5IMIA

Crystal structure of s303a aspergillus terreus aristolochene synthase complexed with (1s,8s,9ar)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
306
structure length
306
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWAQTTLRYSVVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Aristolochene synthase
publication title Probing the Role of Active Site Water in the Sesquiterpene Cyclization Reaction Catalyzed by Aristolochene Synthase.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 127
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5imiA00
3KROA 5A0KA 3N46F 3ACYA 2E91A 3SDVA 2Q9YA 1WL1A 2FORA 3M9UA 5ILYA 4P0VA 5KSXF 1YYRA 5E8LA 4EA0A 4E9UA 5IKAA 1YYTA 5EAUA 1WY0A 3N49F 5IMIA 4GAXA 4LTVA 3LZ9A 3PYAA 4KPDA 3UCAA 3LDWA 5DJPF 4LA6A 2H8OA 5ERMA 5HN8A 3NPKA 3WCHA 1V4KA 3G4DA 1V4IA 3N45F 2EWGA 3KRFA 2Z4WA 3P41A 5DGSF 5ER8A 3S9VA 2Z4YA 5JV2F 2J5CA 3N6KF 3TC1A 5DHIA 1WL3A 2ZEVA 4MC0A 3N5HF 2E90A 1KIYA 1HM7A 4LXWA 5IKHA 3VJBA 3N1WF 4LFVF 5E8HA 2AETA 4JXYA 3TFPA 1YQ7A 3NF2A 5DIQF 4LIXA 3ICMA 2OPNA 5EROA 3LK5A 2PS6A 3WSAA 4XQRF 3KRAA 4E1EA 2Z50A 5JA0F 3CP6A 3LJIA 4EA1A 2E8VA 2FTZA 4NKEA 3ICKA 4KKMA 4P0WA 5JV0F 1YYUA 1ZW5A 3WEHA 3OACB 4KWDA 4E9ZA 2E8TA 5C05A 4UMJA 2QISA 2Z4VA 3SDUA 5A0IA 2E8UA 2O1OA 4DZWA 3OABB 3VJAA 3B7LA 3V1XA 1VG3A 4OMHA 3ACXA 4OGUA 4QPFA 2OPMA 3WCJA 3APZA 4KVYA 1UBVA 5B0JA 2E93A 4DXJA 5ILJA 5DJRF 2ZEUA 3RYEA 2E92A 5CG6A 2AEKA 2Z7HA 5AFXA 3VJCA 3TFVA 5DHKA 4LOBA 4DHDA 3P5PA 3Q30A 2DH4A 4KPJA 3KBKA 5ILKA 3AQ0A 4NFJF 1WL0A 3G4FA 3LSNA 5EASA 3V1VA 5DGMF 3VJ9A 4KQ5A 3WJNA 4XQSF 2ZY1A 1N1ZA 3KRCB 4N1ZF 2J1OA 1WKZA 4JVJF 1RQIA 1V4HA 3EFQA 3ZCDA 1UBWA 3LGZB 4DI5A 1HM4A 4JZBA 5HN9A 1DI1A 3M01A 3LMDA 1V4EA 5AHUB 5AELA 3Q2ZA 4LPHF 2AELA 1DGPA 5B02A 2Z4XA 1N23A 4KVIA 3DYHA 3P8LA 4LLTA 5B00A 4LA5A 1WMWA 4PVYF 3CC9A 3ID0A 3WEIA 4RXEA 4ZQ8A 5B0KA 4JZXA 3VJEA 2ZCSA 3N3DA 3WCDA 5DJVF 1KIZA 3PH7A 3ASXA 5B0LA 3IBAA 1YV5A 3ZMCA 3LEEA 4LPGF 1YYSA 2AZJA 3AQBB 1N24A 4FP4A 3M02A 3WE9A 2PS4A 1UBYA 4H5EF 3AE0A 3PKOA 3WCIA 3TFNA 4KQUA 4LFGA 5ILZA 2F7MF 1VG7A 4LZ3A 2Q80A 3SDRA 2RAHA 1N20A 5B0MA 3WSBA 4LZ0A 1YJ4A 4K10A 1VG2A 4DWBA 1YHMA 4MC8A 3IPIA 3EGTA 2E8WA 3PYBA 3MAVA 1JFAA 3N0FA 4WK5A 4Q23A 1PS1A 1N1BA 4KK2A 4PVXF 2ZCRA 3WEKA 3N5JF 2J1PA 2F89F 4NG6A 3KRPB 3VJ8A 3AQCB 3KROB 3NRIA 1N21A 2Q9ZA 5HNAA 3OACA 4LFEA 5IL8A 5DGNF 1RTRA 3WEJA 3P5RA 5JV1F 2Z78A 3ICZA 2Z4ZA 4LUUA 3LLWA 4NFIF 2I19A 5B0IA 4H5CF 2ONHA 3WCBA 3OABA 3WCGA 2OGDA 3N1VF 5DW7A 2E95A 5AYPA 3V66A 2ZCOA 5IM1A 2PS7A 3CKEA 4F62A 5B03A 1WL2A 3KRPA 3SAEA 1FPSA 1YHKA 4RXAA 1HXAA 2F8CF 4FJQA 5IMPA 3M00A 2P1CA 2ZCQA 5I1UA 3KRFB 3WCCA 5JUZF 3RMGA 5ILDA 5EATA 2Z7IA 2ONGA 3WCEA 3WC9A 3M0GA 4NKFA 3WEGA 3KRCA 3ZOUA 2VF6A 4NUAA 1N22A 4OKMA 3ZL6A 3VJDA 5ILHA 1UBXA 1HXGA 3ZMBA 4RXDA 2Q58A 2PS8A 3BNYA 4OMGA 4P0XA 