZCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EAS A;  4QXS F;  4NKF A;  5IM1 A;  3N49 F;  1HXG A;  4GA3 A;  3VJ8 A;  3N0F A;  3KRF A;  2AET A;  5ER8 A;  3G4F A;  1YV5 A;  3LDW A;  4UMJ A;  3VJE A;  5A0I A;  2AZJ A;  4LXW A;  2ZCQ A;  4KVY A;  3VJC A;  3ID0 A;  5JUZ F;  4KVD A;  4P0W A;  5KSX F;  3LSN A;  4XQR F;  5DGS F;  4KPD A;  4MC0 A;  3LG5 A;  1WL0 A;  1YHM A;  4RXE A;  3PYA A;  5DJV F;  1WL2 A;  3CC9 A;  1YYS A;  1HXA A;  1V4I A;  2E8W A;  3TS7 A;  3WCJ A;  1EZF A;  4P0X A;  5ILI A;  1KIZ A;  2ZEU A;  4P0V A;  2ONH A;  3WCG A;  3WCA A;  5IMP A;  3ACW A;  4E1E A;  3G4D A;  3KRO A;  4KQU A;  2Z4X A;  2EWG A;  1KIY A;  3KRO B;  4RXD A;  2Q80 A;  5IVG A;  3DYG A;  3KB9 A;  5B0M A;  2Z4Y A;  3WCI A;  3EZ3 A;  4RNQ A;  1N21 A;  5ILH A;  3VJA A;  3N1W F;  5JV2 F;  3SDV A;  2E92 A;  1YYR A;  3M02 A;  4DHD A;  5JV0 F;  3VJD A;  4LZ0 A;  4H5D F;  2Z7I A;  3PDE A;  3DYF A;  5IK0 A;  1YYT A;  2ZEV A;  1JFG A;  5B0L A;  5B02 A;  1RQJ A;  3N1V F;  4OKZ A;  3TFN A;  3N0G A;  5AEL A;  1RTR A;  5IK6 A;  4LFG A;  1WL3 A;  3WCB A;  1HX9 A;  4KUX A;  3WCM A;  3AQC B;  4LPH F;  4Q23 A;  4F6X A;  3S4J A;  4KVI A;  4F6V A;  3WJN A;  2OPN A;  4LZ3 A;  3WSB A;  4NG6 A;  3WE9 A;  2E90 A;  3QQV A;  2I19 A;  1YHL A;  3QKC A;  4KK2 A;  1FPS A;  5B0K A;  2Z4V A;  3LMD A;  3N5H F;  3LZ9 A;  3ACY A;  5IK9 A;  4DXJ A;  3AQB B;  3AE0 A;  2E8U A;  2F7M F;  1VG2 A;  1PS1 A;  2F8Z F;  3VJ9 A;  4PVY F;  2E8V A;  4MC8 A;  3NF2 A;  3S9V A;  4LLS A;  3N3L F;  4KQS A;  5E8K A;  3NPK A;  3M00 A;  3PH7 A;  3NPR A;  1WKZ A;  3DYH A;  1HXC A;  5HN7 A;  5ILZ A;  4FJQ A;  2E8X A;  4N1Z F;  1YYU A;  5IMN A;  3KRC A;  5EAT A;  4DI5 A;  3IBA A;  2FTZ A;  3KRC B;  3N46 F;  2RAH A;  2E95 A;  3LGK A;  2ZCR A;  4K10 A;  1HM7 A;  4JZB A;  4L2X F;  5HNA A;  1UBV A;  5IKA A;  3KRA A;  3UCA A;  4NUA A;  4JZX A;  3SDQ A;  2Q58 A;  3M0G A;  4H5E F;  2DH4 A;  3KRA B;  3B7L A;  5ERN A;  1UBY A;  5DW7 A;  4E9U A;  5E8L A;  3ICK A;  3N5J F;  4LPG F;  1DI1 A;  4OMG A;  5C05 A;  5HN9 A;  1N1B A;  5AHU B;  3CKE A;  4JXN A;  1YQ7 A;  3Q2Q A;  4LA5 A;  2OGD A;  2AZK A;  4DZW A;  3WCE A;  3Q2Z A;  3Q1O A;  3APZ A;  2F89 F;  4XQS F;  2Z50 