5HNAA

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph-1251
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
361
structure length
352
Chain Sequence
LAFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKDINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSREIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIDNLIYKKIEDISMLMGEYFQIHDDYLDIFDSTKTGKVSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Farnesyl pyrophosphate synthase, putative
publication title Dynamic Structure and Inhibition of a Malaria Drug Target: Geranylgeranyl Diphosphate Synthase.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 145
structure length 352
sequence length 361
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5hnaA00
4XQTF 3WEGA 5IKAA 4RYPA 3RYEA 4OKZA 1ZW5A 4KQSA 3LZ9A 5B0IA 2H8OA 1FPSA 2E92A 5IMNA 3N0FA 3V1XA 3PH7A 2RAHA 4GP2A 1EZFA 5CG5A 5B0JA 3LGZB 4MC0A 3BNYA 5HNAA 3DYHA 4H5DF 3KROA 1JFAA 4KVYA 3SDUA 3V66A 5B0KA 4KQUA 4JZBA 2E8TA 2F7MF 2E8XA 2ZY1A 3WEHA 4P0VA 1YYSA 3N49F 3KROB 2QISA 1N20A 4NFKF 4LXWA 2PS7A 4KKMA 2I19A 3BNXA 3LEEA 3PDEA 3WEJA 3NRIA 2AETA 4KWDA 3OABA 3TFPA 4L2XF 3SDQA 4RXAA 3TC1A 3SDRA 4JYXA 2E93A 3G4FA 5KSXF 3B7LA 3SAEA 1DGPA 2AEKA 3P8RA 3WCFA 3OABB 4LPGF 2Z7IA 4LTZA 5IMIA 4LUUA 2F89F 5JV0F 3WEFA 2Z78A 1WMWA 2E4OA 2ZEVA 4RXDA 1N21A 3N46F 1VG4A 3V1VA 4GA3A 1YYUA 1YHMA 3EGTA 3ZMBA 4DEMF 1N1BA 1JFGA 2OA6A 3APZA 1YJ4A 2E94A 4JXYA 2VF6A 3M00A 4MC8A 1HXAA 3WSAA 4K10A 2P1CA 2E91A 3ID0A 3OYRA 5AYPA 3WCCA 2Z52A 4F62A 4RXCA 4NUAA 4EA1A 2AELA 4DWBA 4FP4A 4KVWA 3CP6A 4PVYF 4EA0A 3LDWA 2Z4XA 3LMDA 5IKHA 5ILHA 4P0WA 4QPFA 4LA6A 4NG6A 4LLTA 2Q9YA 3WCEA 5DJVF 3P5PA 4LZ3A 4DHDA 3ACXA 3KRCA 3KBKA 4NKEA 5IK9A 4NKFA 3W7FA 4KVDA 5E8HA 5ERMA 4DI5A 3WCHA 4GP1A 4QXSF 3WCIA 3CKEA 4MC3A 4DWGA 5IL3A 5B00A 3N45F 4KK2A 3KRCB 3N0GA 4LIXA 3TFNA 2F94F 2ZEUA 5EATA 5H9DA 3WCMA 2J5CA 3TS7A 3WCJA 4N1ZF 2DH4A 1N24A 1YQ7A 5HN9A 5ILIA 5ILDA 3LGKA 4LPHF 4LLSA 1V4KA 5A0KA 5B03A 4LTVA 5ER8A 4E1EA 2FTZA 3QQVA 1YV5A 4E9ZA 3WE9A 1WL2A 3IBAA 5JA0F 5AELA 3LVSA 3LOMA 3Q2ZA 3M9UA 5IMPA 3PKOA 1UBVA 3DYFA 3OACA 5E8LA 4ZQ8A 3VJCA 5IK6A 5ILYA 3AQ0A 3ACWA 2ZCSA 5A0IA 3MZVA 3NF2A 2J1PA 3N6KF 4JXNA 4OGUA 5ILKA 3Q2QA 3AQBB 1DI1A 2OPMA 3WJNA 3QKCA 4N9UA 4F6XA 1V4JA 2PS4A 3SDTA 5EAUA 3OACB 3ZCDA 5IM1A 3M02A 4KVIA 1RQIA 4LFVF 3M0GA 3SDVA 3VJ8A 3TFVA 1PS1A 4P0XA 3ZMCA 5I1UA 5CG6A 4NFJF 4HD1A 3MAVA 2F8ZF 5EASA 5JV1F 3KRPA 3PYBA 3WEKA 3P8LA 5HN7A 2O1OA 3KB9A 5DJPF 3VJDA 3KRFA 5AHUB 2ONHA 3LJIA 4H5CF 4LA5A 5ILJA 2AZLA 2Q9ZA 3KRPB 5AFXA 3WCBA 4XQSF 2PS5A 2ZCRA 3KRFB 2Z4YA 3LSNA 3RBMA 3ICMA 2PS6A 5E8KA 1HM7A 4XQRF 3VJ9A 4E9UA 5JUZF 3Q1OA 3LG5A 3N3LF 3ACYA 1RTRA 2Q80A 2E95A 4JVJF 3S9VA 4H5EF 3EFQA 1V4HA 1YYRA 5B02A 4LFGA 5DGNF 1HX9A 3RMGA 4Q23A 5A0JA 2OPNA 3N3DA 5B0LA 4KPDA 2ZCQA 4KQ5A 4EA2A 1YYQA 1V4IA 3Q30A 1N1ZA 4KFAA 