5IK0A 5CG5A 3WEFA 2E4OA 2F94F 5IL3A 3KRAB 2F8ZF 1RQJA 4RYPA 3LOMA 1YYQA 1HX9A 4JYXA 1YHLA 5IK6A 4HD1A 2AZLA 4XQTF 3DYGA 4KQSA 4L2XF 1V4JA 2PS5A 3N3LF 4EA2A 2E94A 2OA6A 5IN8A 2AZKA 4KVWA 3QQVA 1EZFA 4F6VA 5IMNA 5E8KA 3NPRA 3S4JA 3WCMA 4LTZA 3W7FA 4H5DF 4DWGA 4GP1A 4GP2A 1HXCA 3OYRA 3TS7A 3QKCA 1JFGA 5H9DA 3RYWA 4GA3A 2F92F 4KVDA 4RNQA 3WCAA 2Z52A 3MZVA 3WCLA 2E8XA 3WJKA 3ACWA 1VG6A 3LG5A 4KUXA 5B01A 4KFAA 4MC3A 3Q1OA 5HN7A 3N0GA 4F6XA 4DEMF 3SDTA 3KB9A 4OKZA 3LGKA 3LVSA 3ADZA 3SDQA 5ILIA 3Q2QA 3ICNA 4JXNA 5A0JA 5IK9A 3PDEA 4RXCA 3DYFA 5IVGA 4NFKF 3EZ3A 1VG4A 3WJOA 3WCFA 4LZCA 4QXSF 3BNXA 5ERNA 3RBMA 4N9UA 4LLSA 5DZ2A 2F9KF 3P8RA
chains in the Genus database with same CATH superfamily
3KROA 5A0KA 3N46F 3ACYA 2E91A 3SDVA 2Q9YA 1WL1A 2FORA 3M9UA 5ILYA 4P0VA 5KSXF 1YYRA 5E8LA 4EA0A 4E9UA 5IKAA 1YYTA 5EAUA 1WY0A 3N49F 5IMIA 4GAXA 4LTVA 3LZ9A 3PYAA 4KPDA 3UCAA 3LDWA 5DJPF 4LA6A 2H8OA 5ERMA 5HN8A 3NPKA 3WCHA 1V4KA 3G4DA 1V4IA 3N45F 2EWGA 3KRFA 2Z4WA 3P41A 5DGSF 5ER8A 3S9VA 2Z4YA 5JV2F 2J5CA 3N6KF 3TC1A 5DHIA 1WL3A 2ZEVA 4MC0A 3N5HF 2E90A 1KIYA 1HM7A 4LXWA 5IKHA 3VJBA 3N1WF 4LFVF 5E8HA 2AETA 4JXYA 3TFPA 1YQ7A 3NF2A 5DIQF 4LIXA 3ICMA 2OPNA 5EROA 3LK5A 2PS6A 3WSAA 4XQRF 3KRAA 4E1EA 2Z50A 5JA0F 3CP6A 3LJIA 4EA1A 2E8VA 2FTZA 4NKEA 3ICKA 4KKMA 4P0WA 5JV0F 1YYUA 1ZW5A 3WEHA 3OACB 4KWDA 4E9ZA 2E8TA 5C05A 4UMJA 2QISA 2Z4VA 3SDUA 5A0IA 2E8UA 2O1OA 4DZWA 3OABB 3VJAA 3B7LA 3V1XA 1VG3A 4OMHA 3ACXA 4OGUA 4QPFA 2OPMA 3WCJA 3APZA 4KVYA 1UBVA 5B0JA 2E93A 4DXJA 5ILJA 5DJRF 2ZEUA 3RYEA 2E92A 5CG6A 2AEKA 2Z7HA 5AFXA 3VJCA 3TFVA 5DHKA 4LOBA 4DHDA 3P5PA 3Q30A 2DH4A 4KPJA 3KBKA 5ILKA 3AQ0A 4NFJF 1WL0A 3G4FA 3LSNA 5EASA 3V1VA 5DGMF 3VJ9A 4KQ5A 3WJNA 4XQSF 2ZY1A 1N1ZA 3KRCB 4N1ZF 2J1OA 1WKZA 4JVJF 1RQIA 1V4HA 3EFQA 3ZCDA 1UBWA 3LGZB 4DI5A 1HM4A 4JZBA 5HN9A 1DI1A 3M01A 3LMDA 1V4EA 5AHUB 5AELA 3Q2ZA 4LPHF 2AELA 1DGPA 5B02A 2Z4XA 1N23A 4KVIA 3DYHA 3P8LA 4LLTA 5B00A 4LA5A 1WMWA 4PVYF 3CC9A 3ID0A 3WEIA 4RXEA 4ZQ8A 5B0KA 4JZXA 3VJEA 2ZCSA 3N3DA 3WCDA 5DJVF 1KIZA 3PH7A 3ASXA 5B0LA 3IBAA 1YV5A 3ZMCA 3LEEA 4LPGF 1YYSA 2AZJA 3AQBB 1N24A 4FP4A 3M02A 3WE9A 2PS4A 1UBYA 4H5EF 3AE0A 3PKOA 3WCIA 3TFNA 4KQUA 4LFGA 5ILZA 2F7MF 1VG7A 4LZ3A 2Q80A 3SDRA 2RAHA 1N20A 5B0MA 3WSBA 4LZ0A 1YJ4A 4K10A 1VG2A 4DWBA 1YHMA 4MC8A 3IPIA 3EGTA 2E8WA 3PYBA 3MAVA 1JFAA 3N0FA 4WK5A 4Q23A 1PS1A 1N1BA 4KK2A 4PVXF 2ZCRA 3WEKA 3N5JF 2J1PA 2F89F 4NG6A 3KRPB 3VJ8A 3AQCB 3KROB 3NRIA 1N21A 2Q9ZA 5HNAA 3OACA 4LFEA 5IL8A 5DGNF 1RTRA 3WEJA 3P5RA 5JV1F 2Z78A 3ICZA 2Z4ZA 4LUUA 3LLWA 4NFIF 2I19A 5B0IA 4H5CF 2ONHA 3WCBA 3OABA 3WCGA 2OGDA 3N1VF 5DW7A 2E95A 5AYPA 3V66A 2ZCOA 5IM1A 2PS7A 3CKEA 4F62A 5B03A 1WL2A 3KRPA 3SAEA 1FPSA 1YHKA 4RXAA 1HXAA 2F8CF 4FJQA 5IMPA 3M00A 2P1CA 2ZCQA 5I1UA 3KRFB 3WCCA 5JUZF 3RMGA 5ILDA 5EATA 2Z7IA 2ONGA 3WCEA 3WC9A 3M0GA 