5HN9A

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph-1186
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
360
structure length
351
Chain Sequence
FFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKRDINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSEIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIDNLIYKKIEDISMLMGEYFQIHDDYLDIFDSTKTGKVSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Farnesyl pyrophosphate synthase, putative
publication title Dynamic Structure and Inhibition of a Malaria Drug Target: Geranylgeranyl Diphosphate Synthase.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 141
structure length 351
sequence length 360
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5hn9A00
4LZ0A 5IM1A 3WCMA 1EZFA 4LFGA 5ILZA 4HD1A 3CKEA 4P0XA 2F8CF 3ICNA 4DZWA 2PS8A 2Q9ZA 4NFKF 4Q23A 4MC3A 2F92F 5DW7A 4XQTF 5AFXA 1YYQA 3OABA 4DEMF 2F8ZF 4MC0A 5DGMF 3ACYA 3LOMA 5IK9A 3VJ8A 1HX9A 4PVYF 4LXWA 4N1ZF 3N0FA 3IBAA 4P0VA 4PVXF 3RYWA 3SDTA 3M01A 5IK0A 3MZVA 4KVIA 5B0JA 2E91A 3LGZB 2EWGA 3OABB 2ZCOA 3ACWA 5HN9A 3N49F 3TFVA 3ADZA 1YHLA 4JXNA 1ZW5A 2AZLA 5DJPF 1N24A 3RBMA 3ICMA 2ONHA 2E95A 4K10A 5DHKA 1RTRA 3B7LA 3RMGA 3N46F 4H5EF 3SDVA 1YYUA 2Z4VA 3Q2QA 3UCAA 3M0GA 3IPIA 3V66A 3WCJA 2E8TA 3VJ9A 1YV5A 3DYHA 2RAHA 5IMNA 3SAEA 5B0LA 5DZ2A 1YHKA 4E9UA 5B0MA 5C05A 3LG5A 3QQVA 3TS7A 4KWDA 2Z7IA 4DWGA 3MAVA 3NF2A 2F89F 5I1UA 1N21A 3AQBB 3AE0A 5ERNA 5ILJA 1UBVA 4EA2A 4KVWA 4DHDA 5ERMA 2J5CA 5DIQF 3WCCA 3WEFA 2Z50A 1N1BA 4KPDA 3RYEA 2PS4A 5EROA 3KRPA 3LVSA 3WCDA 2E8WA 3W7FA 3LK5A 1DI1A 1N20A 3WCEA 3ICZA 3EGTA 1WL3A 2AETA 4GP1A 1JFGA 5HN8A 3M02A 3NRIA 4L2XF 5B03A 5A0IA 1N1ZA 3KRPB 2E94A 1UBWA 3WCAA 3BNYA 4RXDA 4KFAA 3ICKA 3TFPA 5ILYA 1YYSA 3N1VF 3KRFA 3SDRA 4OMHA 3P5RA 2OA6A 5DGNF 4RXAA 3TC1A 3S4JA 4QXSF 3WCBA 3LSNA 2E8XA 4JZBA 2O1OA 3ZMBA 5IL8A 5KSXF 3EZ3A 4OMGA 3KRFB 2FTZA 2ZEVA 5B0KA 5DHIA 2Z78A 3N3LF 4LA5A 2P1CA 4RNQA 3AQ0A 3SDUA 4LPHF 3WEJA 2E4OA 1VG4A 3N0GA 2J1OA 5CG6A 1YQ7A 2ONGA 3AQCB 2I19A 4OKZA 4NUAA 3LEEA 1DGPA 1YYTA 4LLSA 3LZ9A 4LLTA 2AELA 2VF6A 4ZQ8A 3APZA 2Q80A 3KRAA 1KIZA 3N45F 2E92A 1YJ4A 5ILIA 5ER8A 4MC8A 3WEKA 3PKOA 5IMPA 3ZCDA 3WCGA 5JV1F 2J1PA 3G4FA 3N3DA 2E8VA 4NFJF 1HXGA 3PYAA 3VJCA 3WCLA 2E8UA 4F62A 1YYRA 1VG2A 5E8KA 3KRAB 3ZMCA 1KIYA 1WL0A 2Z4XA 1HM7A 3LJIA 2F7MF 1WL1A 2DH4A 5ILDA 1VG7A 3G4DA 4LPGF 3P8LA 2PS6A 4NKFA 2PS5A 5B02A 4KVYA 5A0KA 4KQUA 3WSBA 5JUZF 1JFAA 3P8RA 2ZEUA 2ZY1A 1N23A 3PH7A 1N22A 2AEKA 5EASA 1WY0A 3KRCA 3ZL6A 1PS1A 3ACXA 1V4EA 3VJEA 4KQSA 4LIXA 5ILKA 3WCFA 5DJVF 4LTZA 3VJAA 5E8HA 3KBKA 5JV0F 5IMIA 2F9KF 4UMJA 4JZXA 3P41A 3P5PA 1FPSA 1YHMA 4E1EA 4OGUA 1VG6A 4LFVF 3LMDA 5AELA 4P0WA 3OYRA 1VG3A 2ZCRA 5E8LA 5B0IA 3KRCB 4F6XA 2ZCSA 4KPJA 4E9ZA 3QKCA 4LZCA 5IN8A 4JXYA 1V4IA 1HM4A 4DI5A 4LUUA 5CG5A 4XQRF 1UBXA 2PS7A 4WK5A 3WSAA 3N5HF 