1YHKA 3LK5A 3N1VF 4OKMA 3VJAA 1YHLA 3ADZA 4F6VA 3VJEA 2EWGA 3G4DA 5ILZA 4LOBA 3N5HF 2E8UA 4LFEA 2J1OA 1VG6A 5IK0A 2AZJA 3AQCB 3AE0A 1KIZA 5C05A 2Z50A 3KRAA 1VG7A 2Z7HA 3VJBA 4KUXA 4RXEA 2AZKA 3CC9A 5B0MA 5ERNA 5HN8A 5IL8A 1UBWA 4RNQA 3WCAA 5DJRF 5DHIA 2Z4VA 5IN8A 2E90A 3P41A 3KRAB 5DGSF 5DW7A 2F92F 4OMHA 5DIQF 3WJKA 2FORA 3N1WF 3LLWA 1UBXA 4WK5A 3S4JA 3WSBA 3P5RA 4NFIF 5DHKA 1RQJA 2ONGA 2F9KF 3PYAA 4LZ0A 5DGMF 5EROA 3WJOA 3WCDA 3NPRA 2F8CF 3WC9A 1YYTA 1VG3A 3IPIA 1VG2A 4OMGA 5DZ2A 5JV2F 1WL0A 3UCAA 3ZOUA 2E8WA 4DXJA 2E8VA 1N23A 4KPJA 2PS8A 1WY0A 1WL3A 5IVGA 1WL1A 3WCLA 3ASXA 3RYWA 3EZ3A 2Z4ZA 3M01A 3WEIA 1N22A 1UBYA 4DZWA 2Q58A 1HXCA 3ICNA 3ICKA 4UMJA 4LZCA 3ICZA 1KIYA 3NPKA 3ZL6A 2ZCOA 4PVXF 3WCGA 3DYGA 5B01A 4GAXA 2Z4WA 2OGDA 1WKZA 4JZXA 1V4EA 1HXGA 1HM4A 4FJQA 3N5JF
chains in the Genus database with same CATH superfamily
4XQTF 3WEGA 5IKAA 4RYPA 3RYEA 4OKZA 1ZW5A 4KQSA 3LZ9A 5B0IA 2H8OA 1FPSA 2E92A 5IMNA 3N0FA 3V1XA 3PH7A 2RAHA 4GP2A 1EZFA 5CG5A 5B0JA 3LGZB 4MC0A 3BNYA 5HNAA 3DYHA 4H5DF 3KROA 1JFAA 4KVYA 3SDUA 3V66A 5B0KA 4KQUA 4JZBA 2E8TA 2F7MF 2E8XA 2ZY1A 3WEHA 4P0VA 1YYSA 3N49F 3KROB 2QISA 1N20A 4NFKF 4LXWA 2PS7A 4KKMA 2I19A 3BNXA 3LEEA 3PDEA 3WEJA 3NRIA 2AETA 4KWDA 3OABA 3TFPA 4L2XF 3SDQA 4RXAA 3TC1A 3SDRA 4JYXA 2E93A 3G4FA 5KSXF 3B7LA 3SAEA 1DGPA 2AEKA 3P8RA 3WCFA 3OABB 4LPGF 2Z7IA 4LTZA 5IMIA 4LUUA 2F89F 5JV0F 3WEFA 2Z78A 1WMWA 2E4OA 2ZEVA 4RXDA 1N21A 3N46F 1VG4A 3V1VA 4GA3A 1YYUA 1YHMA 3EGTA 3ZMBA 4DEMF 1N1BA 1JFGA 2OA6A 3APZA 1YJ4A 2E94A 4JXYA 2VF6A 3M00A 4MC8A 1HXAA 3WSAA 4K10A 2P1CA 2E91A 3ID0A 3OYRA 5AYPA 3WCCA 2Z52A 4F62A 4RXCA 4NUAA 4EA1A 2AELA 4DWBA 4FP4A 4KVWA 3CP6A 4PVYF 4EA0A 3LDWA 2Z4XA 3LMDA 5IKHA 5ILHA 4P0WA 4QPFA 4LA6A 4NG6A 4LLTA 2Q9YA 3WCEA 5DJVF 3P5PA 4LZ3A 4DHDA 3ACXA 3KRCA 3KBKA 4NKEA 5IK9A 4NKFA 3W7FA 4KVDA 5E8HA 5ERMA 4DI5A 3WCHA 4GP1A 4QXSF 3WCIA 3CKEA 4MC3A 4DWGA 5IL3A 5B00A 3N45F 4KK2A 3KRCB 3N0GA 4LIXA 3TFNA 2F94F 2ZEUA 5EATA 5H9DA 3WCMA 2J5CA 3TS7A 3WCJA 4N1ZF 2DH4A 1N24A 1YQ7A 5HN9A 5ILIA 5ILDA 3LGKA 4LPHF 4LLSA 1V4KA 5A0KA 5B03A 4LTVA 5ER8A 4E1EA 2FTZA 3QQVA 1YV5A 4E9ZA 3WE9A 1WL2A 3IBAA 5JA0F 5AELA 3LVSA 3LOMA 3Q2ZA 3M9UA 5IMPA 3PKOA 1UBVA 3DYFA 3OACA 5E8LA 4ZQ8A 3VJCA 5IK6A 5ILYA 3AQ0A 3ACWA 2ZCSA 5A0IA 3MZVA 3NF2A 2J1PA 3N6KF 4JXNA 4OGUA 5ILKA 3Q2QA 3AQBB 1DI1A 2OPMA 3WJNA 3QKCA 4N9UA 4F6XA 1V4JA 2PS4A 3SDTA 5EAUA 3OACB 3ZCDA 5IM1A 3M02A 4KVIA 1RQIA 4LFVF 3M0GA 3SDVA 3VJ8A 3TFVA 1PS1A 4P0XA 3ZMCA 5I1UA 5CG6A 4NFJF 4HD1A 3MAVA 2F8ZF 5EASA 5JV1F 3KRPA 3PYBA 3WEKA 3P8LA 5HN7A 2O1OA 3KB9A 5DJPF 3VJDA 3KRFA 5AHUB 2ONHA 3LJIA 4H5CF 4LA5A 5ILJA 2AZLA 2Q9ZA 3KRPB 5AFXA 3WCBA 4XQSF 2PS5A 2ZCRA 3KRFB 2Z4YA 3LSNA 3RBMA 3ICMA 2PS6A 5E8KA 1HM7A 4XQRF 3VJ9A 4E9UA 5JUZF 3Q1OA 3LG5A 3N3LF 3ACYA 1RTRA 2Q80A 2E95A 4JVJF 3S9VA 4H5EF 3EFQA 1V4HA 1YYRA 5B02A 4LFGA 5DGNF 