5IN8A

Crystal structure of q151h aspergillus terreus aristolochene synthase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAHTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Aristolochene synthase
publication title Probing the Role of Active Site Water in the Sesquiterpene Cyclization Reaction Catalyzed by Aristolochene Synthase.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 130
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2016-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5in8A00
4L2XF 2F8CF 4KPDA 4FJQA 3V1VA 4DZWA 1YYQA 2PS7A 3NPRA 4PVYF 1ZW5A 3G4FA 4FP4A 3P41A 1V4EA 3N1WF 4F6VA 2Z4YA 2E90A 3KB9A 3PH7A 4UMJA 4P0WA 2H8OA 2Z4XA 3EGTA 2F94F 5EAUA 3PKOA 3ID0A 2VF6A 4N1ZF 4RXDA 2ONGA 3BNXA 4LPGF 5ILYA 5IMNA 2E92A 5B0JA 3ACYA 5B0IA 5ERNA 3RYWA 3WCAA 3ZL6A 1YHLA 3KRFA 3N46F 3OABA 4KPJA 5KSXF 4NFKF 3SDVA 2DH4A 3KRAB 1N21A 4GP2A 4E1EA 1YYUA 5HN7A 3TC1A 2RAHA 2Z7IA 4GP1A 5IL8A 3LVSA 3WCCA 5HNAA 3Q2ZA 2ZCSA 4XQRF 2ONHA 3PDEA 5A0IA 5ILKA 4EA2A 3WCEA 2E95A 2E91A 2Z7HA 3WCFA 3WCBA 4QPFA 3WJOA 4RXAA 5B03A 1WKZA 4NKEA 4PVXF 5JUZF 3WEHA 3WCMA 2OGDA 3LZ9A 3SDQA 4EA0A 3N1VF 4LZ3A 3ICMA 2Q9ZA 1JFAA 3IBAA 2ZEVA 3EFQA 5EATA 4KUXA 5ILDA 3VJDA 1YQ7A 5DHKA 2Z78A 2Q58A 4HD1A 1KIZA 1HXGA 3RYEA 3VJEA 3ZCDA 5IKAA 3BNYA 5ILZA 3IPIA 3WEKA 4H5CF 3V1XA 3WEJA 1UBXA 1VG2A 4NFIF 4LA6A 3APZA 3LSNA 3N6KF 2Z50A 4KQ5A 3WSBA 4JXYA 3KRAA 2F89F 3NF2A 2AZJA 3WSAA 2E8VA 5JV1F 4RXCA 3ICNA 2OPNA 3Q30A 4JXNA 5DHIA 3ASXA 5ILHA 3TFPA 1N1ZA 3LEEA 4JZXA 5DW7A 4DWBA 1WY0A 3LGZB 2OPMA 4MC8A 5AELA 3P5PA 3VJ8A 3VJAA 1YYSA 2E94A 1V4KA 5DJPF 2ZCRA 3LK5A 5EASA 5IL3A 4DHDA 3KRPB 2J5CA 3N5HF 3N3DA 3ZMCA 1RQIA 1UBYA 3DYFA 3P8LA 5DIQF 3M00A 4LFGA 1HX9A 3AE0A 1N20A 5IM1A 3KROB 4RNQA 4XQSF 3S9VA 4JZBA 5IK0A 5DZ2A 2O1OA 3OACB 4H5EF 4XQTF 1HXAA 1VG3A 3AQBB 1DI1A 5B0MA 5AHUB 3LG5A 5AYPA 2AELA 4NFJF 3WCHA 2Z4VA 4OKMA 3VJBA 3WC9A 4OMHA 2QISA 3WCIA 2E8TA 3N45F 4JVJF 1HXCA 4LZ0A 2Q80A 3WCDA 4LUUA 5JV0F 3RMGA 4JYXA 2AEKA 1UBVA 5ERMA 1EZFA 5IK6A 3ACWA 1DGPA 4N9UA 5B0KA 3WCGA 1JFGA 3AQ0A 3SDTA 4Q23A 3M01A 2I19A 3KRPA 1N1BA 3EZ3A 4KVDA 4F6XA 4NG6A 2ZCOA 3OYRA 4MC3A 5JA0F 1V4IA 1KIYA 4LPHF 3KRCB 5DGNF 3TFVA 3PYBA 1YJ4A 5I1UA 5JV2F 5IVGA 3KROA 4NKFA 4GAXA 5IK9A 3OACA 4E9ZA 3Q2QA 3PYAA 5C05A 3N0GA 3CP6A 4WK5A 5IMIA 3N5JF 1RTRA 3Q1OA 5A0JA 5B00A 1YYTA 3WEIA 4DEMF 5CG5A 1PS1A 3TFNA 4E9UA 4K10A 3VJ9A 2Z4ZA 3WEFA 3M02A 2F9KF 3MZVA 3CKEA 4RXEA 2PS4A 3S4JA 2AZLA 4OGUA 3G4DA 4LZCA 2ZEUA 3WCLA 1UBWA 4KKMA 4KQSA 3N0FA 3SDUA 4F62A 3QQVA 4LIXA 3N49F 5DGSF 4DWGA 5E8KA 1N22A 3UCAA 5B01A 4KWDA 3VJCA 5DJRF 1YYRA 3ICKA 3WJKA 2EWGA 2OA6A 4MC0A 2FTZA 2E8WA 2Z4WA 4KFAA 2AETA 5EROA 2F92F 4LXWA 1N24A 1N23A 5E8LA 3ZMBA 4LTZA 4LFEA 5E8HA 5ILIA 4KQUA 3LMDA 4GA3A 3KRCA 1VG6A 3MAVA 4KVWA 2P1CA 5ER8A 1WL0A 5CG6A 3WCJA 2J1OA 3QKCA 