4NKFA 3WEGA 3KRCA 3ZOUA 2VF6A 4NUAA 1N22A 4OKMA 3ZL6A 3VJDA 5ILHA 1UBXA 1HXGA 3ZMBA 4RXDA 2Q58A 2PS8A 3BNYA 4OMGA 4P0XA 5IK0A 5CG5A 3WEFA 2E4OA 2F94F 5IL3A 3KRAB 2F8ZF 1RQJA 4RYPA 3LOMA 1YYQA 1HX9A 4JYXA 1YHLA 5IK6A 4HD1A 2AZLA 4XQTF 3DYGA 4KQSA 4L2XF 1V4JA 2PS5A 3N3LF 4EA2A 2E94A 2OA6A 5IN8A 2AZKA 4KVWA 3QQVA 1EZFA 4F6VA 5IMNA 5E8KA 3NPRA 3S4JA 3WCMA 4LTZA 3W7FA 4H5DF 4DWGA 4GP1A 4GP2A 1HXCA 3OYRA 3TS7A 3QKCA 1JFGA 5H9DA 3RYWA 4GA3A 2F92F 4KVDA 4RNQA 3WCAA 2Z52A 3MZVA 3WCLA 2E8XA 3WJKA 3ACWA 1VG6A 3LG5A 4KUXA 5B01A 4KFAA 4MC3A 3Q1OA 5HN7A 3N0GA 4F6XA 4DEMF 3SDTA 3KB9A 4OKZA 3LGKA 3LVSA 3ADZA 3SDQA 5ILIA 3Q2QA 3ICNA 4JXNA 5A0JA 5IK9A 3PDEA 4RXCA 3DYFA 5IVGA 4NFKF 3EZ3A 1VG4A 3WJOA 3WCFA 4LZCA 4QXSF 3BNXA 5ERNA 3RBMA 4N9UA 4LLSA 5DZ2A 2F9KF 3P8RA
chains in the Genus database with same CATH topology
3KROA 5A0KA 3N46F 3ACYA 2E91A 3SDVA 2Q9YA 1WL1A 2FORA 3M9UA 5ILYA 4P0VA 5KSXF 1YYRA 5E8LA 4EA0A 4E9UA 5IKAA 1YYTA 5EAUA 1WY0A 3N49F 5IMIA 4GAXA 4LTVA 3LZ9A 3PYAA 4KPDA 3UCAA 3LDWA 5DJPF 4LA6A 2H8OA 5ERMA 5HN8A 3NPKA 3WCHA 1V4KA 3G4DA 1V4IA 3N45F 2EWGA 3KRFA 2Z4WA 3P41A 5DGSF 5ER8A 3S9VA 2Z4YA 5JV2F 2J5CA 3N6KF 3TC1A 5DHIA 1WL3A 2ZEVA 4MC0A 3N5HF 2E90A 1KIYA 1HM7A 4LXWA 5IKHA 3VJBA 3N1WF 4LFVF 5E8HA 2AETA 4JXYA 3TFPA 1YQ7A 3NF2A 5DIQF 4LIXA 3ICMA 2OPNA 5EROA 3LK5A 2PS6A 3WSAA 4XQRF 3KRAA 4E1EA 2Z50A 5JA0F 3CP6A 3LJIA 4EA1A 2E8VA 2FTZA 4NKEA 3ICKA 4KKMA 4P0WA 5JV0F 1YYUA 1ZW5A 3WEHA 3OACB 4KWDA 4E9ZA 2E8TA 5C05A 4UMJA 2QISA 2Z4VA 3SDUA 5A0IA 2E8UA 2O1OA 4DZWA 3OABB 3VJAA 3B7LA 3V1XA 1VG3A 4OMHA 3ACXA 4OGUA 4QPFA 2OPMA 3WCJA 3APZA 4KVYA 1UBVA 5B0JA 2E93A 4DXJA 5ILJA 5DJRF 2ZEUA 3RYEA 2E92A 5CG6A 2AEKA 2Z7HA 5AFXA 3VJCA 3TFVA 5DHKA 4LOBA 4DHDA 3P5PA 3Q30A 2DH4A 4KPJA 3KBKA 5ILKA 3AQ0A 4NFJF 1WL0A 3G4FA 3LSNA 5EASA 3V1VA 5DGMF 3VJ9A 4KQ5A 3WJNA 4XQSF 2ZY1A 1N1ZA 3KRCB 4N1ZF 2J1OA 1WKZA 4JVJF 1RQIA 1V4HA 3EFQA 3ZCDA 1UBWA 3LGZB 4DI5A 1HM4A 4JZBA 5HN9A 1DI1A 3M01A 3LMDA 1V4EA 5AHUB 5AELA 3Q2ZA 4LPHF 2AELA 1DGPA 5B02A 2Z4XA 1N23A 4KVIA 3DYHA 3P8LA 4LLTA 5B00A 4LA5A 1WMWA 4PVYF 3CC9A 3ID0A 3WEIA 4RXEA 4ZQ8A 5B0KA 4JZXA 3VJEA 2ZCSA 3N3DA 3WCDA 5DJVF 1KIZA 3PH7A 3ASXA 5B0LA 3IBAA 1YV5A 3ZMCA 3LEEA 4LPGF 1YYSA 2AZJA 3AQBB 1N24A 4FP4A 3M02A 3WE9A 2PS4A 1UBYA 4H5EF 3AE0A 3PKOA 3WCIA 3TFNA 4KQUA 4LFGA 5ILZA 2F7MF 1VG7A 4LZ3A 2Q80A 3SDRA 2RAHA 1N20A 5B0MA 3WSBA 4LZ0A 1YJ4A 4K10A 1VG2A 4DWBA 1YHMA 4MC8A 3IPIA 3EGTA 2E8WA 3PYBA 3MAVA 1JFAA 3N0FA 4WK5A 4Q23A 1PS1A 1N1BA 4KK2A 4PVXF 2ZCRA 3WEKA 3N5JF 2J1PA 2F89F 4NG6A 3KRPB 3VJ8A 3AQCB 3KROB 3NRIA 1N21A 2Q9ZA 5HNAA 3OACA 4LFEA 5IL8A 5DGNF 1RTRA 3WEJA 3P5RA 5JV1F 2Z78A 3ICZA 2Z4ZA 4LUUA 3LLWA 4NFIF 2I19A 5B0IA 4H5CF 2ONHA 3WCBA 3OABA 3WCGA 2OGDA 3N1VF 5DW7A 2E95A 5AYPA 3V66A 2ZCOA 5IM1A 2PS7A 3CKEA 4F62A 5B03A 1WL2A 3KRPA 3SAEA 1FPSA 1YHKA 4RXAA 