1HX9A 3RMGA 4Q23A 5A0JA 2OPNA 3N3DA 5B0LA 4KPDA 2ZCQA 4KQ5A 4EA2A 1YYQA 1V4IA 3Q30A 1N1ZA 4KFAA 1YHKA 3LK5A 3N1VF 4OKMA 3VJAA 1YHLA 3ADZA 4F6VA 3VJEA 2EWGA 3G4DA 5ILZA 4LOBA 3N5HF 2E8UA 4LFEA 2J1OA 1VG6A 5IK0A 2AZJA 3AQCB 3AE0A 1KIZA 5C05A 2Z50A 3KRAA 1VG7A 2Z7HA 3VJBA 4KUXA 4RXEA 2AZKA 3CC9A 5B0MA 5ERNA 5HN8A 5IL8A 1UBWA 4RNQA 3WCAA 5DJRF 5DHIA 2Z4VA 5IN8A 2E90A 3P41A 3KRAB 5DGSF 5DW7A 2F92F 4OMHA 5DIQF 3WJKA 2FORA 3N1WF 3LLWA 1UBXA 4WK5A 3S4JA 3WSBA 3P5RA 4NFIF 5DHKA 1RQJA 2ONGA 2F9KF 3PYAA 4LZ0A 5DGMF 5EROA 3WJOA 3WCDA 3NPRA 2F8CF 3WC9A 1YYTA 1VG3A 3IPIA 1VG2A 4OMGA 5DZ2A 5JV2F 1WL0A 3UCAA 3ZOUA 2E8WA 4DXJA 2E8VA 1N23A 4KPJA 2PS8A 1WY0A 1WL3A 5IVGA 1WL1A 3WCLA 3ASXA 3RYWA 3EZ3A 2Z4ZA 3M01A 3WEIA 1N22A 1UBYA 4DZWA 2Q58A 1HXCA 3ICNA 3ICKA 4UMJA 4LZCA 3ICZA 1KIYA 3NPKA 3ZL6A 2ZCOA 4PVXF 3WCGA 3DYGA 5B01A 4GAXA 2Z4WA 2OGDA 1WKZA 4JZXA 1V4EA 1HXGA 1HM4A 4FJQA 3N5JF
chains in the Genus database with same CATH topology
4XQTF 3WEGA 5IKAA 4RYPA 3RYEA 4OKZA 1ZW5A 4KQSA 3LZ9A 5B0IA 2H8OA 1FPSA 2E92A 5IMNA 3N0FA 3V1XA 3PH7A 2RAHA 4GP2A 1EZFA 5CG5A 5B0JA 3LGZB 4MC0A 3BNYA 5HNAA 3DYHA 4H5DF 3KROA 1JFAA 4KVYA 3SDUA 3V66A 5B0KA 4KQUA 4JZBA 2E8TA 2F7MF 2E8XA 2ZY1A 3WEHA 4P0VA 1YYSA 3N49F 3KROB 2QISA 1N20A 4NFKF 4LXWA 2PS7A 4KKMA 2I19A 3BNXA 3LEEA 3PDEA 3WEJA 3NRIA 2AETA 4KWDA 3OABA 3TFPA 4L2XF 3SDQA 4RXAA 3TC1A 3SDRA 4JYXA 2E93A 3G4FA 5KSXF 3B7LA 3SAEA 1DGPA 2AEKA 3P8RA 3WCFA 3OABB 4LPGF 2Z7IA 4LTZA 5IMIA 4LUUA 2F89F 5JV0F 3WEFA 2Z78A 1WMWA 2E4OA 2ZEVA 4RXDA 1N21A 3N46F 1VG4A 3V1VA 4GA3A 1YYUA 1YHMA 3EGTA 3ZMBA 4DEMF 1N1BA 1JFGA 2OA6A 3APZA 1YJ4A 2E94A 4JXYA 2VF6A 3M00A 4MC8A 1HXAA 3WSAA 4K10A 2P1CA 2E91A 3ID0A 3OYRA 5AYPA 3WCCA 2Z52A 4F62A 4RXCA 4NUAA 4EA1A 2AELA 4DWBA 4FP4A 4KVWA 3CP6A 4PVYF 4EA0A 3LDWA 2Z4XA 3LMDA 5IKHA 5ILHA 4P0WA 4QPFA 4LA6A 4NG6A 4LLTA 2Q9YA 3WCEA 5DJVF 3P5PA 4LZ3A 4DHDA 3ACXA 3KRCA 3KBKA 4NKEA 5IK9A 4NKFA 3W7FA 4KVDA 5E8HA 5ERMA 4DI5A 3WCHA 4GP1A 4QXSF 3WCIA 3CKEA 4MC3A 4DWGA 5IL3A 5B00A 3N45F 4KK2A 3KRCB 3N0GA 4LIXA 3TFNA 2F94F 2ZEUA 5EATA 5H9DA 3WCMA 2J5CA 3TS7A 3WCJA 4N1ZF 2DH4A 1N24A 1YQ7A 5HN9A 5ILIA 5ILDA 3LGKA 4LPHF 4LLSA 1V4KA 5A0KA 5B03A 4LTVA 5ER8A 4E1EA 2FTZA 3QQVA 1YV5A 4E9ZA 3WE9A 1WL2A 3IBAA 5JA0F 5AELA 3LVSA 3LOMA 3Q2ZA 3M9UA 5IMPA 3PKOA 1UBVA 3DYFA 3OACA 5E8LA 4ZQ8A 3VJCA 5IK6A 5ILYA 3AQ0A 3ACWA 2ZCSA 5A0IA 3MZVA 3NF2A 2J1PA 3N6KF 4JXNA 4OGUA 5ILKA 3Q2QA 3AQBB 1DI1A 2OPMA 3WJNA 3QKCA 4N9UA 4F6XA 1V4JA 2PS4A 3SDTA 5EAUA 3OACB 3ZCDA 5IM1A 3M02A 4KVIA 1RQIA 4LFVF 3M0GA 3SDVA 3VJ8A 3TFVA 1PS1A 4P0XA 3ZMCA 5I1UA 5CG6A 4NFJF 4HD1A 3MAVA 2F8ZF 5EASA 5JV1F 3KRPA 3PYBA 3WEKA 3P8LA 5HN7A 2O1OA 3KB9A 5DJPF 3VJDA 3KRFA 5AHUB 2ONHA 3LJIA 4H5CF 4LA5A 5ILJA 2AZLA 2Q9ZA 3KRPB 5AFXA 3WCBA 4XQSF 2PS5A 2ZCRA 3KRFB 2Z4YA 3LSNA 3RBMA 3ICMA 2PS6A 5E8KA 1HM7A 4XQRF 3VJ9A 4E9UA 5JUZF 