3CP6A 3S9VA 3M00A 5IVGA 3Q1OA 1HXCA 1V4KA 1WKZA 2QISA 2AZJA 3OACA 3PDEA 1RQIA 3TFNA 4H5DF 3WJNA 5AHUB 2FORA 2Z4YA 3LDWA 3SDQA 3NPKA 3PYBA 5HNAA 3BNXA 5DGSF 4EA0A 5EAUA 2Z4WA 5B00A 2F94F 3OACB 3WCHA 5JV2F 4NFIF 4EA1A 3ASXA 4KK2A 3WC9A 4DWBA 3Q2ZA 5ILHA 4RYPA 4KKMA 1HXAA 4RXEA 3N5JF 4LOBA 4H5CF 1RQJA 3DYGA 5JA0F 3WJKA 4FP4A 4RXCA 3VJBA 5EATA 5IL3A 3LLWA 3V1VA 2ZCQA 3N6KF 4LTVA 2Z52A 3ID0A 3WEGA 3KROA 4LFEA 5HN7A 3CC9A 4KVDA 3ZOUA 4JVJF 5IKHA 5IKAA 2Z4ZA 4JYXA 3WEIA 4XQSF 3V1XA 2AZKA 4LA6A 5AYPA 3DYFA 3Q30A 4KUXA 1V4HA 4NKEA 3KROB 1UBYA 4FJQA 4LZ3A 4DXJA 2OPMA 4GP2A 4GA3A 5IK6A 1WL2A 4QPFA 3WE9A 3N1WF 4N9UA 5DJRF 2H8OA 1WMWA 2Q58A 4KQ5A 5H9DA 1V4JA 2E93A 5A0JA 3M9UA 2OGDA 3KB9A 3WEHA 4OKMA 3WCIA 5B01A 3WJOA 3VJDA 2E90A 3EFQA 2OPNA 2Z7HA 4NG6A 4F6VA 4GAXA 3NPRA 2Q9YA 3LGKA
chains in the Genus database with same CATH superfamily
4LZ0A 5IM1A 3WCMA 1EZFA 4LFGA 5ILZA 4HD1A 3CKEA 4P0XA 2F8CF 3ICNA 4DZWA 2PS8A 2Q9ZA 4NFKF 4Q23A 4MC3A 2F92F 5DW7A 4XQTF 5AFXA 1YYQA 3OABA 4DEMF 2F8ZF 4MC0A 5DGMF 3ACYA 3LOMA 5IK9A 3VJ8A 1HX9A 4PVYF 4LXWA 4N1ZF 3N0FA 3IBAA 4P0VA 4PVXF 3RYWA 3SDTA 3M01A 5IK0A 3MZVA 4KVIA 5B0JA 2E91A 3LGZB 2EWGA 3OABB 2ZCOA 3ACWA 5HN9A 3N49F 3TFVA 3ADZA 1YHLA 4JXNA 1ZW5A 2AZLA 5DJPF 1N24A 3RBMA 3ICMA 2ONHA 2E95A 4K10A 5DHKA 1RTRA 3B7LA 3RMGA 3N46F 4H5EF 3SDVA 1YYUA 2Z4VA 3Q2QA 3UCAA 3M0GA 3IPIA 3V66A 3WCJA 2E8TA 3VJ9A 1YV5A 3DYHA 2RAHA 5IMNA 3SAEA 5B0LA 5DZ2A 1YHKA 4E9UA 5B0MA 5C05A 3LG5A 3QQVA 3TS7A 4KWDA 2Z7IA 4DWGA 3MAVA 3NF2A 2F89F 5I1UA 1N21A 3AQBB 3AE0A 5ERNA 5ILJA 1UBVA 4EA2A 4KVWA 4DHDA 5ERMA 2J5CA 5DIQF 3WCCA 3WEFA 2Z50A 1N1BA 4KPDA 3RYEA 2PS4A 5EROA 3KRPA 3LVSA 3WCDA 2E8WA 3W7FA 3LK5A 1DI1A 1N20A 3WCEA 3ICZA 3EGTA 1WL3A 2AETA 4GP1A 1JFGA 5HN8A 3M02A 3NRIA 4L2XF 5B03A 5A0IA 1N1ZA 3KRPB 2E94A 1UBWA 3WCAA 3BNYA 4RXDA 4KFAA 3ICKA 3TFPA 5ILYA 1YYSA 3N1VF 3KRFA 3SDRA 4OMHA 3P5RA 2OA6A 5DGNF 4RXAA 3TC1A 3S4JA 4QXSF 3WCBA 3LSNA 2E8XA 4JZBA 2O1OA 3ZMBA 5IL8A 5KSXF 3EZ3A 4OMGA 3KRFB 2FTZA 2ZEVA 5B0KA 5DHIA 2Z78A 3N3LF 4LA5A 2P1CA 4RNQA 3AQ0A 3SDUA 4LPHF 3WEJA 2E4OA 1VG4A 3N0GA 2J1OA 5CG6A 1YQ7A 2ONGA 3AQCB 2I19A 4OKZA 4NUAA 3LEEA 1DGPA 1YYTA 4LLSA 3LZ9A 4LLTA 2AELA 2VF6A 4ZQ8A 3APZA 2Q80A 3KRAA 1KIZA 3N45F 2E92A 1YJ4A 5ILIA 5ER8A 4MC8A 3WEKA 3PKOA 5IMPA 3ZCDA 3WCGA 5JV1F 2J1PA 3G4FA 3N3DA 2E8VA 4NFJF 1HXGA 3PYAA 3VJCA 3WCLA 2E8UA 4F62A 1YYRA 1VG2A 5E8KA 3KRAB 3ZMCA 1KIYA 1WL0A 2Z4XA 1HM7A 3LJIA 2F7MF 1WL1A 2DH4A 5ILDA 1VG7A 3G4DA 4LPGF 3P8LA 2PS6A 4NKFA 2PS5A 5B02A 4KVYA 5A0KA 4KQUA 3WSBA 5JUZF 1JFAA 3P8RA 2ZEUA 2ZY1A 1N23A 3PH7A 1N22A 2AEKA 5EASA 1WY0A 3KRCA 3ZL6A 1PS1A 3ACXA 1V4EA 3VJEA 4KQSA 4LIXA 5ILKA 3WCFA 5DJVF 4LTZA 3VJAA 5E8HA 3KBKA 5JV0F 5IMIA 2F9KF 4UMJA 4JZXA 3P41A 3P5PA 1FPSA 1YHMA 4E1EA 4OGUA 1VG6A 4LFVF 3LMDA 5AELA 4P0WA 3OYRA 1VG3A 2ZCRA 5E8LA 5B0IA 3KRCB 4F6XA 2ZCSA 4KPJA 