A;  4KVW A;  2ZCS A;  5ERM A;  2Z52 A;  3LGZ B;  3SDU A;  2Z78 A;  2F92 F;  3M01 A;  3OAC A;  1YJ4 A;  3LEE A;  3WJO A;  4N9U A;  3MAV A;  1VG4 A;  5ILY A;  3MZV A;  3ZCD A;  3OAC B;  5HN8 A;  4XQT F;  1WL1 A;  1ZW5 A;  2ZY1 A;  3BNY A;  5IN8 A;  2H8O A;  2ZCO A;  2FOR A;  4OKM A;  3ICM A;  5DJR F;  4EA2 A;  4LOB A;  4FP4 A;  2PS4 A;  1V4J A;  3N45 F;  4JXY A;  4H5C F;  3TFP A;  4RXC A;  3SAE A;  3LOM A;  4LLT A;  1N22 A;  2PS7 A;  5DGN F;  5IL8 A;  2PS6 A;  5B00 A;  5IKH A;  2QIS A;  2F9K F;  3LJI A;  3WCF A;  1V4E A;  4OMH A;  1DGP A;  3WEJ A;  5DHI A;  1N1Z A;  3WJK A;  3RBM A;  4GAX A;  3ZMB A;  2AZL A;  3Q30 A;  4KFA A;  2Q9Z A;  3BNX A;  3ICZ A;  4EA0 A;  4WK5 A;  3N6K F;  3EGT A;  5DZ2 A;  2F8C F;  3SDR A;  4NFI F;  2PS5 A;  5B0J A;  3WCL A;  5ILK A;  4QPF A;  4F62 A;  3KRP A;  4DEM F;  3TFV A;  3ADZ A;  1UBX A;  2Z7H A;  1N24 A;  4LIX A;  4LTV A;  3KRP B;  3LVS A;  3M9U A;  4PVX F;  3V66 A;  5B03 A;  5A0J A;  3W7F A;  3ZL6 A;  3LK5 A;  3V1V A;  2AEK A;  2F94 F;  2E91 A;  4E9Z A;  3WC9 A;  3WEG A;  4DWB A;  2E4O A;  4LTZ A;  3KRF B;  3CP6 A;  3ACX A;  3IPI A;  4NFJ F;  1VG3 A;  3VJB A;  2ONG A;  3TC1 A;  1RQI A;  3ASX A;  4JVJ F;  3SDT A;  4LUU A;  5JV1 F;  5B0I A;  3LLW A;  2J1P A;  4GP1 A;  5EAU A;  3WEF A;  4JYX A;  3P5P A;  3P8R A;  3WCD A;  3OAB A;  2PS8 A;  3ZMC A;  5I1U A;  1VG6 A;  4RXA A;  3V1X A;  5DHK A;  3P8L A;  3N3D A;  1VG7 A;  3OAB B;  1UBW A;  1YHK A;  4KQ5 A;  4MC3 A;  5DGM F;  4LFE A;  5CG6 A;  5JA0 F;  3RMG A;  3EFQ A;  2E8T A;  3WSA A;  5H9D A;  4KWD A;  5CG5 A;  1JFA A;  5ILD A;  3RYE A;  3PYB A;  2O1O A;  3OYR A;  2Z4Z A;  5IMI A;  1HM4 A;  4ZQ8 A;  5ILJ A;  2VF6 A;  3PKO A;  3WEI A;  3WCC A;  5A0K A;  2E93 A;  2E94 A;  3P5R A;  1V4H A;  2P1C A;  3NRI A;  3KBK A;  1V4K A;  4LA6 A;  2Z4W A;  3WEK A;  2OA6 A;  4RYP A;  3AQ0 A;  2Q9Y A;  2J1O A;  3P41 A;  1N20 A;  4KPJ A;  5IL3 A;  3WCH A;  4OGU A;  1YYQ A;  4EA1 A;  5B01 A;  5AYP A;  3ICN A;  1N23 A;  5DJP F;  5E8H A;  2OPM A;  5ERO A;  3WEH A;  1WY0 A;  4DWG A;  1WMW A;  2J5C A;  4NKE A;  4KKM A;  4HD1 A;  5DIQ F;  4NFK F;  4GP2 A;  3RYW A;  5AFX A;  2AEL A;  3ZOU A;  4LFV F;  4LZC A; 