3Q1OA 3LG5A 3N3LF 3ACYA 1RTRA 2Q80A 2E95A 4JVJF 3S9VA 4H5EF 3EFQA 1V4HA 1YYRA 5B02A 4LFGA 5DGNF 1HX9A 3RMGA 4Q23A 5A0JA 2OPNA 3N3DA 5B0LA 4KPDA 2ZCQA 4KQ5A 4EA2A 1YYQA 1V4IA 3Q30A 1N1ZA 4KFAA 1YHKA 3LK5A 3N1VF 4OKMA 3VJAA 1YHLA 3ADZA 4F6VA 3VJEA 2EWGA 3G4DA 5ILZA 4LOBA 3N5HF 2E8UA 4LFEA 2J1OA 1VG6A 5IK0A 2AZJA 3AQCB 3AE0A 1KIZA 5C05A 2Z50A 3KRAA 1VG7A 2Z7HA 3VJBA 4KUXA 4RXEA 2AZKA 3CC9A 5B0MA 5ERNA 5HN8A 5IL8A 1UBWA 4RNQA 3WCAA 5DJRF 5DHIA 2Z4VA 5IN8A 2E90A 3P41A 3KRAB 5DGSF 5DW7A 2F92F 4OMHA 5DIQF 3WJKA 2FORA 3N1WF 3LLWA 1UBXA 4WK5A 3S4JA 3WSBA 3P5RA 4NFIF 5DHKA 1RQJA 2ONGA 2F9KF 3PYAA 4LZ0A 5DGMF 5EROA 3WJOA 3WCDA 3NPRA 2F8CF 3WC9A 1YYTA 1VG3A 3IPIA 1VG2A 4OMGA 5DZ2A 5JV2F 1WL0A 3UCAA 3ZOUA 2E8WA 4DXJA 2E8VA 1N23A 4KPJA 2PS8A 1WY0A 1WL3A 5IVGA 1WL1A 3WCLA 3ASXA 3RYWA 3EZ3A 2Z4ZA 3M01A 3WEIA 1N22A 1UBYA 4DZWA 2Q58A 1HXCA 3ICNA 3ICKA 4UMJA 4LZCA 3ICZA 1KIYA 3NPKA 3ZL6A 2ZCOA 4PVXF 3WCGA 3DYGA 5B01A 4GAXA 2Z4WA 2OGDA 1WKZA 4JZXA 1V4EA 1HXGA 1HM4A 4FJQA 3N5JF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQT F;  3WEG A;  5IKA A;  4RYP A;  3RYE A;  4OKZ A;  1ZW5 A;  4KQS A;  3LZ9 A;  5B0I A;  2H8O A;  1FPS A;  2E92 A;  5IMN A;  3N0F A;  3V1X A;  3PH7 A;  2RAH A;  4GP2 A;  1EZF A;  5CG5 A;  5B0J A;  3LGZ B;  4MC0 A;  3BNY A;  5HNA A;  3DYH A;  4H5D F;  3KRO A;  1JFA A;  4KVY A;  3SDU A;  3V66 A;  5B0K A;  4KQU A;  4JZB A;  2E8T A;  2F7M F;  2E8X A;  2ZY1 A;  3WEH A;  4P0V A;  1YYS A;  3N49 F;  3KRO B;  2QIS A;  1N20 A;  4NFK F;  4LXW A;  2PS7 A;  4KKM A;  2I19 A;  3BNX A;  3LEE A;  3PDE A;  3WEJ A;  3NRI A;  2AET A;  4KWD A;  3OAB A;  3TFP A;  4L2X F;  3SDQ A;  4RXA A;  3TC1 A;  3SDR A;  4JYX A;  2E93 A;  3G4F A;  5KSX F;  3B7L A;  3SAE A;  1DGP A;  2AEK A;  3P8R A;  3WCF A;  3OAB B;  4LPG F;  2Z7I A;  4LTZ A;  5IMI A;  4LUU A;  2F89 F;  5JV0 F;  3WEF A;  2Z78 A;  1WMW A;  2E4O A;  2ZEV A;  4RXD A;  1N21 A;  3N46 F;  1VG4 A;  3V1V A;  4GA3 A;  1YYU A;  1YHM A;  3EGT A;  3ZMB A;  4DEM F;  1N1B A;  1JFG A;  2OA6 A;  3APZ A;  1YJ4 A;  2E94 A;  4JXY A;  2VF6 A;  3M00 A;  4MC8 A;  1HXA A;  3WSA A;  4K10 A;  2P1C A;  2E91 A;  3ID0 A;  3OYR A;  5AYP A;  3WCC A;  2Z52 A;  4F62 A;  4RXC A;  4NUA A;  4EA1 A;  2AEL A;  4DWB A;  4FP4 A;  4KVW A;  3CP6 A;  4PVY F;  4EA0 A;  3LDW A;  2Z4X A;  3LMD A;  5IKH A;  5ILH A;  4P0W A;  4QPF A;  4LA6 A;  4NG6 A;  4LLT A;  2Q9Y A;  3WCE A;  5DJV F;  3P5P A;  4LZ3 A;  4DHD A;  3ACX A;  3KRC A;  3KBK A;  4NKE A;  5IK9 A;  4NKF A;  3W7F A;  4KVD A;  5E8H A;  5ERM A;  4DI5 A;  3WCH A;  4GP1 A;  4QXS F;  3WCI A;  3CKE A;  4MC3 A;  4DWG A;  5IL3 A;  5B00 A;  3N45 F;  4KK2 A;  3KRC B;  3N0G A;  4LIX A;  3TFN A;  2F94 F;  2ZEU A;  5EAT A;  5H9D A;  3WCM A;  2J5C A;  3TS7 A;  3WCJ A;  4N1Z F;  2DH4 A;  1N24 A;  1YQ7 A;  5HN9 A;  5ILI A;  5ILD A;  3LGK A;  4LPH F;  4LLS