4E9ZA 3QKCA 4LZCA 5IN8A 4JXYA 1V4IA 1HM4A 4DI5A 4LUUA 5CG5A 4XQRF 1UBXA 2PS7A 4WK5A 3WSAA 3N5HF 3CP6A 3S9VA 3M00A 5IVGA 3Q1OA 1HXCA 1V4KA 1WKZA 2QISA 2AZJA 3OACA 3PDEA 1RQIA 3TFNA 4H5DF 3WJNA 5AHUB 2FORA 2Z4YA 3LDWA 3SDQA 3NPKA 3PYBA 5HNAA 3BNXA 5DGSF 4EA0A 5EAUA 2Z4WA 5B00A 2F94F 3OACB 3WCHA 5JV2F 4NFIF 4EA1A 3ASXA 4KK2A 3WC9A 4DWBA 3Q2ZA 5ILHA 4RYPA 4KKMA 1HXAA 4RXEA 3N5JF 4LOBA 4H5CF 1RQJA 3DYGA 5JA0F 3WJKA 4FP4A 4RXCA 3VJBA 5EATA 5IL3A 3LLWA 3V1VA 2ZCQA 3N6KF 4LTVA 2Z52A 3ID0A 3WEGA 3KROA 4LFEA 5HN7A 3CC9A 4KVDA 3ZOUA 4JVJF 5IKHA 5IKAA 2Z4ZA 4JYXA 3WEIA 4XQSF 3V1XA 2AZKA 4LA6A 5AYPA 3DYFA 3Q30A 4KUXA 1V4HA 4NKEA 3KROB 1UBYA 4FJQA 4LZ3A 4DXJA 2OPMA 4GP2A 4GA3A 5IK6A 1WL2A 4QPFA 3WE9A 3N1WF 4N9UA 5DJRF 2H8OA 1WMWA 2Q58A 4KQ5A 5H9DA 1V4JA 2E93A 5A0JA 3M9UA 2OGDA 3KB9A 3WEHA 4OKMA 3WCIA 5B01A 3WJOA 3VJDA 2E90A 3EFQA 2OPNA 2Z7HA 4NG6A 4F6VA 4GAXA 3NPRA 2Q9YA 3LGKA
chains in the Genus database with same CATH topology
4LZ0A 5IM1A 3WCMA 1EZFA 4LFGA 5ILZA 4HD1A 3CKEA 4P0XA 2F8CF 3ICNA 4DZWA 2PS8A 2Q9ZA 4NFKF 4Q23A 4MC3A 2F92F 5DW7A 4XQTF 5AFXA 1YYQA 3OABA 4DEMF 2F8ZF 4MC0A 5DGMF 3ACYA 3LOMA 5IK9A 3VJ8A 1HX9A 4PVYF 4LXWA 4N1ZF 3N0FA 3IBAA 4P0VA 4PVXF 3RYWA 3SDTA 3M01A 5IK0A 3MZVA 4KVIA 5B0JA 2E91A 3LGZB 2EWGA 3OABB 2ZCOA 3ACWA 5HN9A 3N49F 3TFVA 3ADZA 1YHLA 4JXNA 1ZW5A 2AZLA 5DJPF 1N24A 3RBMA 3ICMA 2ONHA 2E95A 4K10A 5DHKA 1RTRA 3B7LA 3RMGA 3N46F 4H5EF 3SDVA 1YYUA 2Z4VA 3Q2QA 3UCAA 3M0GA 3IPIA 3V66A 3WCJA 2E8TA 3VJ9A 1YV5A 3DYHA 2RAHA 5IMNA 3SAEA 5B0LA 5DZ2A 1YHKA 4E9UA 5B0MA 5C05A 3LG5A 3QQVA 3TS7A 4KWDA 2Z7IA 4DWGA 3MAVA 3NF2A 2F89F 5I1UA 1N21A 3AQBB 3AE0A 5ERNA 5ILJA 1UBVA 4EA2A 4KVWA 4DHDA 5ERMA 2J5CA 5DIQF 3WCCA 3WEFA 2Z50A 1N1BA 4KPDA 3RYEA 2PS4A 5EROA 3KRPA 3LVSA 3WCDA 2E8WA 3W7FA 3LK5A 1DI1A 1N20A 3WCEA 3ICZA 3EGTA 1WL3A 2AETA 4GP1A 1JFGA 5HN8A 3M02A 3NRIA 4L2XF 5B03A 5A0IA 1N1ZA 3KRPB 2E94A 1UBWA 3WCAA 3BNYA 4RXDA 4KFAA 3ICKA 3TFPA 5ILYA 1YYSA 3N1VF 3KRFA 3SDRA 4OMHA 3P5RA 2OA6A 5DGNF 4RXAA 3TC1A 3S4JA 4QXSF 3WCBA 3LSNA 2E8XA 4JZBA 2O1OA 3ZMBA 5IL8A 5KSXF 3EZ3A 4OMGA 3KRFB 2FTZA 2ZEVA 5B0KA 5DHIA 2Z78A 3N3LF 4LA5A 2P1CA 4RNQA 3AQ0A 3SDUA 4LPHF 3WEJA 2E4OA 1VG4A 3N0GA 2J1OA 5CG6A 1YQ7A 2ONGA 3AQCB 2I19A 4OKZA 4NUAA 3LEEA 1DGPA 1YYTA 4LLSA 3LZ9A 4LLTA 2AELA 2VF6A 4ZQ8A 3APZA 2Q80A 3KRAA 1KIZA 3N45F 2E92A 1YJ4A 5ILIA 5ER8A 4MC8A 3WEKA 3PKOA 5IMPA 3ZCDA 3WCGA 5JV1F 2J1PA 3G4FA 3N3DA 2E8VA 4NFJF 1HXGA 3PYAA 3VJCA 3WCLA 2E8UA 4F62A 1YYRA 1VG2A 5E8KA 3KRAB 3ZMCA 1KIYA 1WL0A 2Z4XA 1HM7A 3LJIA 2F7MF 1WL1A 2DH4A 5ILDA 1VG7A 3G4DA 4LPGF 3P8LA 2PS6A 4NKFA 2PS5A 5B02A 4KVYA 5A0KA 4KQUA 3WSBA 5JUZF 1JFAA 3P8RA 2ZEUA 2ZY1A 1N23A 3PH7A 1N22A 2AEKA 5EASA 1WY0A 3KRCA 3ZL6A 1PS1A 3ACXA 1V4EA 3VJEA 4KQSA 4LIXA 5ILKA 3WCFA 5DJVF 4LTZA 3VJAA 5E8HA 3KBKA 5JV0F 5IMIA 2F9KF 4UMJA 4JZXA 3P41A 3P5PA 1FPSA 1YHMA 