1HXAA 2F8CF 4FJQA 5IMPA 3M00A 2P1CA 2ZCQA 5I1UA 3KRFB 3WCCA 5JUZF 3RMGA 5ILDA 5EATA 2Z7IA 2ONGA 3WCEA 3WC9A 3M0GA 4NKFA 3WEGA 3KRCA 3ZOUA 2VF6A 4NUAA 1N22A 4OKMA 3ZL6A 3VJDA 5ILHA 1UBXA 1HXGA 3ZMBA 4RXDA 2Q58A 2PS8A 3BNYA 4OMGA 4P0XA 5IK0A 5CG5A 3WEFA 2E4OA 2F94F 5IL3A 3KRAB 2F8ZF 1RQJA 4RYPA 3LOMA 1YYQA 1HX9A 4JYXA 1YHLA 5IK6A 4HD1A 2AZLA 4XQTF 3DYGA 4KQSA 4L2XF 1V4JA 2PS5A 3N3LF 4EA2A 2E94A 2OA6A 5IN8A 2AZKA 4KVWA 3QQVA 1EZFA 4F6VA 5IMNA 5E8KA 3NPRA 3S4JA 3WCMA 4LTZA 3W7FA 4H5DF 4DWGA 4GP1A 4GP2A 1HXCA 3OYRA 3TS7A 3QKCA 1JFGA 5H9DA 3RYWA 4GA3A 2F92F 4KVDA 4RNQA 3WCAA 2Z52A 3MZVA 3WCLA 2E8XA 3WJKA 3ACWA 1VG6A 3LG5A 4KUXA 5B01A 4KFAA 4MC3A 3Q1OA 5HN7A 3N0GA 4F6XA 4DEMF 3SDTA 3KB9A 4OKZA 3LGKA 3LVSA 3ADZA 3SDQA 5ILIA 3Q2QA 3ICNA 4JXNA 5A0JA 5IK9A 3PDEA 4RXCA 3DYFA 5IVGA 4NFKF 3EZ3A 1VG4A 3WJOA 3WCFA 4LZCA 4QXSF 3BNXA 5ERNA 3RBMA 4N9UA 4LLSA 5DZ2A 2F9KF 3P8RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRO A;  5A0K A;  3N46 F;  3ACY A;  2E91 A;  3SDV A;  2Q9Y A;  1WL1 A;  2FOR A;  3M9U A;  5ILY A;  4P0V A;  5KSX F;  1YYR A;  5E8L A;  4EA0 A;  4E9U A;  5IKA A;  1YYT A;  5EAU A;  1WY0 A;  3N49 F;  5IMI A;  4GAX A;  4LTV A;  3LZ9 A;  3PYA A;  4KPD A;  3UCA A;  3LDW A;  5DJP F;  4LA6 A;  2H8O A;  5ERM A;  5HN8 A;  3NPK A;  3WCH A;  1V4K A;  3G4D A;  1V4I A;  3N45 F;  2EWG A;  3KRF A;  2Z4W A;  3P41 A;  5DGS F;  5ER8 A;  3S9V A;  2Z4Y A;  5JV2 F;  2J5C A;  3N6K F;  3TC1 A;  5DHI A;  1WL3 A;  2ZEV A;  4MC0 A;  3N5H F;  2E90 A;  1KIY A;  1HM7 A;  4LXW A;  5IKH A;  3VJB A;  3N1W F;  4LFV F;  5E8H A;  2AET A;  4JXY A;  3TFP A;  1YQ7 A;  3NF2 A;  5DIQ F;  4LIX A;  3ICM A;  2OPN A;  5ERO A;  3LK5 A;  2PS6 A;  3WSA A;  4XQR F;  3KRA A;  4E1E A;  2Z50 A;  5JA0 F;  3CP6 A;  3LJI A;  4EA1 A;  2E8V A;  2FTZ A;  4NKE A;  3ICK A;  4KKM A;  4P0W A;  5JV0 F;  1YYU A;  1ZW5 A;  3WEH A;  3OAC B;  4KWD A;  4E9Z A;  2E8T A;  5C05 A;  4UMJ A;  2QIS A;  2Z4V A;  3SDU A;  5A0I A;  2E8U A;  2O1O A;  4DZW A;  3OAB B;  3VJA A;  3B7L A;  3V1X A;  1VG3 A;  4OMH A;  3ACX A;  4OGU A;  4QPF A;  2OPM A;  3WCJ A;  3APZ A;  4KVY A;  1UBV A;  5B0J A;  2E93 A;  4DXJ A;  5ILJ A;  5DJR F;  2ZEU A;  3RYE A;  2E92 A;  5CG6 A;  2AEK A;  2Z7H A;  5AFX A;  3VJC A;  3TFV A;  5DHK A;  4LOB A;  4DHD A;  3P5P A;  3Q30 A;  2DH4 A;  4KPJ A;  3KBK A;  5ILK A;  3AQ0 A;  4NFJ F;  1WL0 A;  3G4F A;  3LSN A;  5EAS A;  3V1V A;  5DGM F;  3VJ9 A;  4KQ5 A;  3WJN A;  4XQS F;  2ZY1 A;  1N1Z A;  3KRC B;  4N1Z F;  2J1O A;  1WKZ A;  4JVJ F;  1RQI A;  1V4H A;  3EFQ A;  3ZCD A;  1UBW A;  3LGZ B;  4DI5 A;  1HM4 A;  4JZB A;  5HN9 A;  1DI1 A;  3M01 A;  3LMD A;  1V4E A;  5AHU B;  5AEL A;  3Q2Z A;  4LPH F;  2AEL A;  1DGP A;  5B02 A;  2Z4X A;  1N23 A;  4KVI A;  3DYH A;  3P8L A;  4LLT A;  5B00 A;  4LA5 A;  1WMW A;  4PVY F;  3CC9 A;  3ID0 