A;  1V4K A;  5A0K A;  5B03 A;  4LTV A;  5ER8 A;  4E1E A;  2FTZ A;  3QQV A;  1YV5 A;  4E9Z A;  3WE9 A;  1WL2 A;  3IBA A;  5JA0 F;  5AEL A;  3LVS A;  3LOM A;  3Q2Z A;  3M9U A;  5IMP A;  3PKO A;  1UBV A;  3DYF A;  3OAC A;  5E8L A;  4ZQ8 A;  3VJC A;  5IK6 A;  5ILY A;  3AQ0 A;  3ACW A;  2ZCS A;  5A0I A;  3MZV A;  3NF2 A;  2J1P A;  3N6K F;  4JXN A;  4OGU A;  5ILK A;  3Q2Q A;  3AQB B;  1DI1 A;  2OPM A;  3WJN A;  3QKC A;  4N9U A;  4F6X A;  1V4J A;  2PS4 A;  3SDT A;  5EAU A;  3OAC B;  3ZCD A;  5IM1 A;  3M02 A;  4KVI A;  1RQI A;  4LFV F;  3M0G A;  3SDV A;  3VJ8 A;  3TFV A;  1PS1 A;  4P0X A;  3ZMC A;  5I1U A;  5CG6 A;  4NFJ F;  4HD1 A;  3MAV A;  2F8Z F;  5EAS A;  5JV1 F;  3KRP A;  3PYB A;  3WEK A;  3P8L A;  5HN7 A;  2O1O A;  3KB9 A;  5DJP F;  3VJD A;  3KRF A;  5AHU B;  2ONH A;  3LJI A;  4H5C F;  4LA5 A;  5ILJ A;  2AZL A;  2Q9Z A;  3KRP B;  5AFX A;  3WCB A;  4XQS F;  2PS5 A;  2ZCR A;  3KRF B;  2Z4Y A;  3LSN A;  3RBM A;  3ICM A;  2PS6 A;  5E8K A;  1HM7 A;  4XQR F;  3VJ9 A;  4E9U A;  5JUZ F;  3Q1O A;  3LG5 A;  3N3L F;  3ACY A;  1RTR A;  2Q80 A;  2E95 A;  4JVJ F;  3S9V A;  4H5E F;  3EFQ A;  1V4H A;  1YYR A;  5B02 A;  4LFG A;  5DGN F;  1HX9 A;  3RMG A;  4Q23 A;  5A0J A;  2OPN A;  3N3D A;  5B0L A;  4KPD A;  2ZCQ A;  4KQ5 A;  4EA2 A;  1YYQ A;  1V4I A;  3Q30 A;  1N1Z A;  4KFA A;  1YHK A;  3LK5 A;  3N1V F;  4OKM A;  3VJA A;  1YHL A;  3ADZ A;  4F6V A;  3VJE A;  2EWG A;  3G4D A;  5ILZ A;  4LOB A;  3N5H F;  2E8U A;  4LFE A;  2J1O A;  1VG6 A;  5IK0 A;  2AZJ A;  3AQC B;  3AE0 A;  1KIZ A;  5C05 A;  2Z50 A;  3KRA A;  1VG7 A;  2Z7H A;  3VJB A;  4KUX A;  4RXE A;  2AZK A;  3CC9 A;  5B0M A;  5ERN A;  5HN8 A;  5IL8 A;  1UBW A;  4RNQ A;  3WCA A;  5DJR F;  5DHI A;  2Z4V A;  5IN8 A;  2E90 A;  3P41 A;  3KRA B;  5DGS F;  5DW7 A;  2F92 F;  4OMH A;  5DIQ F;  3WJK A;  2FOR A;  3N1W F;  3LLW A;  1UBX A;  4WK5 A;  3S4J A;  3WSB A;  3P5R A;  4NFI F;  5DHK A;  1RQJ A;  2ONG A;  2F9K F;  3PYA A;  4LZ0 A;  5DGM F;  5ERO A;  3WJO A;  3WCD A;  3NPR A;  2F8C F;  3WC9 A;  1YYT A;  1VG3 A;  3IPI A;  1VG2 A;  4OMG A;  5DZ2 A;  5JV2 F;  1WL0 A;  3UCA A;  3ZOU A;  2E8W A;  4DXJ A;  2E8V A;  1N23 A;  4KPJ A;  2PS8 A;  1WY0 A;  1WL3 A;  5IVG A;  1WL1 A;  3WCL A;  3ASX A;  3RYW A;  3EZ3 A;  2Z4Z A;  3M01 A;  3WEI A;  1N22 A;  1UBY A;  4DZW A;  2Q58 A;  1HXC A;  3ICN A;  3ICK A;  4UMJ A;  4LZC A;  3ICZ A;  1KIY A;  3NPK A;  3ZL6 A;  2ZCO A;  4PVX F;  3WCG A;  3DYG A;  5B01 A;  4GAX A;  2Z4W A;  2OGD A;  1WKZ A;  4JZX A;  1V4E A;  1HXG A;  1HM4 A;  4FJQ A;  3N5J F; 
#chains in the Genus database with same CATH topology