4E1EA 4OGUA 1VG6A 4LFVF 3LMDA 5AELA 4P0WA 3OYRA 1VG3A 2ZCRA 5E8LA 5B0IA 3KRCB 4F6XA 2ZCSA 4KPJA 4E9ZA 3QKCA 4LZCA 5IN8A 4JXYA 1V4IA 1HM4A 4DI5A 4LUUA 5CG5A 4XQRF 1UBXA 2PS7A 4WK5A 3WSAA 3N5HF 3CP6A 3S9VA 3M00A 5IVGA 3Q1OA 1HXCA 1V4KA 1WKZA 2QISA 2AZJA 3OACA 3PDEA 1RQIA 3TFNA 4H5DF 3WJNA 5AHUB 2FORA 2Z4YA 3LDWA 3SDQA 3NPKA 3PYBA 5HNAA 3BNXA 5DGSF 4EA0A 5EAUA 2Z4WA 5B00A 2F94F 3OACB 3WCHA 5JV2F 4NFIF 4EA1A 3ASXA 4KK2A 3WC9A 4DWBA 3Q2ZA 5ILHA 4RYPA 4KKMA 1HXAA 4RXEA 3N5JF 4LOBA 4H5CF 1RQJA 3DYGA 5JA0F 3WJKA 4FP4A 4RXCA 3VJBA 5EATA 5IL3A 3LLWA 3V1VA 2ZCQA 3N6KF 4LTVA 2Z52A 3ID0A 3WEGA 3KROA 4LFEA 5HN7A 3CC9A 4KVDA 3ZOUA 4JVJF 5IKHA 5IKAA 2Z4ZA 4JYXA 3WEIA 4XQSF 3V1XA 2AZKA 4LA6A 5AYPA 3DYFA 3Q30A 4KUXA 1V4HA 4NKEA 3KROB 1UBYA 4FJQA 4LZ3A 4DXJA 2OPMA 4GP2A 4GA3A 5IK6A 1WL2A 4QPFA 3WE9A 3N1WF 4N9UA 5DJRF 2H8OA 1WMWA 2Q58A 4KQ5A 5H9DA 1V4JA 2E93A 5A0JA 3M9UA 2OGDA 3KB9A 3WEHA 4OKMA 3WCIA 5B01A 3WJOA 3VJDA 2E90A 3EFQA 2OPNA 2Z7HA 4NG6A 4F6VA 4GAXA 3NPRA 2Q9YA 3LGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LZ0 A;  5IM1 A;  3WCM A;  1EZF A;  4LFG A;  5ILZ A;  4HD1 A;  3CKE A;  4P0X A;  2F8C F;  3ICN A;  4DZW A;  2PS8 A;  2Q9Z A;  4NFK F;  4Q23 A;  4MC3 A;  2F92 F;  5DW7 A;  4XQT F;  5AFX A;  1YYQ A;  3OAB A;  4DEM F;  2F8Z F;  4MC0 A;  5DGM F;  3ACY A;  3LOM A;  5IK9 A;  3VJ8 A;  1HX9 A;  4PVY F;  4LXW A;  4N1Z F;  3N0F A;  3IBA A;  4P0V A;  4PVX F;  3RYW A;  3SDT A;  3M01 A;  5IK0 A;  3MZV A;  4KVI A;  5B0J A;  2E91 A;  3LGZ B;  2EWG A;  3OAB B;  2ZCO A;  3ACW A;  5HN9 A;  3N49 F;  3TFV A;  3ADZ A;  1YHL A;  4JXN A;  1ZW5 A;  2AZL A;  5DJP F;  1N24 A;  3RBM A;  3ICM A;  2ONH A;  2E95 A;  4K10 A;  5DHK A;  1RTR A;  3B7L A;  3RMG A;  3N46 F;  4H5E F;  3SDV A;  1YYU A;  2Z4V A;  3Q2Q A;  3UCA A;  3M0G A;  3IPI A;  3V66 A;  3WCJ A;  2E8T A;  3VJ9 A;  1YV5 A;  3DYH A;  2RAH A;  5IMN A;  3SAE A;  5B0L A;  5DZ2 A;  1YHK A;  4E9U A;  5B0M A;  5C05 A;  3LG5 A;  3QQV A;  3TS7 A;  4KWD A;  2Z7I A;  4DWG A;  3MAV A;  3NF2 A;  2F89 F;  5I1U A;  1N21 A;  3AQB B;  3AE0 A;  5ERN A;  5ILJ A;  1UBV A;  4EA2 A;  4KVW A;  4DHD A;  5ERM A;  2J5C A;  5DIQ F;  3WCC A;  3WEF A;  2Z50 A;  1N1B A;  4KPD A;  3RYE A;  2PS4 A;  5ERO A;  3KRP A;  3LVS A;  3WCD A;  2E8W A;  3W7F A;  3LK5 A;  1DI1 A;  1N20 A;  3WCE A;  3ICZ A;  3EGT A;  1WL3 A;  2AET A;  4GP1 A;  1JFG A;  5HN8 A;  3M02 A;  3NRI A;  4L2X F;  5B03 A;  5A0I A;  1N1Z A;  3KRP B;  2E94 A;  1UBW A;  3WCA A;  3BNY A;  4RXD A;  4KFA A;  3ICK A;  3TFP A;  5ILY A;  1YYS A;  3N1V F;  3KRF A;  3SDR A;  4OMH A;  3P5R A;  2OA6 A;  5DGN F;  4RXA A;  3TC1 A;  3S4J A;  4QXS F;  3WCB A;  3LSN A;  2E8X A;  4JZB A;  2O1O A;  3ZMB A;  5IL8 A;  5KSX F;  3EZ3 A;  4OMG A;  3KRF B;  2FTZ A;  2ZEV A;  5B0K A;  5DHI A;  2Z78 A;  3N3L F;  4LA5 A;  2P1C A;  4RNQ A;  3AQ0 A;  3SDU