A;  3WEI A;  4RXE A;  4ZQ8 A;  5B0K A;  4JZX A;  3VJE A;  2ZCS A;  3N3D A;  3WCD A;  5DJV F;  1KIZ A;  3PH7 A;  3ASX A;  5B0L A;  3IBA A;  1YV5 A;  3ZMC A;  3LEE A;  4LPG F;  1YYS A;  2AZJ A;  3AQB B;  1N24 A;  4FP4 A;  3M02 A;  3WE9 A;  2PS4 A;  1UBY A;  4H5E F;  3AE0 A;  3PKO A;  3WCI A;  3TFN A;  4KQU A;  4LFG A;  5ILZ A;  2F7M F;  1VG7 A;  4LZ3 A;  2Q80 A;  3SDR A;  2RAH A;  1N20 A;  5B0M A;  3WSB A;  4LZ0 A;  1YJ4 A;  4K10 A;  1VG2 A;  4DWB A;  1YHM A;  4MC8 A;  3IPI A;  3EGT A;  2E8W A;  3PYB A;  3MAV A;  1JFA A;  3N0F A;  4WK5 A;  4Q23 A;  1PS1 A;  1N1B A;  4KK2 A;  4PVX F;  2ZCR A;  3WEK A;  3N5J F;  2J1P A;  2F89 F;  4NG6 A;  3KRP B;  3VJ8 A;  3AQC B;  3KRO B;  3NRI A;  1N21 A;  2Q9Z A;  5HNA A;  3OAC A;  4LFE A;  5IL8 A;  5DGN F;  1RTR A;  3WEJ A;  3P5R A;  5JV1 F;  2Z78 A;  3ICZ A;  2Z4Z A;  4LUU A;  3LLW A;  4NFI F;  2I19 A;  5B0I A;  4H5C F;  2ONH A;  3WCB A;  3OAB A;  3WCG A;  2OGD A;  3N1V F;  5DW7 A;  2E95 A;  5AYP A;  3V66 A;  2ZCO A;  5IM1 A;  2PS7 A;  3CKE A;  4F62 A;  5B03 A;  1WL2 A;  3KRP A;  3SAE A;  1FPS A;  1YHK A;  4RXA A;  1HXA A;  2F8C F;  4FJQ A;  5IMP A;  3M00 A;  2P1C A;  2ZCQ A;  5I1U A;  3KRF B;  3WCC A;  5JUZ F;  3RMG A;  5ILD A;  5EAT A;  2Z7I A;  2ONG A;  3WCE A;  3WC9 A;  3M0G A;  4NKF A;  3WEG A;  3KRC A;  3ZOU A;  2VF6 A;  4NUA A;  1N22 A;  4OKM A;  3ZL6 A;  3VJD A;  5ILH A;  1UBX A;  1HXG A;  3ZMB A;  4RXD A;  2Q58 A;  2PS8 A;  3BNY A;  4OMG A;  4P0X A;  5IK0 A;  5CG5 A;  3WEF A;  2E4O A;  2F94 F;  5IL3 A;  3KRA B;  2F8Z F;  1RQJ A;  4RYP A;  3LOM A;  1YYQ A;  1HX9 A;  4JYX A;  1YHL A;  5IK6 A;  4HD1 A;  2AZL A;  4XQT F;  3DYG A;  4KQS A;  4L2X F;  1V4J A;  2PS5 A;  3N3L F;  4EA2 A;  2E94 A;  2OA6 A;  5IN8 A;  2AZK A;  4KVW A;  3QQV A;  1EZF A;  4F6V A;  5IMN A;  5E8K A;  3NPR A;  3S4J A;  3WCM A;  4LTZ A;  3W7F A;  4H5D F;  4DWG A;  4GP1 A;  4GP2 A;  1HXC A;  3OYR A;  3TS7 A;  3QKC A;  1JFG A;  5H9D A;  3RYW A;  4GA3 A;  2F92 F;  4KVD A;  4RNQ A;  3WCA A;  2Z52 A;  3MZV A;  3WCL A;  2E8X A;  3WJK A;  3ACW A;  1VG6 A;  3LG5 A;  4KUX A;  5B01 A;  4KFA A;  4MC3 A;  3Q1O A;  5HN7 A;  3N0G A;  4F6X A;  4DEM F;  3SDT A;  3KB9 A;  4OKZ A;  3LGK A;  3LVS A;  3ADZ A;  3SDQ A;  5ILI A;  3Q2Q A;  3ICN A;  4JXN A;  5A0J A;  5IK9 A;  3PDE A;  4RXC A;  3DYF A;  5IVG A;  4NFK F;  3EZ3 A;  1VG4 A;  3WJO A;  3WCF A;  4LZC A;  4QXS F;  3BNX A;  5ERN A;  3RBM A;  4N9U A;  4LLS A;  5DZ2 A;  2F9K F;  3P8R A; 
#chains in the Genus database with same CATH topology