 4XQT F;  3WEG A;  5IKA A;  4RYP A;  3RYE A;  4OKZ A;  1ZW5 A;  4KQS A;  3LZ9 A;  5B0I A;  2H8O A;  1FPS A;  2E92 A;  5IMN A;  3N0F A;  3V1X A;  3PH7 A;  2RAH A;  4GP2 A;  1EZF A;  5CG5 A;  5B0J A;  3LGZ B;  4MC0 A;  3BNY A;  5HNA A;  3DYH A;  4H5D F;  3KRO A;  1JFA A;  4KVY A;  3SDU A;  3V66 A;  5B0K A;  4KQU A;  4JZB A;  2E8T A;  2F7M F;  2E8X A;  2ZY1 A;  3WEH A;  4P0V A;  1YYS A;  3N49 F;  3KRO B;  2QIS A;  1N20 A;  4NFK F;  4LXW A;  2PS7 A;  4KKM A;  2I19 A;  3BNX A;  3LEE A;  3PDE A;  3WEJ A;  3NRI A;  2AET A;  4KWD A;  3OAB A;  3TFP A;  4L2X F;  3SDQ A;  4RXA A;  3TC1 A;  3SDR A;  4JYX A;  2E93 A;  3G4F A;  5KSX F;  3B7L A;  3SAE A;  1DGP A;  2AEK A;  3P8R A;  3WCF A;  3OAB B;  4LPG F;  2Z7I A;  4LTZ A;  5IMI A;  4LUU A;  2F89 F;  5JV0 F;  3WEF A;  2Z78 A;  1WMW A;  2E4O A;  2ZEV A;  4RXD A;  1N21 A;  3N46 F;  1VG4 A;  3V1V A;  4GA3 A;  1YYU A;  1YHM A;  3EGT A;  3ZMB A;  4DEM F;  1N1B A;  1JFG A;  2OA6 A;  3APZ A;  1YJ4 A;  2E94 A;  4JXY A;  2VF6 A;  3M00 A;  4MC8 A;  1HXA A;  3WSA A;  4K10 A;  2P1C A;  2E91 A;  3ID0 A;  3OYR A;  5AYP A;  3WCC A;  2Z52 A;  4F62 A;  4RXC A;  4NUA A;  4EA1 A;  2AEL A;  4DWB A;  4FP4 A;  4KVW A;  3CP6 A;  4PVY F;  4EA0 A;  3LDW A;  2Z4X A;  3LMD A;  5IKH A;  5ILH A;  4P0W A;  4QPF A;  4LA6 A;  4NG6 A;  4LLT A;  2Q9Y A;  3WCE A;  5DJV F;  3P5P A;  4LZ3 A;  4DHD A;  3ACX A;  3KRC A;  3KBK A;  4NKE A;  5IK9 A;  4NKF A;  3W7F A;  4KVD A;  5E8H A;  5ERM A;  4DI5 A;  3WCH A;  4GP1 A;  4QXS F;  3WCI A;  3CKE A;  4MC3 A;  4DWG A;  5IL3 A;  5B00 A;  3N45 F;  4KK2 A;  3KRC B;  3N0G A;  4LIX A;  3TFN A;  2F94 F;  2ZEU A;  5EAT A;  5H9D A;  3WCM A;  2J5C A;  3TS7 A;  3WCJ A;  4N1Z F;  2DH4 A;  1N24 A;  1YQ7 A;  5HN9 A;  5ILI A;  5ILD A;  3LGK A;  4LPH F;  4LLS A;  1V4K A;  5A0K A;  5B03 A;  4LTV A;  5ER8 A;  4E1E A;  2FTZ A;  3QQV A;  1YV5 A;  4E9Z A;  3WE9 A;  1WL2 A;  3IBA A;  5JA0 F;  5AEL A;  3LVS A;  3LOM A;  3Q2Z A;  3M9U A;  5IMP A;  3PKO A;  1UBV A;  3DYF A;  3OAC A;  5E8L A;  4ZQ8 A;  3VJC A;  5IK6 A;  5ILY A;  3AQ0 A;  3ACW A;  2ZCS A;  5A0I A;  3MZV A;  3NF2 A;  2J1P A;  3N6K F;  4JXN A;  4OGU A;  5ILK A;  3Q2Q A;  3AQB B;  1DI1 A;  2OPM A;  3WJN A;  3QKC A;  4N9U A;  4F6X A;  1V4J A;  2PS4 A;  3SDT A;  5EAU A;  3OAC B;  3ZCD A;  5IM1 A;  3M02 A;  4KVI A;  1RQI A;  4LFV F;  3M0G A;  3SDV A;  3VJ8 A;  3TFV A;  1PS1 A;  4P0X A;  3ZMC A;  5I1U A;  5CG6 A;  4NFJ F;  4HD1 A;  3MAV A;  2F8Z F;  5EAS A;  5JV1 F;  3KRP A;  3PYB A;  3WEK A;  3P8L A;  5HN7 A;  2O1O A;  3KB9 A;  5DJP F;  3VJD A;  3KRF A;  5AHU B;  2ONH A;  3LJI A;  4H5C F;  4LA5 A;  5ILJ A;  2AZL A;  2Q9Z A;  3KRP B;  5AFX A;  3WCB A;  4XQS F;  2PS5 A;  2ZCR A;  3KRF B;  2Z4Y A;  3LSN A;  3RBM A;  3ICM A;  2PS6 A;  5E8K A;  1HM7 A;  4XQR F;  3VJ9 A;  4E9U A;  5JUZ F;  3Q1O A;  3LG5 A;  3N3L F;  3ACY A;  1RTR A;  2Q80 A;  2E95 A;  4JVJ F;  3S9V A;  4H5E F;  3EFQ A;  1V4H A;  1YYR A;  5B02 A;  4LFG A;  5DGN F;  1HX9 A;  3RMG A;  4Q23 A;  5A0J A;  2OPN A;  3N3D A;  5B0L A;  4KPD A;  2ZCQ A;  4KQ5 A;  4EA2 A;  1YYQ A;  1V4I