A;  4LPH F;  3WEJ A;  2E4O A;  1VG4 A;  3N0G A;  2J1O A;  5CG6 A;  1YQ7 A;  2ONG A;  3AQC B;  2I19 A;  4OKZ A;  4NUA A;  3LEE A;  1DGP A;  1YYT A;  4LLS A;  3LZ9 A;  4LLT A;  2AEL A;  2VF6 A;  4ZQ8 A;  3APZ A;  2Q80 A;  3KRA A;  1KIZ A;  3N45 F;  2E92 A;  1YJ4 A;  5ILI A;  5ER8 A;  4MC8 A;  3WEK A;  3PKO A;  5IMP A;  3ZCD A;  3WCG A;  5JV1 F;  2J1P A;  3G4F A;  3N3D A;  2E8V A;  4NFJ F;  1HXG A;  3PYA A;  3VJC A;  3WCL A;  2E8U A;  4F62 A;  1YYR A;  1VG2 A;  5E8K A;  3KRA B;  3ZMC A;  1KIY A;  1WL0 A;  2Z4X A;  1HM7 A;  3LJI A;  2F7M F;  1WL1 A;  2DH4 A;  5ILD A;  1VG7 A;  3G4D A;  4LPG F;  3P8L A;  2PS6 A;  4NKF A;  2PS5 A;  5B02 A;  4KVY A;  5A0K A;  4KQU A;  3WSB A;  5JUZ F;  1JFA A;  3P8R A;  2ZEU A;  2ZY1 A;  1N23 A;  3PH7 A;  1N22 A;  2AEK A;  5EAS A;  1WY0 A;  3KRC A;  3ZL6 A;  1PS1 A;  3ACX A;  1V4E A;  3VJE A;  4KQS A;  4LIX A;  5ILK A;  3WCF A;  5DJV F;  4LTZ A;  3VJA A;  5E8H A;  3KBK A;  5JV0 F;  5IMI A;  2F9K F;  4UMJ A;  4JZX A;  3P41 A;  3P5P A;  1FPS A;  1YHM A;  4E1E A;  4OGU A;  1VG6 A;  4LFV F;  3LMD A;  5AEL A;  4P0W A;  3OYR A;  1VG3 A;  2ZCR A;  5E8L A;  5B0I A;  3KRC B;  4F6X A;  2ZCS A;  4KPJ A;  4E9Z A;  3QKC A;  4LZC A;  5IN8 A;  4JXY A;  1V4I A;  1HM4 A;  4DI5 A;  4LUU A;  5CG5 A;  4XQR F;  1UBX A;  2PS7 A;  4WK5 A;  3WSA A;  3N5H F;  3CP6 A;  3S9V A;  3M00 A;  5IVG A;  3Q1O A;  1HXC A;  1V4K A;  1WKZ A;  2QIS A;  2AZJ A;  3OAC A;  3PDE A;  1RQI A;  3TFN A;  4H5D F;  3WJN A;  5AHU B;  2FOR A;  2Z4Y A;  3LDW A;  3SDQ A;  3NPK A;  3PYB A;  5HNA A;  3BNX A;  5DGS F;  4EA0 A;  5EAU A;  2Z4W A;  5B00 A;  2F94 F;  3OAC B;  3WCH A;  5JV2 F;  4NFI F;  4EA1 A;  3ASX A;  4KK2 A;  3WC9 A;  4DWB A;  3Q2Z A;  5ILH A;  4RYP A;  4KKM A;  1HXA A;  4RXE A;  3N5J F;  4LOB A;  4H5C F;  1RQJ A;  3DYG A;  5JA0 F;  3WJK A;  4FP4 A;  4RXC A;  3VJB A;  5EAT A;  5IL3 A;  3LLW A;  3V1V A;  2ZCQ A;  3N6K F;  4LTV A;  2Z52 A;  3ID0 A;  3WEG A;  3KRO A;  4LFE A;  5HN7 A;  3CC9 A;  4KVD A;  3ZOU A;  4JVJ F;  5IKH A;  5IKA A;  2Z4Z A;  4JYX A;  3WEI A;  4XQS F;  3V1X A;  2AZK A;  4LA6 A;  5AYP A;  3DYF A;  3Q30 A;  4KUX A;  1V4H A;  4NKE A;  3KRO B;  1UBY A;  4FJQ A;  4LZ3 A;  4DXJ A;  2OPM A;  4GP2 A;  4GA3 A;  5IK6 A;  1WL2 A;  4QPF A;  3WE9 A;  3N1W F;  4N9U A;  5DJR F;  2H8O A;  1WMW A;  2Q58 A;  4KQ5 A;  5H9D A;  1V4J A;  2E93 A;  5A0J A;  3M9U A;  2OGD A;  3KB9 A;  3WEH A;  4OKM A;  3WCI A;  5B01 A;  3WJO A;  3VJD A;  2E90 A;  3EFQ A;  2OPN A;  2Z7H A;  4NG6 A;  4F6V A;  4GAX A;  3NPR A;  2Q9Y A;  3LGK A; 
#chains in the Genus database with same CATH topology