2F8ZF 3P5RA 3SAEA 3WJNA 2E8UA 4NUAA 3RBMA 3WE9A 2E93A 2Q9YA 2E4OA 4EA1A 3WEGA 3ADZA 3AQCB 4RYPA 3LGKA 3V66A 2J1PA 3DYHA 5H9DA 3M9UA 3NRIA 5IN8A 2PS8A 5HN9A 2PS5A 3TS7A 3ICZA 4LFVF 3LJIA 4LTVA 4LOBA 3N3LF 4P0XA 4LLTA 4KK2A 3ZOUA 3SDRA 4KVIA 5HN8A 1VG7A 2E8XA 3LLWA 2PS6A 3ACXA 1V4HA 3B7LA 5DJVF 4ZQ8A 3LOMA 5B02A 3KBKA 1WL3A 1RQJA 4DXJA 4P0VA 4QXSF 3CC9A 2ZY1A 4KVYA 5A0KA 3DYGA 5AFXA 3W7FA 3NPKA 3KRFB 1WL1A 5IKHA 2FORA 3OABB 3M0GA 5DGMF 1HM4A 2Z52A 1WMWA 4H5DF 5ILJA 1YHMA 2F7MF 4OMGA 1YV5A 4OKZA 1YHKA 3P8RA 4LA5A 4DI5A 1VG4A 4LLSA 1HM7A 1WL2A 3LDWA 1FPSA 2AZKA 2ZCQA 5IMPA 1V4JA 5B0LA
chains in the Genus database with same CATH superfamily
4L2XF 2F8CF 4KPDA 4FJQA 3V1VA 4DZWA 1YYQA 2PS7A 3NPRA 4PVYF 1ZW5A 3G4FA 4FP4A 3P41A 1V4EA 3N1WF 4F6VA 2Z4YA 2E90A 3KB9A 3PH7A 4UMJA 4P0WA 2H8OA 2Z4XA 3EGTA 2F94F 5EAUA 3PKOA 3ID0A 2VF6A 4N1ZF 4RXDA 2ONGA 3BNXA 4LPGF 5ILYA 5IMNA 2E92A 5B0JA 3ACYA 5B0IA 5ERNA 3RYWA 3WCAA 3ZL6A 1YHLA 3KRFA 3N46F 3OABA 4KPJA 5KSXF 4NFKF 3SDVA 2DH4A 3KRAB 1N21A 4GP2A 4E1EA 1YYUA 5HN7A 3TC1A 2RAHA 2Z7IA 4GP1A 5IL8A 3LVSA 3WCCA 5HNAA 3Q2ZA 2ZCSA 4XQRF 2ONHA 3PDEA 5A0IA 5ILKA 4EA2A 3WCEA 2E95A 2E91A 2Z7HA 3WCFA 3WCBA 4QPFA 3WJOA 4RXAA 5B03A 1WKZA 4NKEA 4PVXF 5JUZF 3WEHA 3WCMA 2OGDA 3LZ9A 3SDQA 4EA0A 3N1VF 4LZ3A 3ICMA 2Q9ZA 1JFAA 3IBAA 2ZEVA 3EFQA 5EATA 4KUXA 5ILDA 3VJDA 1YQ7A 5DHKA 2Z78A 2Q58A 4HD1A 1KIZA 1HXGA 3RYEA 3VJEA 3ZCDA 5IKAA 3BNYA 5ILZA 3IPIA 3WEKA 4H5CF 3V1XA 3WEJA 1UBXA 1VG2A 4NFIF 4LA6A 3APZA 3LSNA 3N6KF 2Z50A 4KQ5A 3WSBA 4JXYA 3KRAA 2F89F 3NF2A 2AZJA 3WSAA 2E8VA 5JV1F 4RXCA 3ICNA 2OPNA 3Q30A 4JXNA 5DHIA 3ASXA 5ILHA 3TFPA 1N1ZA 3LEEA 4JZXA 5DW7A 4DWBA 1WY0A 3LGZB 2OPMA 4MC8A 5AELA 3P5PA 3VJ8A 3VJAA 1YYSA 2E94A 1V4KA 5DJPF 2ZCRA 3LK5A 5EASA 5IL3A 4DHDA 3KRPB 2J5CA 3N5HF 3N3DA 3ZMCA 1RQIA 1UBYA 3DYFA 3P8LA 5DIQF 3M00A 4LFGA 1HX9A 3AE0A 1N20A 5IM1A 3KROB 4RNQA 4XQSF 3S9VA 4JZBA 5IK0A 5DZ2A 2O1OA 3OACB 4H5EF 4XQTF 1HXAA 1VG3A 3AQBB 1DI1A 5B0MA 5AHUB 3LG5A 5AYPA 2AELA 4NFJF 3WCHA 2Z4VA 4OKMA 3VJBA 3WC9A 4OMHA 2QISA 3WCIA 2E8TA 3N45F 4JVJF 1HXCA 4LZ0A 2Q80A 3WCDA 4LUUA 5JV0F 3RMGA 4JYXA 2AEKA 1UBVA 5ERMA 1EZFA 5IK6A 3ACWA 1DGPA 4N9UA 5B0KA 3WCGA 1JFGA 3AQ0A 3SDTA 4Q23A 3M01A 2I19A 3KRPA 1N1BA 3EZ3A 4KVDA 4F6XA 4NG6A 2ZCOA 3OYRA 4MC3A 5JA0F 1V4IA 1KIYA 4LPHF 3KRCB 5DGNF 3TFVA 3PYBA 1YJ4A 5I1UA 5JV2F 5IVGA 3KROA 4NKFA 4GAXA 5IK9A 3OACA 4E9ZA 3Q2QA 3PYAA 5C05A 3N0GA 3CP6A 4WK5A 5IMIA 3N5JF 1RTRA 3Q1OA 5A0JA 5B00A 1YYTA 3WEIA 4DEMF 5CG5A 1PS1A 3TFNA 4E9UA 4K10A 3VJ9A 2Z4ZA 3WEFA 3M02A 2F9KF 3MZVA 3CKEA 4RXEA 2PS4A 3S4JA 2AZLA 4OGUA 3G4DA 4LZCA 2ZEUA 3WCLA 1UBWA 4KKMA 4KQSA 3N0FA 3SDUA 4F62A 3QQVA 4LIXA 3N49F 5DGSF 4DWGA 5E8KA 1N22A 3UCAA 5B01A 4KWDA 3VJCA 5DJRF 1YYRA 3ICKA 3WJKA 2EWGA 2OA6A 4MC0A 2FTZA 2E8WA 2Z4WA 4KFAA 2AETA 5EROA 2F92F 4LXWA 1N24A 