A;  3Q30 A;  1N1Z A;  4KFA A;  1YHK A;  3LK5 A;  3N1V F;  4OKM A;  3VJA A;  1YHL A;  3ADZ A;  4F6V A;  3VJE A;  2EWG A;  3G4D A;  5ILZ A;  4LOB A;  3N5H F;  2E8U A;  4LFE A;  2J1O A;  1VG6 A;  5IK0 A;  2AZJ A;  3AQC B;  3AE0 A;  1KIZ A;  5C05 A;  2Z50 A;  3KRA A;  1VG7 A;  2Z7H A;  3VJB A;  4KUX A;  4RXE A;  2AZK A;  3CC9 A;  5B0M A;  5ERN A;  5HN8 A;  5IL8 A;  1UBW A;  4RNQ A;  3WCA A;  5DJR F;  5DHI A;  2Z4V A;  5IN8 A;  2E90 A;  3P41 A;  3KRA B;  5DGS F;  5DW7 A;  2F92 F;  4OMH A;  5DIQ F;  3WJK A;  2FOR A;  3N1W F;  3LLW A;  1UBX A;  4WK5 A;  3S4J A;  3WSB A;  3P5R A;  4NFI F;  5DHK A;  1RQJ A;  2ONG A;  2F9K F;  3PYA A;  4LZ0 A;  5DGM F;  5ERO A;  3WJO A;  3WCD A;  3NPR A;  2F8C F;  3WC9 A;  1YYT A;  1VG3 A;  3IPI A;  1VG2 A;  4OMG A;  5DZ2 A;  5JV2 F;  1WL0 A;  3UCA A;  3ZOU A;  2E8W A;  4DXJ A;  2E8V A;  1N23 A;  4KPJ A;  2PS8 A;  1WY0 A;  1WL3 A;  5IVG A;  1WL1 A;  3WCL A;  3ASX A;  3RYW A;  3EZ3 A;  2Z4Z A;  3M01 A;  3WEI A;  1N22 A;  1UBY A;  4DZW A;  2Q58 A;  1HXC A;  3ICN A;  3ICK A;  4UMJ A;  4LZC A;  3ICZ A;  1KIY A;  3NPK A;  3ZL6 A;  2ZCO A;  4PVX F;  3WCG A;  3DYG A;  5B01 A;  4GAX A;  2Z4W A;  2OGD A;  1WKZ A;  4JZX A;  1V4E A;  1HXG A;  1HM4 A;  4FJQ A;  3N5J F; 
#chains in the Genus database with same CATH homology
 4XQT F;  3WEG A;  5IKA A;  4RYP A;  3RYE A;  4OKZ A;  1ZW5 A;  4KQS A;  3LZ9 A;  5B0I A;  2H8O A;  1FPS A;  2E92 A;  5IMN A;  3N0F A;  3V1X A;  3PH7 A;  2RAH A;  4GP2 A;  1EZF A;  5CG5 A;  5B0J A;  3LGZ B;  4MC0 A;  3BNY A;  5HNA A;  3DYH A;  4H5D F;  3KRO A;  1JFA A;  4KVY A;  3SDU A;  3V66 A;  5B0K A;  4KQU A;  4JZB A;  2E8T A;  2F7M F;  2E8X A;  2ZY1 A;  3WEH A;  4P0V A;  1YYS A;  3N49 F;  3KRO B;  2QIS A;  1N20 A;  4NFK F;  4LXW A;  2PS7 A;  4KKM A;  2I19 A;  3BNX A;  3LEE A;  3PDE A;  3WEJ A;  3NRI A;  2AET A;  4KWD A;  3OAB A;  3TFP A;  4L2X F;  3SDQ A;  4RXA A;  3TC1 A;  3SDR A;  4JYX A;  2E93 A;  3G4F A;  5KSX F;  3B7L A;  3SAE A;  1DGP A;  2AEK A;  3P8R A;  3WCF A;  3OAB B;  4LPG F;  2Z7I A;  4LTZ A;  5IMI A;  4LUU A;  2F89 F;  5JV0 F;  3WEF A;  2Z78 A;  1WMW A;  2E4O A;  2ZEV A;  4RXD A;  1N21 A;  3N46 F;  1VG4 A;  3V1V A;  4GA3 A;  1YYU A;  1YHM A;  3EGT A;  3ZMB A;  4DEM F;  1N1B A;  1JFG A;  2OA6 A;  3APZ A;  1YJ4 A;  2E94 A;  4JXY A;  2VF6 A;  3M00 A;  4MC8 A;  1HXA A;  3WSA A;  4K10 A;  2P1C A;  2E91 A;  3ID0 A;  3OYR A;  5AYP A;  3WCC A;  2Z52 A;  4F62 A;  4RXC A;  4NUA A;  4EA1 A;  2AEL A;  4DWB A;  4FP4 A;  4KVW A;  3CP6 A;  4PVY F;  4EA0 A;  3LDW A;  2Z4X A;  3LMD A;  5IKH A;  5ILH A;  4P0W A;  4QPF A;  4LA6 A;  4NG6 A;  4LLT A;  2Q9Y A;  3WCE A;  5DJV F;  3P5P A;  4LZ3 A;  4DHD A;  3ACX A;  3KRC A;  3KBK A;  4NKE A;  5IK9 A;  4NKF A;  3W7F A;  4KVD A;  5E8H A;  5ERM A;  4DI5 A;  3WCH A;  4GP1 A;  4QXS F;  3WCI A;  3CKE A;  4MC3 A;  4DWG