 4LZ0 A;  5IM1 A;  3WCM A;  1EZF A;  4LFG A;  5ILZ A;  4HD1 A;  3CKE A;  4P0X A;  2F8C F;  3ICN A;  4DZW A;  2PS8 A;  2Q9Z A;  4NFK F;  4Q23 A;  4MC3 A;  2F92 F;  5DW7 A;  4XQT F;  5AFX A;  1YYQ A;  3OAB A;  4DEM F;  2F8Z F;  4MC0 A;  5DGM F;  3ACY A;  3LOM A;  5IK9 A;  3VJ8 A;  1HX9 A;  4PVY F;  4LXW A;  4N1Z F;  3N0F A;  3IBA A;  4P0V A;  4PVX F;  3RYW A;  3SDT A;  3M01 A;  5IK0 A;  3MZV A;  4KVI A;  5B0J A;  2E91 A;  3LGZ B;  2EWG A;  3OAB B;  2ZCO A;  3ACW A;  5HN9 A;  3N49 F;  3TFV A;  3ADZ A;  1YHL A;  4JXN A;  1ZW5 A;  2AZL A;  5DJP F;  1N24 A;  3RBM A;  3ICM A;  2ONH A;  2E95 A;  4K10 A;  5DHK A;  1RTR A;  3B7L A;  3RMG A;  3N46 F;  4H5E F;  3SDV A;  1YYU A;  2Z4V A;  3Q2Q A;  3UCA A;  3M0G A;  3IPI A;  3V66 A;  3WCJ A;  2E8T A;  3VJ9 A;  1YV5 A;  3DYH A;  2RAH A;  5IMN A;  3SAE A;  5B0L A;  5DZ2 A;  1YHK A;  4E9U A;  5B0M A;  5C05 A;  3LG5 A;  3QQV A;  3TS7 A;  4KWD A;  2Z7I A;  4DWG A;  3MAV A;  3NF2 A;  2F89 F;  5I1U A;  1N21 A;  3AQB B;  3AE0 A;  5ERN A;  5ILJ A;  1UBV A;  4EA2 A;  4KVW A;  4DHD A;  5ERM A;  2J5C A;  5DIQ F;  3WCC A;  3WEF A;  2Z50 A;  1N1B A;  4KPD A;  3RYE A;  2PS4 A;  5ERO A;  3KRP A;  3LVS A;  3WCD A;  2E8W A;  3W7F A;  3LK5 A;  1DI1 A;  1N20 A;  3WCE A;  3ICZ A;  3EGT A;  1WL3 A;  2AET A;  4GP1 A;  1JFG A;  5HN8 A;  3M02 A;  3NRI A;  4L2X F;  5B03 A;  5A0I A;  1N1Z A;  3KRP B;  2E94 A;  1UBW A;  3WCA A;  3BNY A;  4RXD A;  4KFA A;  3ICK A;  3TFP A;  5ILY A;  1YYS A;  3N1V F;  3KRF A;  3SDR A;  4OMH A;  3P5R A;  2OA6 A;  5DGN F;  4RXA A;  3TC1 A;  3S4J A;  4QXS F;  3WCB A;  3LSN A;  2E8X A;  4JZB A;  2O1O A;  3ZMB A;  5IL8 A;  5KSX F;  3EZ3 A;  4OMG A;  3KRF B;  2FTZ A;  2ZEV A;  5B0K A;  5DHI A;  2Z78 A;  3N3L F;  4LA5 A;  2P1C A;  4RNQ A;  3AQ0 A;  3SDU A;  4LPH F;  3WEJ A;  2E4O A;  1VG4 A;  3N0G A;  2J1O A;  5CG6 A;  1YQ7 A;  2ONG A;  3AQC B;  2I19 A;  4OKZ A;  4NUA A;  3LEE A;  1DGP A;  1YYT A;  4LLS A;  3LZ9 A;  4LLT A;  2AEL A;  2VF6 A;  4ZQ8 A;  3APZ A;  2Q80 A;  3KRA A;  1KIZ A;  3N45 F;  2E92 A;  1YJ4 A;  5ILI A;  5ER8 A;  4MC8 A;  3WEK A;  3PKO A;  5IMP A;  3ZCD A;  3WCG A;  5JV1 F;  2J1P A;  3G4F A;  3N3D A;  2E8V A;  4NFJ F;  1HXG A;  3PYA A;  3VJC A;  3WCL A;  2E8U A;  4F62 A;  1YYR A;  1VG2 A;  5E8K A;  3KRA B;  3ZMC A;  1KIY A;  1WL0 A;  2Z4X A;  1HM7 A;  3LJI A;  2F7M F;  1WL1 A;  2DH4 A;  5ILD A;  1VG7 A;  3G4D A;  4LPG F;  3P8L A;  2PS6 A;  4NKF A;  2PS5 A;  5B02 A;  4KVY A;  5A0K A;  4KQU A;  3WSB A;  5JUZ F;  1JFA A;  3P8R A;  2ZEU A;  2ZY1 A;  1N23 A;  3PH7 A;  1N22 A;  2AEK A;  5EAS A;  1WY0 A;  3KRC A;  3ZL6 A;  1PS1 A;  3ACX A;  1V4E A;  3VJE A;  4KQS A;  4LIX A;  5ILK A;  3WCF A;  5DJV F;  4LTZ A;  3VJA A;  5E8H A;  3KBK A;  5JV0 F;  5IMI A;  2F9K F;  4UMJ A;  4JZX A;  3P41 A;  3P5P A;  1FPS A;  1YHM A;  4E1E A;  4OGU A;  1VG6 A;  4LFV F;  3LMD A;  5AEL A;  4P0W A;  3OYR A;  1VG3 A;  2ZCR A;  5E8L A;  5B0I A;  3KRC B;  4F6X A;  2ZCS A;  4KPJ A;  4E9Z A;  3QKC A;  4LZC A;  5IN8 A;  4JXY A;  1V4I A;  1HM4 A;  4DI5 A;  4LUU A;  5CG5 A;  4XQR F;  1UBX A;  2PS7 