#chains in the Genus database with same CATH topology
 5EAS A;  4QXS F;  4NKF A;  5IM1 A;  3N49 F;  1HXG A;  4GA3 A;  3VJ8 A;  3N0F A;  3KRF A;  2AET A;  5ER8 A;  3G4F A;  1YV5 A;  3LDW A;  4UMJ A;  3VJE A;  5A0I A;  2AZJ A;  4LXW A;  2ZCQ A;  4KVY A;  3VJC A;  3ID0 A;  5JUZ F;  4KVD A;  4P0W A;  5KSX F;  3LSN A;  4XQR F;  5DGS F;  4KPD A;  4MC0 A;  3LG5 A;  1WL0 A;  1YHM A;  4RXE A;  3PYA A;  5DJV F;  1WL2 A;  3CC9 A;  1YYS A;  1HXA A;  1V4I A;  2E8W A;  3TS7 A;  3WCJ A;  1EZF A;  4P0X A;  5ILI A;  1KIZ A;  2ZEU A;  4P0V A;  2ONH A;  3WCG A;  3WCA A;  5IMP A;  3ACW A;  4E1E A;  3G4D A;  3KRO A;  4KQU A;  2Z4X A;  2EWG A;  1KIY A;  3KRO B;  4RXD A;  2Q80 A;  5IVG A;  3DYG A;  3KB9 A;  5B0M A;  2Z4Y A;  3WCI A;  3EZ3 A;  4RNQ A;  1N21 A;  5ILH A;  3VJA A;  3N1W F;  5JV2 F;  3SDV A;  2E92 A;  1YYR A;  3M02 A;  4DHD A;  5JV0 F;  3VJD A;  4LZ0 A;  4H5D F;  2Z7I A;  3PDE A;  3DYF A;  5IK0 A;  1YYT A;  2ZEV A;  1JFG A;  5B0L A;  5B02 A;  1RQJ A;  3N1V F;  4OKZ A;  3TFN A;  3N0G A;  5AEL A;  1RTR A;  5IK6 A;  4LFG A;  1WL3 A;  3WCB A;  1HX9 A;  4KUX A;  3WCM A;  3AQC B;  4LPH F;  4Q23 A;  4F6X A;  3S4J A;  4KVI A;  4F6V A;  3WJN A;  2OPN A;  4LZ3 A;  3WSB A;  4NG6 A;  3WE9 A;  2E90 A;  3QQV A;  2I19 A;  1YHL A;  3QKC A;  4KK2 A;  1FPS A;  5B0K A;  2Z4V A;  3LMD A;  3N5H F;  3LZ9 A;  3ACY A;  5IK9 A;  4DXJ A;  3AQB B;  3AE0 A;  2E8U A;  2F7M F;  1VG2 A;  1PS1 A;  2F8Z F;  3VJ9 A;  4PVY F;  2E8V A;  4MC8 A;  3NF2 A;  3S9V A;  4LLS A;  3N3L F;  4KQS A;  5E8K A;  3NPK A;  3M00 A;  3PH7 A;  3NPR A;  1WKZ A;  3DYH A;  1HXC A;  5HN7 A;  5ILZ A;  4FJQ A;  2E8X A;  4N1Z F;  1YYU A;  5IMN A;  3KRC A;  5EAT A;  4DI5 A;  3IBA A;  2FTZ A;  3KRC B;  3N46 F;  2RAH A;  2E95 A;  3LGK A;  2ZCR A;  4K10 A;  1HM7 A;  4JZB A;  4L2X F;  5HNA A;  1UBV A;  5IKA A;  3KRA A;  3UCA A;  4NUA A;  4JZX A;  3SDQ A;  2Q58 A;  3M0G A;  4H5E F;  2DH4 A;  3KRA B;  3B7L A;  5ERN A;  1UBY A;  5DW7 A;  4E9U A;  5E8L A;  3ICK A;  3N5J F;  4LPG F;  1DI1 A;  4OMG A;  5C05 A;  5HN9 A;  1N1B A;  5AHU B;  3CKE A;  4JXN A;  1YQ7 A;  3Q2Q A;  4LA5 A;  2OGD A;  2AZK A;  4DZW A;  3WCE A;  3Q2Z A;  3Q1O A;  3APZ A;  2F89 F;  4XQS F;  2Z50 A;  4KVW A;  2ZCS