1N23A 5E8LA 3ZMBA 4LTZA 4LFEA 5E8HA 5ILIA 4KQUA 3LMDA 4GA3A 3KRCA 1VG6A 3MAVA 4KVWA 2P1CA 5ER8A 1WL0A 5CG6A 3WCJA 2J1OA 3QKCA 2F8ZF 3P5RA 3SAEA 3WJNA 2E8UA 4NUAA 3RBMA 3WE9A 2E93A 2Q9YA 2E4OA 4EA1A 3WEGA 3ADZA 3AQCB 4RYPA 3LGKA 3V66A 2J1PA 3DYHA 5H9DA 3M9UA 3NRIA 5IN8A 2PS8A 5HN9A 2PS5A 3TS7A 3ICZA 4LFVF 3LJIA 4LTVA 4LOBA 3N3LF 4P0XA 4LLTA 4KK2A 3ZOUA 3SDRA 4KVIA 5HN8A 1VG7A 2E8XA 3LLWA 2PS6A 3ACXA 1V4HA 3B7LA 5DJVF 4ZQ8A 3LOMA 5B02A 3KBKA 1WL3A 1RQJA 4DXJA 4P0VA 4QXSF 3CC9A 2ZY1A 4KVYA 5A0KA 3DYGA 5AFXA 3W7FA 3NPKA 3KRFB 1WL1A 5IKHA 2FORA 3OABB 3M0GA 5DGMF 1HM4A 2Z52A 1WMWA 4H5DF 5ILJA 1YHMA 2F7MF 4OMGA 1YV5A 4OKZA 1YHKA 3P8RA 4LA5A 4DI5A 1VG4A 4LLSA 1HM7A 1WL2A 3LDWA 1FPSA 2AZKA 2ZCQA 5IMPA 1V4JA 5B0LA
chains in the Genus database with same CATH topology
4L2XF 2F8CF 4KPDA 4FJQA 3V1VA 4DZWA 1YYQA 2PS7A 3NPRA 4PVYF 1ZW5A 3G4FA 4FP4A 3P41A 1V4EA 3N1WF 4F6VA 2Z4YA 2E90A 3KB9A 3PH7A 4UMJA 4P0WA 2H8OA 2Z4XA 3EGTA 2F94F 5EAUA 3PKOA 3ID0A 2VF6A 4N1ZF 4RXDA 2ONGA 3BNXA 4LPGF 5ILYA 5IMNA 2E92A 5B0JA 3ACYA 5B0IA 5ERNA 3RYWA 3WCAA 3ZL6A 1YHLA 3KRFA 3N46F 3OABA 4KPJA 5KSXF 4NFKF 3SDVA 2DH4A 3KRAB 1N21A 4GP2A 4E1EA 1YYUA 5HN7A 3TC1A 2RAHA 2Z7IA 4GP1A 5IL8A 3LVSA 3WCCA 5HNAA 3Q2ZA 2ZCSA 4XQRF 2ONHA 3PDEA 5A0IA 5ILKA 4EA2A 3WCEA 2E95A 2E91A 2Z7HA 3WCFA 3WCBA 4QPFA 3WJOA 4RXAA 5B03A 1WKZA 4NKEA 4PVXF 5JUZF 3WEHA 3WCMA 2OGDA 3LZ9A 3SDQA 4EA0A 3N1VF 4LZ3A 3ICMA 2Q9ZA 1JFAA 3IBAA 2ZEVA 3EFQA 5EATA 4KUXA 5ILDA 3VJDA 1YQ7A 5DHKA 2Z78A 2Q58A 4HD1A 1KIZA 1HXGA 3RYEA 3VJEA 3ZCDA 5IKAA 3BNYA 5ILZA 3IPIA 3WEKA 4H5CF 3V1XA 3WEJA 1UBXA 1VG2A 4NFIF 4LA6A 3APZA 3LSNA 3N6KF 2Z50A 4KQ5A 3WSBA 4JXYA 3KRAA 2F89F 3NF2A 2AZJA 3WSAA 2E8VA 5JV1F 4RXCA 3ICNA 2OPNA 3Q30A 4JXNA 5DHIA 3ASXA 5ILHA 3TFPA 1N1ZA 3LEEA 4JZXA 5DW7A 4DWBA 1WY0A 3LGZB 2OPMA 4MC8A 5AELA 3P5PA 3VJ8A 3VJAA 1YYSA 2E94A 1V4KA 5DJPF 2ZCRA 3LK5A 5EASA 5IL3A 4DHDA 3KRPB 2J5CA 3N5HF 3N3DA 3ZMCA 1RQIA 1UBYA 3DYFA 3P8LA 5DIQF 3M00A 4LFGA 1HX9A 3AE0A 1N20A 5IM1A 3KROB 4RNQA 4XQSF 3S9VA 4JZBA 5IK0A 5DZ2A 2O1OA 3OACB 4H5EF 4XQTF 1HXAA 1VG3A 3AQBB 1DI1A 5B0MA 5AHUB 3LG5A 5AYPA 2AELA 4NFJF 3WCHA 2Z4VA 4OKMA 3VJBA 3WC9A 4OMHA 2QISA 3WCIA 2E8TA 3N45F 4JVJF 1HXCA 4LZ0A 2Q80A 3WCDA 4LUUA 5JV0F 3RMGA 4JYXA 2AEKA 1UBVA 5ERMA 1EZFA 5IK6A 3ACWA 1DGPA 4N9UA 5B0KA 3WCGA 1JFGA 3AQ0A 3SDTA 4Q23A 3M01A 2I19A 3KRPA 1N1BA 3EZ3A 4KVDA 4F6XA 4NG6A 2ZCOA 3OYRA 4MC3A 5JA0F 1V4IA 1KIYA 4LPHF 3KRCB 5DGNF 3TFVA 3PYBA 1YJ4A 5I1UA 5JV2F 5IVGA 3KROA 4NKFA 4GAXA 5IK9A 3OACA 4E9ZA 3Q2QA 3PYAA 5C05A 3N0GA 3CP6A 4WK5A 5IMIA 3N5JF 1RTRA 3Q1OA 5A0JA 5B00A 1YYTA 3WEIA 4DEMF 5CG5A 1PS1A 3TFNA 4E9UA 4K10A 3VJ9A 2Z4ZA 3WEFA 3M02A 2F9KF 3MZVA 3CKEA 4RXEA 2PS4A 3S4JA 2AZLA 4OGUA 3G4DA 4LZCA 2ZEUA 3WCLA 1UBWA 4KKMA 4KQSA 3N0FA 3SDUA 4F62A 3QQVA 4LIXA 3N49F 5DGSF 4DWGA 5E8KA 1N22A 