A;  4WK5 A;  3WSA A;  3N5H F;  3CP6 A;  3S9V A;  3M00 A;  5IVG A;  3Q1O A;  1HXC A;  1V4K A;  1WKZ A;  2QIS A;  2AZJ A;  3OAC A;  3PDE A;  1RQI A;  3TFN A;  4H5D F;  3WJN A;  5AHU B;  2FOR A;  2Z4Y A;  3LDW A;  3SDQ A;  3NPK A;  3PYB A;  5HNA A;  3BNX A;  5DGS F;  4EA0 A;  5EAU A;  2Z4W A;  5B00 A;  2F94 F;  3OAC B;  3WCH A;  5JV2 F;  4NFI F;  4EA1 A;  3ASX A;  4KK2 A;  3WC9 A;  4DWB A;  3Q2Z A;  5ILH A;  4RYP A;  4KKM A;  1HXA A;  4RXE A;  3N5J F;  4LOB A;  4H5C F;  1RQJ A;  3DYG A;  5JA0 F;  3WJK A;  4FP4 A;  4RXC A;  3VJB A;  5EAT A;  5IL3 A;  3LLW A;  3V1V A;  2ZCQ A;  3N6K F;  4LTV A;  2Z52 A;  3ID0 A;  3WEG A;  3KRO A;  4LFE A;  5HN7 A;  3CC9 A;  4KVD A;  3ZOU A;  4JVJ F;  5IKH A;  5IKA A;  2Z4Z A;  4JYX A;  3WEI A;  4XQS F;  3V1X A;  2AZK A;  4LA6 A;  5AYP A;  3DYF A;  3Q30 A;  4KUX A;  1V4H A;  4NKE A;  3KRO B;  1UBY A;  4FJQ A;  4LZ3 A;  4DXJ A;  2OPM A;  4GP2 A;  4GA3 A;  5IK6 A;  1WL2 A;  4QPF A;  3WE9 A;  3N1W F;  4N9U A;  5DJR F;  2H8O A;  1WMW A;  2Q58 A;  4KQ5 A;  5H9D A;  1V4J A;  2E93 A;  5A0J A;  3M9U A;  2OGD A;  3KB9 A;  3WEH A;  4OKM A;  3WCI A;  5B01 A;  3WJO A;  3VJD A;  2E90 A;  3EFQ A;  2OPN A;  2Z7H A;  4NG6 A;  4F6V A;  4GAX A;  3NPR A;  2Q9Y A;  3LGK A; 
#chains in the Genus database with same CATH homology
 4LZ0 A;  5IM1 A;  3WCM A;  1EZF A;  4LFG A;  5ILZ A;  4HD1 A;  3CKE A;  4P0X A;  2F8C F;  3ICN A;  4DZW A;  2PS8 A;  2Q9Z A;  4NFK F;  4Q23 A;  4MC3 A;  2F92 F;  5DW7 A;  4XQT F;  5AFX A;  1YYQ A;  3OAB A;  4DEM F;  2F8Z F;  4MC0 A;  5DGM F;  3ACY A;  3LOM A;  5IK9 A;  3VJ8 A;  1HX9 A;  4PVY F;  4LXW A;  4N1Z F;  3N0F A;  3IBA A;  4P0V A;  4PVX F;  3RYW A;  3SDT A;  3M01 A;  5IK0 A;  3MZV A;  4KVI A;  5B0J A;  2E91 A;  3LGZ B;  2EWG A;  3OAB B;  2ZCO A;  3ACW A;  5HN9 A;  3N49 F;  3TFV A;  3ADZ A;  1YHL A;  4JXN A;  1ZW5 A;  2AZL A;  5DJP F;  1N24 A;  3RBM A;  3ICM A;  2ONH A;  2E95 A;  4K10 A;  5DHK A;  1RTR A;  3B7L A;  3RMG A;  3N46 F;  4H5E F;  3SDV A;  1YYU A;  2Z4V A;  3Q2Q A;  3UCA A;  3M0G A;  3IPI A;  3V66 A;  3WCJ A;  2E8T A;  3VJ9 A;  1YV5 A;  3DYH A;  2RAH A;  5IMN A;  3SAE A;  5B0L A;  5DZ2 A;  1YHK A;  4E9U A;  5B0M A;  5C05 A;  3LG5 A;  3QQV A;  3TS7 A;  4KWD A;  2Z7I A;  4DWG A;  3MAV A;  3NF2 A;  2F89 F;  5I1U A;  1N21 A;  3AQB B;  3AE0 A;  5ERN A;  5ILJ A;  1UBV A;  4EA2 A;  4KVW A;  4DHD A;  5ERM A;  2J5C A;  5DIQ F;  3WCC A;  3WEF A;  2Z50 A;  1N1B A;  4KPD A;  3RYE A;  2PS4 A;  5ERO A;  3KRP A;  3LVS A;  3WCD A;  2E8W A;  3W7F A;  3LK5 A;  1DI1 A;  1N20 A;  3WCE A;  3ICZ A;  3EGT A;  1WL3 A;  2AET A;  4GP1 A;  1JFG A;  5HN8 A;  3M02 A;  3NRI A;  4L2X F;  5B03 A;  5A0I A;  1N1Z A;  3KRP B;  2E94 A;  1UBW A;  3WCA A;  3BNY A;  4RXD A;  4KFA A;  3ICK A;  3TFP A;  5ILY A;  1YYS A;  3N1V F;  3KRF A;  3SDR A;  4OMH A;  3P5R A;  2OA6 A;  5DGN