 3KRO A;  5A0K A;  3N46 F;  3ACY A;  2E91 A;  3SDV A;  2Q9Y A;  1WL1 A;  2FOR A;  3M9U A;  5ILY A;  4P0V A;  5KSX F;  1YYR A;  5E8L A;  4EA0 A;  4E9U A;  5IKA A;  1YYT A;  5EAU A;  1WY0 A;  3N49 F;  5IMI A;  4GAX A;  4LTV A;  3LZ9 A;  3PYA A;  4KPD A;  3UCA A;  3LDW A;  5DJP F;  4LA6 A;  2H8O A;  5ERM A;  5HN8 A;  3NPK A;  3WCH A;  1V4K A;  3G4D A;  1V4I A;  3N45 F;  2EWG A;  3KRF A;  2Z4W A;  3P41 A;  5DGS F;  5ER8 A;  3S9V A;  2Z4Y A;  5JV2 F;  2J5C A;  3N6K F;  3TC1 A;  5DHI A;  1WL3 A;  2ZEV A;  4MC0 A;  3N5H F;  2E90 A;  1KIY A;  1HM7 A;  4LXW A;  5IKH A;  3VJB A;  3N1W F;  4LFV F;  5E8H A;  2AET A;  4JXY A;  3TFP A;  1YQ7 A;  3NF2 A;  5DIQ F;  4LIX A;  3ICM A;  2OPN A;  5ERO A;  3LK5 A;  2PS6 A;  3WSA A;  4XQR F;  3KRA A;  4E1E A;  2Z50 A;  5JA0 F;  3CP6 A;  3LJI A;  4EA1 A;  2E8V A;  2FTZ A;  4NKE A;  3ICK A;  4KKM A;  4P0W A;  5JV0 F;  1YYU A;  1ZW5 A;  3WEH A;  3OAC B;  4KWD A;  4E9Z A;  2E8T A;  5C05 A;  4UMJ A;  2QIS A;  2Z4V A;  3SDU A;  5A0I A;  2E8U A;  2O1O A;  4DZW A;  3OAB B;  3VJA A;  3B7L A;  3V1X A;  1VG3 A;  4OMH A;  3ACX A;  4OGU A;  4QPF A;  2OPM A;  3WCJ A;  3APZ A;  4KVY A;  1UBV A;  5B0J A;  2E93 A;  4DXJ A;  5ILJ A;  5DJR F;  2ZEU A;  3RYE A;  2E92 A;  5CG6 A;  2AEK A;  2Z7H A;  5AFX A;  3VJC A;  3TFV A;  5DHK A;  4LOB A;  4DHD A;  3P5P A;  3Q30 A;  2DH4 A;  4KPJ A;  3KBK A;  5ILK A;  3AQ0 A;  4NFJ F;  1WL0 A;  3G4F A;  3LSN A;  5EAS A;  3V1V A;  5DGM F;  3VJ9 A;  4KQ5 A;  3WJN A;  4XQS F;  2ZY1 A;  1N1Z A;  3KRC B;  4N1Z F;  2J1O A;  1WKZ A;  4JVJ F;  1RQI A;  1V4H A;  3EFQ A;  3ZCD A;  1UBW A;  3LGZ B;  4DI5 A;  1HM4 A;  4JZB A;  5HN9 A;  1DI1 A;  3M01 A;  3LMD A;  1V4E A;  5AHU B;  5AEL A;  3Q2Z A;  4LPH F;  2AEL A;  1DGP A;  5B02 A;  2Z4X A;  1N23 A;  4KVI A;  3DYH A;  3P8L A;  4LLT A;  5B00 A;  4LA5 A;  1WMW A;  4PVY F;  3CC9 A;  3ID0 A;  3WEI A;  4RXE A;  4ZQ8 A;  5B0K A;  4JZX A;  3VJE A;  2ZCS A;  3N3D A;  3WCD A;  5DJV F;  1KIZ A;  3PH7 A;  3ASX A;  5B0L A;  3IBA A;  1YV5 A;  3ZMC A;  3LEE A;  4LPG F;  1YYS A;  2AZJ A;  3AQB B;  1N24 A;  4FP4 A;  3M02 A;  3WE9 A;  2PS4 A;  1UBY A;  4H5E F;  3AE0 A;  3PKO A;  3WCI A;  3TFN A;  4KQU A;  4LFG A;  5ILZ A;  2F7M F;  1VG7 A;  4LZ3 A;  2Q80 A;  3SDR A;  2RAH A;  1N20 A;  5B0M A;  3WSB A;  4LZ0 A;  1YJ4 A;  4K10 A;  1VG2 A;  4DWB A;  1YHM A;  4MC8 A;  3IPI A;  3EGT A;  2E8W A;  3PYB A;  3MAV A;  1JFA A;  3N0F A;  4WK5 A;  4Q23 A;  1PS1 A;  1N1B A;  4KK2 A;  4PVX F;  2ZCR A;  3WEK A;  3N5J F;  2J1P A;  2F89 F;  4NG6 A;  3KRP B;  3VJ8 A;  3AQC B;  3KRO B;  3NRI A;  1N21 A;  2Q9Z A;  5HNA A;  3OAC A;  4LFE A;  5IL8 A;  5DGN F;  1RTR A;  3WEJ A;  3P5R A;  5JV1 F;  2Z78 A;  3ICZ A;  2Z4Z A;  4LUU A;  3LLW A;  4NFI F;  2I19 A;  5B0I A;  4H5C F;  2ONH A;  3WCB A;  3OAB A;  3WCG A;  2OGD A;  3N1V F;  5DW7 A;  2E95 A;  5AYP A;  3V66 A;  2ZCO A;  5IM1 A;  2PS7 A;  3CKE A;  4F62 A;  5B03 A;  1WL2 A;  3KRP A;  3SAE A;  1FPS A;  1YHK A;  4RXA A;  1HXA A;  2F8C F;  4FJQ A;  5IMP A;  3M00 A;  2P1C A;  2ZCQ A;  5I1U A;  3KRF B;  3WCC A;  5JUZ F;  3RMG A;  5ILD A;  5EAT A;  2Z7I A;  2ONG A;  