3UCAA 5B01A 4KWDA 3VJCA 5DJRF 1YYRA 3ICKA 3WJKA 2EWGA 2OA6A 4MC0A 2FTZA 2E8WA 2Z4WA 4KFAA 2AETA 5EROA 2F92F 4LXWA 1N24A 1N23A 5E8LA 3ZMBA 4LTZA 4LFEA 5E8HA 5ILIA 4KQUA 3LMDA 4GA3A 3KRCA 1VG6A 3MAVA 4KVWA 2P1CA 5ER8A 1WL0A 5CG6A 3WCJA 2J1OA 3QKCA 2F8ZF 3P5RA 3SAEA 3WJNA 2E8UA 4NUAA 3RBMA 3WE9A 2E93A 2Q9YA 2E4OA 4EA1A 3WEGA 3ADZA 3AQCB 4RYPA 3LGKA 3V66A 2J1PA 3DYHA 5H9DA 3M9UA 3NRIA 5IN8A 2PS8A 5HN9A 2PS5A 3TS7A 3ICZA 4LFVF 3LJIA 4LTVA 4LOBA 3N3LF 4P0XA 4LLTA 4KK2A 3ZOUA 3SDRA 4KVIA 5HN8A 1VG7A 2E8XA 3LLWA 2PS6A 3ACXA 1V4HA 3B7LA 5DJVF 4ZQ8A 3LOMA 5B02A 3KBKA 1WL3A 1RQJA 4DXJA 4P0VA 4QXSF 3CC9A 2ZY1A 4KVYA 5A0KA 3DYGA 5AFXA 3W7FA 3NPKA 3KRFB 1WL1A 5IKHA 2FORA 3OABB 3M0GA 5DGMF 1HM4A 2Z52A 1WMWA 4H5DF 5ILJA 1YHMA 2F7MF 4OMGA 1YV5A 4OKZA 1YHKA 3P8RA 4LA5A 4DI5A 1VG4A 4LLSA 1HM7A 1WL2A 3LDWA 1FPSA 2AZKA 2ZCQA 5IMPA 1V4JA 5B0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L2X F;  2F8C F;  4KPD A;  4FJQ A;  3V1V A;  4DZW A;  1YYQ A;  2PS7 A;  3NPR A;  4PVY F;  1ZW5 A;  3G4F A;  4FP4 A;  3P41 A;  1V4E A;  3N1W F;  4F6V A;  2Z4Y A;  2E90 A;  3KB9 A;  3PH7 A;  4UMJ A;  4P0W A;  2H8O A;  2Z4X A;  3EGT A;  2F94 F;  5EAU A;  3PKO A;  3ID0 A;  2VF6 A;  4N1Z F;  4RXD A;  2ONG A;  3BNX A;  4LPG F;  5ILY A;  5IMN A;  2E92 A;  5B0J A;  3ACY A;  5B0I A;  5ERN A;  3RYW A;  3WCA A;  3ZL6 A;  1YHL A;  3KRF A;  3N46 F;  3OAB A;  4KPJ A;  5KSX F;  4NFK F;  3SDV A;  2DH4 A;  3KRA B;  1N21 A;  4GP2 A;  4E1E A;  1YYU A;  5HN7 A;  3TC1 A;  2RAH A;  2Z7I A;  4GP1 A;  5IL8 A;  3LVS A;  3WCC A;  5HNA A;  3Q2Z A;  2ZCS A;  4XQR F;  2ONH A;  3PDE A;  5A0I A;  5ILK A;  4EA2 A;  3WCE A;  2E95 A;  2E91 A;  2Z7H A;  3WCF A;  3WCB A;  4QPF A;  3WJO A;  4RXA A;  5B03 A;  1WKZ A;  4NKE A;  4PVX F;  5JUZ F;  3WEH A;  3WCM A;  2OGD A;  3LZ9 A;  3SDQ A;  4EA0 A;  3N1V F;  4LZ3 A;  3ICM A;  2Q9Z A;  1JFA A;  3IBA A;  2ZEV A;  3EFQ A;  5EAT A;  4KUX A;  5ILD A;  3VJD A;  1YQ7 A;  5DHK A;  2Z78 A;  2Q58 A;  4HD1 A;  1KIZ A;  1HXG A;  3RYE A;  3VJE A;  3ZCD A;  5IKA A;  3BNY A;  5ILZ A;  3IPI A;  3WEK A;  4H5C F;  3V1X A;  3WEJ A;  1UBX A;  1VG2 A;  4NFI F;  4LA6 A;  3APZ A;  3LSN A;  3N6K F;  2Z50 A;  4KQ5 A;  3WSB A;  4JXY A;  3KRA A;  2F89 F;  3NF2 A;  2AZJ A;  3WSA A;  2E8V A;  5JV1 F;  4RXC A;  3ICN A;  2OPN A;  3Q30 A;  4JXN A;  5DHI A;  3ASX A;  5ILH A;  3TFP A;  1N1Z A;  3LEE A;  4JZX A;  5DW7 A;  4DWB A;  1WY0 A;  3LGZ B;  2OPM A;  4MC8 A;  5AEL A;  3P5P A;  3VJ8 A;  3VJA A;  1YYS A;  2E94 A;  1V4K A;  5DJP F;  2ZCR A;  3LK5 A;  5EAS A;  5IL3 A;  4DHD A;  3KRP B;  2J5C A;  3N5H F;  3N3D A;  3ZMC A;  1RQI A;  1UBY A;  3DYF A;  3P8L A;  5DIQ F;  3M00 A;  4LFG A;  1HX9 A;  3AE0 A;  1N20 A;  5IM1 A;  3KRO B;  4RNQ A;  4XQS F;  3S9V A;  4JZB A;  5IK0 A;  5DZ2 A;  2O1O A;  3OAC B;  4H5E F;  4XQT