A;  5ERM A;  2Z52 A;  3LGZ B;  3SDU A;  2Z78 A;  2F92 F;  3M01 A;  3OAC A;  1YJ4 A;  3LEE A;  3WJO A;  4N9U A;  3MAV A;  1VG4 A;  5ILY A;  3MZV A;  3ZCD A;  3OAC B;  5HN8 A;  4XQT F;  1WL1 A;  1ZW5 A;  2ZY1 A;  3BNY A;  5IN8 A;  2H8O A;  2ZCO A;  2FOR A;  4OKM A;  3ICM A;  5DJR F;  4EA2 A;  4LOB A;  4FP4 A;  2PS4 A;  1V4J A;  3N45 F;  4JXY A;  4H5C F;  3TFP A;  4RXC A;  3SAE A;  3LOM A;  4LLT A;  1N22 A;  2PS7 A;  5DGN F;  5IL8 A;  2PS6 A;  5B00 A;  5IKH A;  2QIS A;  2F9K F;  3LJI A;  3WCF A;  1V4E A;  4OMH A;  1DGP A;  3WEJ A;  5DHI A;  1N1Z A;  3WJK A;  3RBM A;  4GAX A;  3ZMB A;  2AZL A;  3Q30 A;  4KFA A;  2Q9Z A;  3BNX A;  3ICZ A;  4EA0 A;  4WK5 A;  3N6K F;  3EGT A;  5DZ2 A;  2F8C F;  3SDR A;  4NFI F;  2PS5 A;  5B0J A;  3WCL A;  5ILK A;  4QPF A;  4F62 A;  3KRP A;  4DEM F;  3TFV A;  3ADZ A;  1UBX A;  2Z7H A;  1N24 A;  4LIX A;  4LTV A;  3KRP B;  3LVS A;  3M9U A;  4PVX F;  3V66 A;  5B03 A;  5A0J A;  3W7F A;  3ZL6 A;  3LK5 A;  3V1V A;  2AEK A;  2F94 F;  2E91 A;  4E9Z A;  3WC9 A;  3WEG A;  4DWB A;  2E4O A;  4LTZ A;  3KRF B;  3CP6 A;  3ACX A;  3IPI A;  4NFJ F;  1VG3 A;  3VJB A;  2ONG A;  3TC1 A;  1RQI A;  3ASX A;  4JVJ F;  3SDT A;  4LUU A;  5JV1 F;  5B0I A;  3LLW A;  2J1P A;  4GP1 A;  5EAU A;  3WEF A;  4JYX A;  3P5P A;  3P8R A;  3WCD A;  3OAB A;  2PS8 A;  3ZMC A;  5I1U A;  1VG6 A;  4RXA A;  3V1X A;  5DHK A;  3P8L A;  3N3D A;  1VG7 A;  3OAB B;  1UBW A;  1YHK A;  4KQ5 A;  4MC3 A;  5DGM F;  4LFE A;  5CG6 A;  5JA0 F;  3RMG A;  3EFQ A;  2E8T A;  3WSA A;  5H9D A;  4KWD A;  5CG5 A;  1JFA A;  5ILD A;  3RYE A;  3PYB A;  2O1O A;  3OYR A;  2Z4Z A;  5IMI A;  1HM4 A;  4ZQ8 A;  5ILJ A;  2VF6 A;  3PKO A;  3WEI A;  3WCC A;  5A0K A;  2E93 A;  2E94 A;  3P5R A;  1V4H A;  2P1C A;  3NRI A;  3KBK A;  1V4K A;  4LA6 A;  2Z4W A;  3WEK A;  2OA6 A;  4RYP A;  3AQ0 A;  2Q9Y A;  2J1O A;  3P41 A;  1N20 A;  4KPJ A;  5IL3 A;  3WCH A;  4OGU A;  1YYQ A;  4EA1 A;  5B01 A;  5AYP A;  3ICN A;  1N23 A;  5DJP F;  5E8H A;  2OPM A;  5ERO A;  3WEH A;  1WY0 A;  4DWG A;  1WMW A;  2J5C A;  4NKE A;  4KKM A;  4HD1 A;  5DIQ F;  4NFK F;  4GP2 A;  3RYW A;  5AFX A;  2AEL A;  3ZOU A;  4LFV F;  4LZC A; 
#chains in the Genus database with same CATH homology