3WCE A;  3WC9 A;  3M0G A;  4NKF A;  3WEG A;  3KRC A;  3ZOU A;  2VF6 A;  4NUA A;  1N22 A;  4OKM A;  3ZL6 A;  3VJD A;  5ILH A;  1UBX A;  1HXG A;  3ZMB A;  4RXD A;  2Q58 A;  2PS8 A;  3BNY A;  4OMG A;  4P0X A;  5IK0 A;  5CG5 A;  3WEF A;  2E4O A;  2F94 F;  5IL3 A;  3KRA B;  2F8Z F;  1RQJ A;  4RYP A;  3LOM A;  1YYQ A;  1HX9 A;  4JYX A;  1YHL A;  5IK6 A;  4HD1 A;  2AZL A;  4XQT F;  3DYG A;  4KQS A;  4L2X F;  1V4J A;  2PS5 A;  3N3L F;  4EA2 A;  2E94 A;  2OA6 A;  5IN8 A;  2AZK A;  4KVW A;  3QQV A;  1EZF A;  4F6V A;  5IMN A;  5E8K A;  3NPR A;  3S4J A;  3WCM A;  4LTZ A;  3W7F A;  4H5D F;  4DWG A;  4GP1 A;  4GP2 A;  1HXC A;  3OYR A;  3TS7 A;  3QKC A;  1JFG A;  5H9D A;  3RYW A;  4GA3 A;  2F92 F;  4KVD A;  4RNQ A;  3WCA A;  2Z52 A;  3MZV A;  3WCL A;  2E8X A;  3WJK A;  3ACW A;  1VG6 A;  3LG5 A;  4KUX A;  5B01 A;  4KFA A;  4MC3 A;  3Q1O A;  5HN7 A;  3N0G A;  4F6X A;  4DEM F;  3SDT A;  3KB9 A;  4OKZ A;  3LGK A;  3LVS A;  3ADZ A;  3SDQ A;  5ILI A;  3Q2Q A;  3ICN A;  4JXN A;  5A0J A;  5IK9 A;  3PDE A;  4RXC A;  3DYF A;  5IVG A;  4NFK F;  3EZ3 A;  1VG4 A;  3WJO A;  3WCF A;  4LZC A;  4QXS F;  3BNX A;  5ERN A;  3RBM A;  4N9U A;  4LLS A;  5DZ2 A;  2F9K F;  3P8R A; 
#chains in the Genus database with same CATH homology
 3KRO A;  5A0K A;  3N46 F;  3ACY A;  2E91 A;  3SDV A;  2Q9Y A;  1WL1 A;  2FOR A;  3M9U A;  5ILY A;  4P0V A;  5KSX F;  1YYR A;  5E8L A;  4EA0 A;  4E9U A;  5IKA A;  1YYT A;  5EAU A;  1WY0 A;  3N49 F;  5IMI A;  4GAX A;  4LTV A;  3LZ9 A;  3PYA A;  4KPD A;  3UCA A;  3LDW A;  5DJP F;  4LA6 A;  2H8O A;  5ERM A;  5HN8 A;  3NPK A;  3WCH A;  1V4K A;  3G4D A;  1V4I A;  3N45 F;  2EWG A;  3KRF A;  2Z4W A;  3P41 A;  5DGS F;  5ER8 A;  3S9V A;  2Z4Y A;  5JV2 F;  2J5C A;  3N6K F;  3TC1 A;  5DHI A;  1WL3 A;  2ZEV A;  4MC0 A;  3N5H F;  2E90 A;  1KIY A;  1HM7 A;  4LXW A;  5IKH A;  3VJB A;  3N1W F;  4LFV F;  5E8H A;  2AET A;  4JXY A;  3TFP A;  1YQ7 A;  3NF2 A;  5DIQ F;  4LIX A;  3ICM A;  2OPN A;  5ERO A;  3LK5 A;  2PS6 A;  3WSA A;  4XQR F;  3KRA A;  4E1E A;  2Z50 A;  5JA0 F;  3CP6 A;  3LJI A;  4EA1 A;  2E8V A;  2FTZ A;  4NKE A;  3ICK A;  4KKM A;  4P0W A;  5JV0 F;  1YYU A;  1ZW5 A;  3WEH A;  3OAC B;  4KWD A;  4E9Z A;  2E8T A;  5C05 A;  4UMJ A;  2QIS A;  2Z4V A;  3SDU A;  5A0I A;  2E8U A;  2O1O A;  4DZW A;  3OAB B;  3VJA A;  3B7L A;  3V1X A;  1VG3 A;  4OMH A;  3ACX A;  4OGU A;  4QPF A;  2OPM A;  3WCJ A;  3APZ A;  4KVY A;  1UBV A;  5B0J A;  2E93 A;  4DXJ A;  5ILJ A;  5DJR F;  2ZEU A;  3RYE A;  2E92 A;  5CG6 A;  2AEK A;  2Z7H A;  5AFX A;  3VJC A;  3TFV A;  5DHK A;  4LOB A;  4DHD A;  3P5P A;  3Q30 A;  2DH4 A;  4KPJ A;  3KBK A;  5ILK A;  3AQ0 A;  4NFJ F;  1WL0 A;  3G4F A;  3LSN A;  5EAS A;  3V1V A;  5DGM F;  3VJ9 A;  4KQ5 A;  3WJN A;  4XQS F;  2ZY1 A;  1N1Z A;  3KRC B;  4N1Z F;  2J1O A;  1WKZ A;  4JVJ F;  1RQI A;  1V4H A;  3EFQ A;  3ZCD A;  1UBW A;  3LGZ B;  4DI5 A;  1HM4 A;  4JZB A;  5HN9 A;  1DI1 A;  3M01 A;  3LMD A;  1V4E A;  5AHU B;  5AEL A;  3Q2Z A;  4LPH F;  2AEL A;  1DGP A;  5B02 A;  2Z4X A;  1N23 A;  4KVI A;  3DYH A;  3P8L A;  4LLT A;  5B00 A;  4LA5 A;  1WMW A;  4PVY F;  3CC9 A;  3ID0 A;  3WEI A;  4RXE A;  4ZQ8 A;  5B0K A;  4JZX A;  3VJE A;  2ZCS A;  3N3D A;  3WCD A;  5DJV F;  1KIZ A;  3PH7 A;  3ASX A;  5B0L A;  3IBA A;  1YV5 A;  3ZMC A;  3LEE A;  4LPG F;  1YYS A;  2AZJ A;  3AQB B;  1N24 A;  4FP4 A;  3M02 A;  3WE9 A;  2PS4 A;  1UBY A;  4H5E F;  3AE0 A;  3PKO A;  3WCI A;  3TFN A;  4KQU A;  4LFG A;  5ILZ A;  2F7M F;  1VG7 A;  4LZ3 A;  2Q80 A;  3SDR A;  2RAH A;  1N20 A;  5B0M A;  3WSB A;  4LZ0 A;  1YJ4 A;  4K10 A;  1VG2 A;  4DWB A;  1YHM A;  4MC8 A;  3IPI A;  3EGT A;  2E8W A;  3PYB A;  3MAV A;  1JFA A;  3N0F A;  4WK5 A;  4Q23 A;  1PS1 A;  1N1B A;  4KK2 A;  4PVX F;  2ZCR A;  3WEK A;  3N5J F;  2J1P A;  2F89 F;  4NG6 A;  3KRP B;  3VJ8 A;  3AQC B;  3KRO B;  3NRI A;  1N21 A;  2Q9Z A;  5HNA A;  3OAC A;  4LFE A;  5IL8 A;  5DGN F;  1RTR A;  3WEJ A;  3P5R A;  5JV1 F;  2Z78 A;  3ICZ A;  2Z4Z A;  4LUU A;  3LLW A;  4NFI F;  2I19 A;  5B0I A;  4H5C F;  2ONH A;  3WCB A;  3OAB A;  3WCG A;  2OGD A;  3N1V F;  5DW7 A;  2E95 A;  5AYP A;  3V66 A;  2ZCO A;  5IM1 A;  2PS7 A;  3CKE A;  4F62 A;  5B03 A;  1WL2 A;  3KRP A;  3SAE A;  1FPS A;  1YHK A;  4RXA A;  1HXA A;  2F8C F;  4FJQ A;  5IMP A;  3M00 A;  2P1C A;  2ZCQ A;  5I1U A;  3KRF B;  3WCC A;  5JUZ F;  3RMG A;  5ILD A;  5EAT A;  2Z7I A;  2ONG A;  3WCE A;  3WC9 A;  3M0G A;  4NKF A;  3WEG A;  3KRC A;  3ZOU A;  2VF6 A;  4NUA A;  1N22 A;  4OKM A;  3ZL6 A;  3VJD A;  5ILH A;  1UBX A;  1HXG A;  3ZMB A;  4RXD A;  2Q58 A;  2PS8 A;  3BNY A;  4OMG A;  4P0X A;  5IK0 A;  5CG5 A;  3WEF A;  2E4O A;  2F94 F;  5IL3 A;  3KRA B;  2F8Z F;  1RQJ A;  4RYP A;  3LOM A;  1YYQ A;  1HX9 A;  4JYX A;  1YHL A;  5IK6 A;  4HD1 A;  2AZL A;  4XQT F;  3DYG A;  4KQS A;  4L2X F;  1V4J A;  2PS5 A;  3N3L F;  4EA2 A;  2E94 A;  2OA6 A;  5IN8 A;  2AZK A;  4KVW A;  3QQV A;  1EZF A;  4F6V A;  5IMN A;  5E8K A;  3NPR A;  3S4J A;  3WCM A;  4LTZ A;  3W7F A;  4H5D F;  4DWG A;  4GP1 A;  4GP2 A;  1HXC A;  3OYR A;  3TS7 A;  3QKC A;  1JFG A;  5H9D A;  3RYW A;  4GA3 A;  2F92 F;  4KVD A;  4RNQ A;  3WCA A;  2Z52 A;  3MZV A;  3WCL A;  2E8X A;  3WJK A;  3ACW A;  1VG6 A;  3LG5 A;  4KUX A;  5B01 A;  4KFA A;  4MC3 A;  3Q1O A;  5HN7 A;  3N0G A;  4F6X A;  4DEM F;  3SDT A;  3KB9 A;  4OKZ A;  3LGK A;  3LVS A;  3ADZ A;  3SDQ A;  5ILI A;  3Q2Q A;  3ICN A;  4JXN A;  5A0J A;  5IK9 A;  3PDE A;  4RXC A;  3DYF A;  5IVG A;  4NFK F;  3EZ3 A;  1VG4 A;  3WJO A;  3WCF A;  4LZC A;  4QXS F;  3BNX A;  5ERN A;  3RBM A;  4N9U A;  4LLS A;  5DZ2 A;  2F9K F;  3P8R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...