A;  5IL3 A;  5B00 A;  3N45 F;  4KK2 A;  3KRC B;  3N0G A;  4LIX A;  3TFN A;  2F94 F;  2ZEU A;  5EAT A;  5H9D A;  3WCM A;  2J5C A;  3TS7 A;  3WCJ A;  4N1Z F;  2DH4 A;  1N24 A;  1YQ7 A;  5HN9 A;  5ILI A;  5ILD A;  3LGK A;  4LPH F;  4LLS A;  1V4K A;  5A0K A;  5B03 A;  4LTV A;  5ER8 A;  4E1E A;  2FTZ A;  3QQV A;  1YV5 A;  4E9Z A;  3WE9 A;  1WL2 A;  3IBA A;  5JA0 F;  5AEL A;  3LVS A;  3LOM A;  3Q2Z A;  3M9U A;  5IMP A;  3PKO A;  1UBV A;  3DYF A;  3OAC A;  5E8L A;  4ZQ8 A;  3VJC A;  5IK6 A;  5ILY A;  3AQ0 A;  3ACW A;  2ZCS A;  5A0I A;  3MZV A;  3NF2 A;  2J1P A;  3N6K F;  4JXN A;  4OGU A;  5ILK A;  3Q2Q A;  3AQB B;  1DI1 A;  2OPM A;  3WJN A;  3QKC A;  4N9U A;  4F6X A;  1V4J A;  2PS4 A;  3SDT A;  5EAU A;  3OAC B;  3ZCD A;  5IM1 A;  3M02 A;  4KVI A;  1RQI A;  4LFV F;  3M0G A;  3SDV A;  3VJ8 A;  3TFV A;  1PS1 A;  4P0X A;  3ZMC A;  5I1U A;  5CG6 A;  4NFJ F;  4HD1 A;  3MAV A;  2F8Z F;  5EAS A;  5JV1 F;  3KRP A;  3PYB A;  3WEK A;  3P8L A;  5HN7 A;  2O1O A;  3KB9 A;  5DJP F;  3VJD A;  3KRF A;  5AHU B;  2ONH A;  3LJI A;  4H5C F;  4LA5 A;  5ILJ A;  2AZL A;  2Q9Z A;  3KRP B;  5AFX A;  3WCB A;  4XQS F;  2PS5 A;  2ZCR A;  3KRF B;  2Z4Y A;  3LSN A;  3RBM A;  3ICM A;  2PS6 A;  5E8K A;  1HM7 A;  4XQR F;  3VJ9 A;  4E9U A;  5JUZ F;  3Q1O A;  3LG5 A;  3N3L F;  3ACY A;  1RTR A;  2Q80 A;  2E95 A;  4JVJ F;  3S9V A;  4H5E F;  3EFQ A;  1V4H A;  1YYR A;  5B02 A;  4LFG A;  5DGN F;  1HX9 A;  3RMG A;  4Q23 A;  5A0J A;  2OPN A;  3N3D A;  5B0L A;  4KPD A;  2ZCQ A;  4KQ5 A;  4EA2 A;  1YYQ A;  1V4I A;  3Q30 A;  1N1Z A;  4KFA A;  1YHK A;  3LK5 A;  3N1V F;  4OKM A;  3VJA A;  1YHL A;  3ADZ A;  4F6V A;  3VJE A;  2EWG A;  3G4D A;  5ILZ A;  4LOB A;  3N5H F;  2E8U A;  4LFE A;  2J1O A;  1VG6 A;  5IK0 A;  2AZJ A;  3AQC B;  3AE0 A;  1KIZ A;  5C05 A;  2Z50 A;  3KRA A;  1VG7 A;  2Z7H A;  3VJB A;  4KUX A;  4RXE A;  2AZK A;  3CC9 A;  5B0M A;  5ERN A;  5HN8 A;  5IL8 A;  1UBW A;  4RNQ A;  3WCA A;  5DJR F;  5DHI A;  2Z4V A;  5IN8 A;  2E90 A;  3P41 A;  3KRA B;  5DGS F;  5DW7 A;  2F92 F;  4OMH A;  5DIQ F;  3WJK A;  2FOR A;  3N1W F;  3LLW A;  1UBX A;  4WK5 A;  3S4J A;  3WSB A;  3P5R A;  4NFI F;  5DHK A;  1RQJ A;  2ONG A;  2F9K F;  3PYA A;  4LZ0 A;  5DGM F;  5ERO A;  3WJO A;  3WCD A;  3NPR A;  2F8C F;  3WC9 A;  1YYT A;  1VG3 A;  3IPI A;  1VG2 A;  4OMG A;  5DZ2 A;  5JV2 F;  1WL0 A;  3UCA A;  3ZOU A;  2E8W A;  4DXJ A;  2E8V A;  1N23 A;  4KPJ A;  2PS8 A;  1WY0 A;  1WL3 A;  5IVG A;  1WL1 A;  3WCL A;  3ASX A;  3RYW A;  3EZ3 A;  2Z4Z A;  3M01 A;  3WEI A;  1N22 A;  1UBY A;  4DZW A;  2Q58 A;  1HXC A;  3ICN A;  3ICK A;  4UMJ A;  4LZC A;  3ICZ A;  1KIY A;  3NPK A;  3ZL6 A;  2ZCO A;  4PVX F;  3WCG A;  3DYG A;  5B01 A;  4GAX A;  2Z4W A;  2OGD A;  1WKZ A;  4JZX A;  1V4E A;  1HXG A;  1HM4 A;  4FJQ A;  3N5J F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...