 5EAS A;  4QXS F;  4NKF A;  5IM1 A;  3N49 F;  1HXG A;  4GA3 A;  3VJ8 A;  3N0F A;  3KRF A;  2AET A;  5ER8 A;  3G4F A;  1YV5 A;  3LDW A;  4UMJ A;  3VJE A;  5A0I A;  2AZJ A;  4LXW A;  2ZCQ A;  4KVY A;  3VJC A;  3ID0 A;  5JUZ F;  4KVD A;  4P0W A;  5KSX F;  3LSN A;  4XQR F;  5DGS F;  4KPD A;  4MC0 A;  3LG5 A;  1WL0 A;  1YHM A;  4RXE A;  3PYA A;  5DJV F;  1WL2 A;  3CC9 A;  1YYS A;  1HXA A;  1V4I A;  2E8W A;  3TS7 A;  3WCJ A;  1EZF A;  4P0X A;  5ILI A;  1KIZ A;  2ZEU A;  4P0V A;  2ONH A;  3WCG A;  3WCA A;  5IMP A;  3ACW A;  4E1E A;  3G4D A;  3KRO A;  4KQU A;  2Z4X A;  2EWG A;  1KIY A;  3KRO B;  4RXD A;  2Q80 A;  5IVG A;  3DYG A;  3KB9 A;  5B0M A;  2Z4Y A;  3WCI A;  3EZ3 A;  4RNQ A;  1N21 A;  5ILH A;  3VJA A;  3N1W F;  5JV2 F;  3SDV A;  2E92 A;  1YYR A;  3M02 A;  4DHD A;  5JV0 F;  3VJD A;  4LZ0 A;  4H5D F;  2Z7I A;  3PDE A;  3DYF A;  5IK0 A;  1YYT A;  2ZEV A;  1JFG A;  5B0L A;  5B02 A;  1RQJ A;  3N1V F;  4OKZ A;  3TFN A;  3N0G A;  5AEL A;  1RTR A;  5IK6 A;  4LFG A;  1WL3 A;  3WCB A;  1HX9 A;  4KUX A;  3WCM A;  3AQC B;  4LPH F;  4Q23 A;  4F6X A;  3S4J A;  4KVI A;  4F6V A;  3WJN A;  2OPN A;  4LZ3 A;  3WSB A;  4NG6 A;  3WE9 A;  2E90 A;  3QQV A;  2I19 A;  1YHL A;  3QKC A;  4KK2 A;  1FPS A;  5B0K A;  2Z4V A;  3LMD A;  3N5H F;  3LZ9 A;  3ACY A;  5IK9 A;  4DXJ A;  3AQB B;  3AE0 A;  2E8U A;  2F7M F;  1VG2 A;  1PS1 A;  2F8Z F;  3VJ9 A;  4PVY F;  2E8V A;  4MC8 A;  3NF2 A;  3S9V A;  4LLS A;  3N3L F;  4KQS A;  5E8K A;  3NPK A;  3M00 A;  3PH7 A;  3NPR A;  1WKZ A;  3DYH A;  1HXC A;  5HN7 A;  5ILZ A;  4FJQ A;  2E8X A;  4N1Z F;  1YYU A;  5IMN A;  3KRC A;  5EAT A;  4DI5 A;  3IBA A;  2FTZ A;  3KRC B;  3N46 F;  2RAH A;  2E95 A;  3LGK A;  2ZCR A;  4K10 A;  1HM7 A;  4JZB A;  4L2X F;  5HNA A;  1UBV A;  5IKA A;  3KRA A;  3UCA A;  4NUA A;  4JZX A;  3SDQ A;  2Q58 A;  3M0G A;  4H5E F;  2DH4 A;  3KRA B;  3B7L A;  5ERN A;  1UBY A;  5DW7 A;  4E9U A;  5E8L A;  3ICK A;  3N5J F;  4LPG F;  1DI1 A;  4OMG A;  5C05 A;  5HN9 A;  1N1B A;  5AHU B;  3CKE A;  4JXN A;  1YQ7 A;  3Q2Q A;  4LA5 A;  2OGD A;  2AZK A;  4DZW A;  3WCE A;  3Q2Z A;  3Q1O A;  3APZ A;  2F89 F;  4XQS F;  2Z50 A;  4KVW A;  2ZCS A;  5ERM A;  