F;  1HXA A;  1VG3 A;  3AQB B;  1DI1 A;  5B0M A;  5AHU B;  3LG5 A;  5AYP A;  2AEL A;  4NFJ F;  3WCH A;  2Z4V A;  4OKM A;  3VJB A;  3WC9 A;  4OMH A;  2QIS A;  3WCI A;  2E8T A;  3N45 F;  4JVJ F;  1HXC A;  4LZ0 A;  2Q80 A;  3WCD A;  4LUU A;  5JV0 F;  3RMG A;  4JYX A;  2AEK A;  1UBV A;  5ERM A;  1EZF A;  5IK6 A;  3ACW A;  1DGP A;  4N9U A;  5B0K A;  3WCG A;  1JFG A;  3AQ0 A;  3SDT A;  4Q23 A;  3M01 A;  2I19 A;  3KRP A;  1N1B A;  3EZ3 A;  4KVD A;  4F6X A;  4NG6 A;  2ZCO A;  3OYR A;  4MC3 A;  5JA0 F;  1V4I A;  1KIY A;  4LPH F;  3KRC B;  5DGN F;  3TFV A;  3PYB A;  1YJ4 A;  5I1U A;  5JV2 F;  5IVG A;  3KRO A;  4NKF A;  4GAX A;  5IK9 A;  3OAC A;  4E9Z A;  3Q2Q A;  3PYA A;  5C05 A;  3N0G A;  3CP6 A;  4WK5 A;  5IMI A;  3N5J F;  1RTR A;  3Q1O A;  5A0J A;  5B00 A;  1YYT A;  3WEI A;  4DEM F;  5CG5 A;  1PS1 A;  3TFN A;  4E9U A;  4K10 A;  3VJ9 A;  2Z4Z A;  3WEF A;  3M02 A;  2F9K F;  3MZV A;  3CKE A;  4RXE A;  2PS4 A;  3S4J A;  2AZL A;  4OGU A;  3G4D A;  4LZC A;  2ZEU A;  3WCL A;  1UBW A;  4KKM A;  4KQS A;  3N0F A;  3SDU A;  4F62 A;  3QQV A;  4LIX A;  3N49 F;  5DGS F;  4DWG A;  5E8K A;  1N22 A;  3UCA A;  5B01 A;  4KWD A;  3VJC A;  5DJR F;  1YYR A;  3ICK A;  3WJK A;  2EWG A;  2OA6 A;  4MC0 A;  2FTZ A;  2E8W A;  2Z4W A;  4KFA A;  2AET A;  5ERO A;  2F92 F;  4LXW A;  1N24 A;  1N23 A;  5E8L A;  3ZMB A;  4LTZ A;  4LFE A;  5E8H A;  5ILI A;  4KQU A;  3LMD A;  4GA3 A;  3KRC A;  1VG6 A;  3MAV A;  4KVW A;  2P1C A;  5ER8 A;  1WL0 A;  5CG6 A;  3WCJ A;  2J1O A;  3QKC A;  2F8Z F;  3P5R A;  3SAE A;  3WJN A;  2E8U A;  4NUA A;  3RBM A;  3WE9 A;  2E93 A;  2Q9Y A;  2E4O A;  4EA1 A;  3WEG A;  3ADZ A;  3AQC B;  4RYP A;  3LGK A;  3V66 A;  2J1P A;  3DYH A;  5H9D A;  3M9U A;  3NRI A;  5IN8 A;  2PS8 A;  5HN9 A;  2PS5 A;  3TS7 A;  3ICZ A;  4LFV F;  3LJI A;  4LTV A;  4LOB A;  3N3L F;  4P0X A;  4LLT A;  4KK2 A;  3ZOU A;  3SDR A;  4KVI A;  5HN8 A;  1VG7 A;  2E8X A;  3LLW A;  2PS6 A;  3ACX A;  1V4H A;  3B7L A;  5DJV F;  4ZQ8 A;  3LOM A;  5B02 A;  3KBK A;  1WL3 A;  1RQJ A;  4DXJ A;  4P0V A;  4QXS F;  3CC9 A;  2ZY1 A;  4KVY A;  5A0K A;  3DYG A;  5AFX A;  3W7F A;  3NPK A;  3KRF B;  1WL1 A;  5IKH A;  2FOR A;  3OAB B;  3M0G A;  5DGM F;  1HM4 A;  2Z52 A;  1WMW A;  4H5D F;  5ILJ A;  1YHM A;  2F7M F;  4OMG A;  1YV5 A;  4OKZ A;  1YHK A;  3P8R A;  4LA5 A;  4DI5 A;  1VG4 A;  4LLS A;  1HM7 A;  1WL2 A;  3LDW A;  1FPS A;  2AZK A;  2ZCQ A;  5IMP A;  1V4J A;  5B0L A; 
#chains in the Genus database with same CATH topology