F;  4RXA A;  3TC1 A;  3S4J A;  4QXS F;  3WCB A;  3LSN A;  2E8X A;  4JZB A;  2O1O A;  3ZMB A;  5IL8 A;  5KSX F;  3EZ3 A;  4OMG A;  3KRF B;  2FTZ A;  2ZEV A;  5B0K A;  5DHI A;  2Z78 A;  3N3L F;  4LA5 A;  2P1C A;  4RNQ A;  3AQ0 A;  3SDU A;  4LPH F;  3WEJ A;  2E4O A;  1VG4 A;  3N0G A;  2J1O A;  5CG6 A;  1YQ7 A;  2ONG A;  3AQC B;  2I19 A;  4OKZ A;  4NUA A;  3LEE A;  1DGP A;  1YYT A;  4LLS A;  3LZ9 A;  4LLT A;  2AEL A;  2VF6 A;  4ZQ8 A;  3APZ A;  2Q80 A;  3KRA A;  1KIZ A;  3N45 F;  2E92 A;  1YJ4 A;  5ILI A;  5ER8 A;  4MC8 A;  3WEK A;  3PKO A;  5IMP A;  3ZCD A;  3WCG A;  5JV1 F;  2J1P A;  3G4F A;  3N3D A;  2E8V A;  4NFJ F;  1HXG A;  3PYA A;  3VJC A;  3WCL A;  2E8U A;  4F62 A;  1YYR A;  1VG2 A;  5E8K A;  3KRA B;  3ZMC A;  1KIY A;  1WL0 A;  2Z4X A;  1HM7 A;  3LJI A;  2F7M F;  1WL1 A;  2DH4 A;  5ILD A;  1VG7 A;  3G4D A;  4LPG F;  3P8L A;  2PS6 A;  4NKF A;  2PS5 A;  5B02 A;  4KVY A;  5A0K A;  4KQU A;  3WSB A;  5JUZ F;  1JFA A;  3P8R A;  2ZEU A;  2ZY1 A;  1N23 A;  3PH7 A;  1N22 A;  2AEK A;  5EAS A;  1WY0 A;  3KRC A;  3ZL6 A;  1PS1 A;  3ACX A;  1V4E A;  3VJE A;  4KQS A;  4LIX A;  5ILK A;  3WCF A;  5DJV F;  4LTZ A;  3VJA A;  5E8H A;  3KBK A;  5JV0 F;  5IMI A;  2F9K F;  4UMJ A;  4JZX A;  3P41 A;  3P5P A;  1FPS A;  1YHM A;  4E1E A;  4OGU A;  1VG6 A;  4LFV F;  3LMD A;  5AEL A;  4P0W A;  3OYR A;  1VG3 A;  2ZCR A;  5E8L A;  5B0I A;  3KRC B;  4F6X A;  2ZCS A;  4KPJ A;  4E9Z A;  3QKC A;  4LZC A;  5IN8 A;  4JXY A;  1V4I A;  1HM4 A;  4DI5 A;  4LUU A;  5CG5 A;  4XQR F;  1UBX A;  2PS7 A;  4WK5 A;  3WSA A;  3N5H F;  3CP6 A;  3S9V A;  3M00 A;  5IVG A;  3Q1O A;  1HXC A;  1V4K A;  1WKZ A;  2QIS A;  2AZJ A;  3OAC A;  3PDE A;  1RQI A;  3TFN A;  4H5D F;  3WJN A;  5AHU B;  2FOR A;  2Z4Y A;  3LDW A;  3SDQ A;  3NPK A;  3PYB A;  5HNA A;  3BNX A;  5DGS F;  4EA0 A;  5EAU A;  2Z4W A;  5B00 A;  2F94 F;  3OAC B;  3WCH A;  5JV2 F;  4NFI F;  4EA1 A;  3ASX A;  4KK2 A;  3WC9 A;  4DWB A;  3Q2Z A;  5ILH A;  4RYP A;  4KKM A;  1HXA A;  4RXE A;  3N5J F;  4LOB A;  4H5C F;  1RQJ A;  3DYG A;  5JA0 F;  3WJK A;  4FP4 A;  4RXC A;  3VJB A;  5EAT A;  5IL3 A;  3LLW A;  3V1V A;  2ZCQ A;  3N6K F;  4LTV A;  2Z52 A;  3ID0 A;  3WEG A;  3KRO A;  4LFE A;  5HN7 A;  3CC9 A;  4KVD A;  3ZOU A;  4JVJ F;  5IKH A;  5IKA A;  2Z4Z A;  4JYX A;  3WEI A;  4XQS F;  3V1X A;  2AZK A;  4LA6 A;  5AYP A;  3DYF A;  3Q30 A;  4KUX A;  1V4H A;  4NKE A;  3KRO B;  1UBY A;  4FJQ A;  4LZ3 A;  4DXJ A;  2OPM A;  4GP2 A;  4GA3 A;  5IK6 A;  1WL2 A;  4QPF A;  3WE9 A;  3N1W F;  4N9U A;  5DJR F;  2H8O A;  1WMW A;  2Q58 A;  4KQ5 A;  5H9D A;  1V4J A;  2E93 A;  5A0J A;  3M9U A;  2OGD A;  3KB9 A;  3WEH A;  4OKM A;  3WCI A;  5B01 A;  3WJO A;  3VJD A;  2E90 A;  3EFQ A;  2OPN A;  2Z7H A;  4NG6 A;  4F6V A;  4GAX A;  3NPR A;  2Q9Y A;  3LGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...