2Z52 A;  3LGZ B;  3SDU A;  2Z78 A;  2F92 F;  3M01 A;  3OAC A;  1YJ4 A;  3LEE A;  3WJO A;  4N9U A;  3MAV A;  1VG4 A;  5ILY A;  3MZV A;  3ZCD A;  3OAC B;  5HN8 A;  4XQT F;  1WL1 A;  1ZW5 A;  2ZY1 A;  3BNY A;  5IN8 A;  2H8O A;  2ZCO A;  2FOR A;  4OKM A;  3ICM A;  5DJR F;  4EA2 A;  4LOB A;  4FP4 A;  2PS4 A;  1V4J A;  3N45 F;  4JXY A;  4H5C F;  3TFP A;  4RXC A;  3SAE A;  3LOM A;  4LLT A;  1N22 A;  2PS7 A;  5DGN F;  5IL8 A;  2PS6 A;  5B00 A;  5IKH A;  2QIS A;  2F9K F;  3LJI A;  3WCF A;  1V4E A;  4OMH A;  1DGP A;  3WEJ A;  5DHI A;  1N1Z A;  3WJK A;  3RBM A;  4GAX A;  3ZMB A;  2AZL A;  3Q30 A;  4KFA A;  2Q9Z A;  3BNX A;  3ICZ A;  4EA0 A;  4WK5 A;  3N6K F;  3EGT A;  5DZ2 A;  2F8C F;  3SDR A;  4NFI F;  2PS5 A;  5B0J A;  3WCL A;  5ILK A;  4QPF A;  4F62 A;  3KRP A;  4DEM F;  3TFV A;  3ADZ A;  1UBX A;  2Z7H A;  1N24 A;  4LIX A;  4LTV A;  3KRP B;  3LVS A;  3M9U A;  4PVX F;  3V66 A;  5B03 A;  5A0J A;  3W7F A;  3ZL6 A;  3LK5 A;  3V1V A;  2AEK A;  2F94 F;  2E91 A;  4E9Z A;  3WC9 A;  3WEG A;  4DWB A;  2E4O A;  4LTZ A;  3KRF B;  3CP6 A;  3ACX A;  3IPI A;  4NFJ F;  1VG3 A;  3VJB A;  2ONG A;  3TC1 A;  1RQI A;  3ASX A;  4JVJ F;  3SDT A;  4LUU A;  5JV1 F;  5B0I A;  3LLW A;  2J1P A;  4GP1 A;  5EAU A;  3WEF A;  4JYX A;  3P5P A;  3P8R A;  3WCD A;  3OAB A;  2PS8 A;  3ZMC A;  5I1U A;  1VG6 A;  4RXA A;  3V1X A;  5DHK A;  3P8L A;  3N3D A;  1VG7 A;  3OAB B;  1UBW A;  1YHK A;  4KQ5 A;  4MC3 A;  5DGM F;  4LFE A;  5CG6 A;  5JA0 F;  3RMG A;  3EFQ A;  2E8T A;  3WSA A;  5H9D A;  4KWD A;  5CG5 A;  1JFA A;  5ILD A;  3RYE A;  3PYB A;  2O1O A;  3OYR A;  2Z4Z A;  5IMI A;  1HM4 A;  4ZQ8 A;  5ILJ A;  2VF6 A;  3PKO A;  3WEI A;  3WCC A;  5A0K A;  2E93 A;  2E94 A;  3P5R A;  1V4H A;  2P1C A;  3NRI A;  3KBK A;  1V4K A;  4LA6 A;  2Z4W A;  3WEK A;  2OA6 A;  4RYP A;  3AQ0 A;  2Q9Y A;  2J1O A;  3P41 A;  1N20 A;  4KPJ A;  5IL3 A;  3WCH A;  4OGU A;  1YYQ A;  4EA1 A;  5B01 A;  5AYP A;  3ICN A;  1N23 A;  5DJP F;  5E8H A;  2OPM A;  5ERO A;  3WEH A;  1WY0 A;  4DWG A;  1WMW A;  2J5C A;  4NKE A;  4KKM A;  4HD1 A;  5DIQ F;  4NFK F;  4GP2 A;  3RYW A;  5AFX A;  2AEL A;  3ZOU A;  4LFV F;  4LZC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...