 4L2X F;  2F8C F;  4KPD A;  4FJQ A;  3V1V A;  4DZW A;  1YYQ A;  2PS7 A;  3NPR A;  4PVY F;  1ZW5 A;  3G4F A;  4FP4 A;  3P41 A;  1V4E A;  3N1W F;  4F6V A;  2Z4Y A;  2E90 A;  3KB9 A;  3PH7 A;  4UMJ A;  4P0W A;  2H8O A;  2Z4X A;  3EGT A;  2F94 F;  5EAU A;  3PKO A;  3ID0 A;  2VF6 A;  4N1Z F;  4RXD A;  2ONG A;  3BNX A;  4LPG F;  5ILY A;  5IMN A;  2E92 A;  5B0J A;  3ACY A;  5B0I A;  5ERN A;  3RYW A;  3WCA A;  3ZL6 A;  1YHL A;  3KRF A;  3N46 F;  3OAB A;  4KPJ A;  5KSX F;  4NFK F;  3SDV A;  2DH4 A;  3KRA B;  1N21 A;  4GP2 A;  4E1E A;  1YYU A;  5HN7 A;  3TC1 A;  2RAH A;  2Z7I A;  4GP1 A;  5IL8 A;  3LVS A;  3WCC A;  5HNA A;  3Q2Z A;  2ZCS A;  4XQR F;  2ONH A;  3PDE A;  5A0I A;  5ILK A;  4EA2 A;  3WCE A;  2E95 A;  2E91 A;  2Z7H A;  3WCF A;  3WCB A;  4QPF A;  3WJO A;  4RXA A;  5B03 A;  1WKZ A;  4NKE A;  4PVX F;  5JUZ F;  3WEH A;  3WCM A;  2OGD A;  3LZ9 A;  3SDQ A;  4EA0 A;  3N1V F;  4LZ3 A;  3ICM A;  2Q9Z A;  1JFA A;  3IBA A;  2ZEV A;  3EFQ A;  5EAT A;  4KUX A;  5ILD A;  3VJD A;  1YQ7 A;  5DHK A;  2Z78 A;  2Q58 A;  4HD1 A;  1KIZ A;  1HXG A;  3RYE A;  3VJE A;  3ZCD A;  5IKA A;  3BNY A;  5ILZ A;  3IPI A;  3WEK A;  4H5C F;  3V1X A;  3WEJ A;  1UBX A;  1VG2 A;  4NFI F;  4LA6 A;  3APZ A;  3LSN A;  3N6K F;  2Z50 A;  4KQ5 A;  3WSB A;  4JXY A;  3KRA A;  2F89 F;  3NF2 A;  2AZJ A;  3WSA A;  2E8V A;  5JV1 F;  4RXC A;  3ICN A;  2OPN A;  3Q30 A;  4JXN A;  5DHI A;  3ASX A;  5ILH A;  3TFP A;  1N1Z A;  3LEE A;  4JZX A;  5DW7 A;  4DWB A;  1WY0 A;  3LGZ B;  2OPM A;  4MC8 A;  5AEL A;  3P5P A;  3VJ8 A;  3VJA A;  1YYS A;  2E94 A;  1V4K A;  5DJP F;  2ZCR A;  3LK5 A;  5EAS A;  5IL3 A;  4DHD A;  3KRP B;  2J5C A;  3N5H F;  3N3D A;  3ZMC A;  1RQI A;  1UBY A;  3DYF A;  3P8L A;  5DIQ F;  3M00 A;  4LFG A;  1HX9 A;  3AE0 A;  1N20 A;  5IM1 A;  3KRO B;  4RNQ A;  4XQS F;  3S9V A;  4JZB A;  5IK0 A;  5DZ2 A;  2O1O A;  3OAC B;  4H5E F;  4XQT F;  1HXA A;  1VG3 A;  3AQB B;  1DI1 A;  5B0M A;  5AHU B;  3LG5 A;  5AYP A;  2AEL A;  4NFJ F;  3WCH A;  2Z4V A;  4OKM A;  3VJB A;  3WC9 A;  4OMH A;  2QIS A;  3WCI A;  2E8T A;  3N45 F;  4JVJ F;  1HXC A;  4LZ0 A;  2Q80 A;  3WCD A;  4LUU A;  5JV0 F;  3RMG A;  4JYX A;  2AEK A;  1UBV A;  5ERM A;  1EZF A;  5IK6 A;  3ACW A;  1DGP A;  4N9U A;  5B0K A;  3WCG A;  1JFG A;  3AQ0 A;  3SDT A;  4Q23 A;  3M01 A;  2I19 A;  3KRP A;  1N1B A;  3EZ3 A;  4KVD A;  4F6X A;  4NG6 A;  2ZCO A;  3OYR A;  4MC3 A;  5JA0 F;  1V4I A;  1KIY A;  4LPH F;  3KRC B;  5DGN F;  3TFV A;  3PYB A;  1YJ4 A;  5I1U A;  5JV2 F;  5IVG A;  3KRO A;  4NKF A;  4GAX A;  5IK9 A;  3OAC A;  4E9Z A;  3Q2Q A;  3PYA A;  5C05 A;  3N0G A;  3CP6 A;  4WK5 A;  5IMI A;  3N5J F;  1RTR A;  3Q1O A;  5A0J A;  5B00 A;  1YYT A;  3WEI A;  4DEM F;  5CG5 A;  1PS1 A;  3TFN A;  4E9U A;  4K10 A;  3VJ9 A;  2Z4Z A;  3WEF A;  3M02 A;  2F9K F;  3MZV A;  3CKE A;  4RXE A;  2PS4 A;  3S4J A;  2AZL A;  4OGU A;  3G4D A;  4LZC A;  2ZEU A;  3WCL A;  1UBW A;  4KKM A;  4KQS A;  3N0F A;  3SDU A;  4F62 A;  3QQV A;  4LIX A;  3N49 F;  5DGS F;  4DWG A;  5E8K A;  1N22 A;  3UCA A;  5B01 A;  4KWD A;  3VJC A;  5DJR F;  1YYR A;  3ICK A;  3WJK A;  2EWG A;  2OA6 A;  4MC0 A;  2FTZ A;  2E8W A;  2Z4W A;  4KFA A;  2AET A;  5ERO A;  2F92 F;  4LXW A;  1N24 A;  1N23 A;  5E8L A;  3ZMB A;  4LTZ A;  4LFE A;  5E8H A;  5ILI A;  4KQU A;  3LMD A;  4GA3 A;  3KRC A;  1VG6 A;  3MAV A;  4KVW A;  2P1C A;  5ER8 A;  1WL0 A;  5CG6 A;  3WCJ A;  2J1O A;  3QKC A;  2F8Z F;  3P5R A;  3SAE A;  3WJN A;  2E8U A;  4NUA A;  3RBM A;  3WE9 A;  2E93 A;  2Q9Y A;  2E4O A;  4EA1 A;  3WEG A;  3ADZ A;  3AQC B;  4RYP A;  3LGK A;  3V66 A;  2J1P A;  3DYH A;  5H9D A;  3M9U A;  3NRI A;  5IN8 A;  2PS8 A;  5HN9 A;  2PS5 A;  3TS7 A;  3ICZ A;  4LFV F;  3LJI A;  4LTV A;  4LOB A;  3N3L F;  4P0X A;  4LLT A;  4KK2 A;  3ZOU A;  3SDR A;  4KVI A;  5HN8 A;  1VG7 A;  2E8X A;  3LLW A;  2PS6 A;  3ACX A;  1V4H A;  3B7L A;  5DJV F;  4ZQ8 A;  3LOM A;  5B02 A;  3KBK A;  1WL3 A;  1RQJ A;  4DXJ A;  4P0V A;  4QXS F;  3CC9 A;  2ZY1 A;  4KVY A;  5A0K A;  3DYG A;  5AFX A;  3W7F A;  3NPK A;  3KRF B;  1WL1 A;  5IKH A;  2FOR A;  3OAB B;  3M0G A;  5DGM F;  1HM4 A;  2Z52 A;  1WMW A;  4H5D F;  5ILJ A;  1YHM A;  2F7M F;  4OMG A;  1YV5 A;  4OKZ A;  1YHK A;  3P8R A;  4LA5 A;  4DI5 A;  1VG4 A;  4LLS A;  1HM7 A;  1WL2 A;  3LDW A;  1FPS A;  2AZK A;  2ZCQ A;  5IMP A;  1V4J A;  5B0L A; 
#chains in the Genus database with same CATH homology
 4L2X F;  2F8C F;  4KPD A;  4FJQ A;  3V1V A;  4DZW A;  1YYQ A;  2PS7 A;  3NPR A;  4PVY F;  1ZW5 A;  3G4F A;  4FP4 A;  3P41 A;  1V4E A;  3N1W F;  4F6V A;  2Z4Y A;  2E90 A;  3KB9 A;  3PH7 A;  4UMJ A;  4P0W A;  2H8O A;  2Z4X A;  3EGT A;  2F94 F;  5EAU A;  3PKO A;  3ID0 A;  2VF6 A;  4N1Z F;  4RXD A;  2ONG A;  3BNX A;  4LPG F;  5ILY A;  5IMN A;  2E92 A;  5B0J A;  3ACY A;  5B0I A;  5ERN A;  3RYW A;  3WCA A;  3ZL6 A;  1YHL A;  3KRF A;  3N46 F;  3OAB A;  4KPJ A;  5KSX F;  4NFK F;  3SDV A;  2DH4 A;  3KRA B;  1N21 A;  4GP2 A;  4E1E A;  1YYU A;  5HN7 A;  3TC1 A;  2RAH A;  2Z7I A;  4GP1 A;  5IL8 A;  3LVS A;  3WCC A;  5HNA A;  3Q2Z A;  2ZCS A;  4XQR F;  2ONH A;  3PDE A;  5A0I A;  5ILK A;  4EA2 A;  3WCE A;  2E95 A;  2E91 A;  2Z7H A;  3WCF A;  3WCB A;  4QPF A;  3WJO A;  4RXA A;  5B03 A;  1WKZ A;  4NKE A;  4PVX F;  5JUZ F;  3WEH A;  3WCM A;  2OGD A;  3LZ9 A;  3SDQ A;  4EA0 A;  3N1V F;  4LZ3 A;  3ICM A;  2Q9Z A;  1JFA A;  3IBA A;  2ZEV A;  3EFQ A;  5EAT A;  4KUX A;  5ILD A;  3VJD A;  1YQ7 A;  5DHK A;  2Z78 A;  2Q58 A;  4HD1 A;  1KIZ A;  1HXG A;  3RYE A;  3VJE A;  3ZCD A;  5IKA A;  3BNY A;  5ILZ A;  3IPI A;  3WEK A;  4H5C F;  3V1X A;  3WEJ A;  1UBX A;  1VG2 A;  4NFI F;  4LA6 A;  3APZ A;  3LSN A;  3N6K F;  2Z50 A;  4KQ5 A;  3WSB A;  4JXY A;  3KRA A;  2F89 F;  3NF2 A;  2AZJ A;  3WSA A;  2E8V A;  5JV1 F;  4RXC A;  3ICN A;  2OPN A;  3Q30 A;  4JXN A;  5DHI A;  3ASX A;  5ILH A;  3TFP A;  1N1Z A;  3LEE A;  4JZX A;  5DW7 A;  4DWB A;  1WY0 A;  3LGZ B;  2OPM A;  4MC8 A;  5AEL A;  3P5P A;  3VJ8 A;  3VJA A;  1YYS A;  2E94 A;  1V4K A;  5DJP F;  2ZCR A;  3LK5 A;  5EAS A;  5IL3 A;  4DHD A;  3KRP B;  2J5C A;  3N5H F;  3N3D A;  3ZMC A;  1RQI A;  1UBY A;  3DYF A;  3P8L A;  5DIQ F;  3M00 A;  4LFG A;  1HX9 A;  3AE0 A;  1N20 A;  5IM1 A;  3KRO B;  4RNQ A;  4XQS F;  3S9V A;  4JZB A;  5IK0 A;  5DZ2 A;  2O1O A;  3OAC B;  4H5E F;  4XQT F;  1HXA A;  1VG3 A;  3AQB B;  1DI1 A;  5B0M A;  5AHU B;  3LG5 A;  5AYP A;  2AEL A;  4NFJ F;  3WCH A;  2Z4V A;  4OKM A;  3VJB A;  3WC9 A;  4OMH A;  2QIS A;  3WCI A;  2E8T A;  3N45 F;  4JVJ F;  1HXC A;  4LZ0 A;  2Q80 A;  3WCD A;  4LUU A;  5JV0 F;  3RMG A;  4JYX A;  2AEK A;  1UBV A;  5ERM A;  1EZF A;  5IK6 A;  3ACW A;  1DGP A;  4N9U A;  5B0K A;  3WCG A;  1JFG A;  3AQ0 A;  3SDT A;  4Q23 A;  3M01 A;  2I19 A;  3KRP A;  1N1B A;  3EZ3 A;  4KVD A;  4F6X A;  4NG6 A;  2ZCO A;  3OYR A;  4MC3 A;  5JA0 F;  1V4I A;  1KIY A;  4LPH F;  3KRC B;  5DGN F;  3TFV A;  3PYB A;  1YJ4 A;  5I1U A;  5JV2 F;  5IVG A;  3KRO A;  4NKF A;  4GAX A;  5IK9 A;  3OAC A;  4E9Z A;  3Q2Q A;  3PYA A;  5C05 A;  3N0G A;  3CP6 A;  4WK5 A;  5IMI A;  3N5J F;  1RTR A;  3Q1O A;  5A0J A;  5B00 A;  1YYT A;  3WEI A;  4DEM F;  5CG5 A;  1PS1 A;  3TFN A;  4E9U A;  4K10 A;  3VJ9 A;  2Z4Z A;  3WEF A;  3M02 A;  2F9K F;  3MZV A;  3CKE A;  4RXE A;  2PS4 A;  3S4J A;  2AZL A;  4OGU A;  3G4D A;  4LZC A;  2ZEU A;  3WCL A;  1UBW A;  4KKM A;  4KQS A;  3N0F A;  3SDU A;  4F62 A;  3QQV A;  4LIX A;  3N49 F;  5DGS F;  4DWG A;  5E8K A;  1N22 A;  3UCA A;  5B01 A;  4KWD A;  3VJC A;  5DJR F;  1YYR A;  3ICK A;  3WJK A;  2EWG A;  2OA6 A;  4MC0 A;  2FTZ A;  2E8W A;  2Z4W A;  4KFA A;  2AET A;  5ERO A;  2F92 F;  4LXW A;  1N24 A;  1N23 A;  5E8L A;  3ZMB A;  4LTZ A;  4LFE A;  5E8H A;  5ILI A;  4KQU A;  3LMD A;  4GA3 A;  3KRC A;  1VG6 A;  3MAV A;  4KVW A;  2P1C A;  5ER8 A;  1WL0 A;  5CG6 A;  3WCJ A;  2J1O A;  3QKC A;  2F8Z F;  3P5R A;  3SAE A;  3WJN A;  2E8U A;  4NUA A;  3RBM A;  3WE9 A;  2E93 A;  2Q9Y A;  2E4O A;  4EA1 A;  3WEG A;  3ADZ A;  3AQC B;  4RYP A;  3LGK A;  3V66 A;  2J1P A;  3DYH A;  5H9D A;  3M9U A;  3NRI A;  5IN8 A;  2PS8 A;  5HN9 A;  2PS5 A;  3TS7 A;  3ICZ A;  4LFV F;  3LJI A;  4LTV A;  4LOB A;  3N3L F;  4P0X A;  4LLT A;  4KK2 A;  3ZOU A;  3SDR A;  4KVI A;  5HN8 A;  1VG7 A;  2E8X A;  3LLW A;  2PS6 A;  3ACX A;  1V4H A;  3B7L A;  5DJV F;  4ZQ8 A;  3LOM A;  5B02 A;  3KBK A;  1WL3 A;  1RQJ A;  4DXJ A;  4P0V A;  4QXS F;  3CC9 A;  2ZY1 A;  4KVY A;  5A0K A;  3DYG A;  5AFX A;  3W7F A;  3NPK A;  3KRF B;  1WL1 A;  5IKH A;  2FOR A;  3OAB B;  3M0G A;  5DGM F;  1HM4 A;  2Z52 A;  1WMW A;  4H5D F;  5ILJ A;  1YHM A;  2F7M F;  4OMG A;  1YV5 A;  4OKZ A;  1YHK A;  3P8R A;  4LA5 A;  4DI5 A;  1VG4 A;  4LLS A;  1HM7 A;  1WL2 A;  3LDW A;  1FPS A;  2AZK A;  2ZCQ A;  5IMP A;  1V4J A;  5B0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...