3N4RA

Structure of csm1 c-terminal domain, r3 form
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
111
structure length
93
Chain Sequence
NSEVIKDLYEYLCNVRVHKSYSGLWFDISQGTYSIMDYKLGFVEVIYAPVLKQRSTEELYSLQSKLPEYMFETLSFPLSSLNQFYNKIAKSLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monopolin complex subunit CSM1
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 20
structure length 93
sequence length 111
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n4rA00
3N4XA 5KTBA 3N7NA 3N4SA 3N4RA
chains in the Genus database with same CATH superfamily
2X5FA 3E6GA 2CJDA 1VEFA 1W3UA 2OKKA 3GZCA 3PD6B 2O0RA 2VYCA 1C0NA 2YKXA 1SZKA 3AEJA 3I4JA 1ELQA 1QIRA 5BJ4A 1OXOA 2QBTA 4A6RA 2D65A 5E3KA 3E2ZA 4W8IA 4TN4A 3FZ7A 2VMOA 1W7NA 3FQ7A 4ZM4A 2CH2A 1I41A 1JF9A 3FFHA 4MSOA 5DB5A 1IX7A 4ZLVA 1WYUB 3LVMA 3Q8NA 3QBOA 3GBXA 4LNMA 1W23A 2W8JA 4GSAA 4JEWA 4EB5A 1MAQA 2BHXA 4U1TA 1AIAA 2W7DA 1WKHA 1GCKA 3WCOA 3P6KA 2OATA 2JJFA 4PIWA 2CJGA 5FT8A 4IX8A 2BKWA 3GR9A 1CZCA 4OCAA 4UHOA 3PDBB 4WBTA 2CY8A 3UE8A 3WGCA 2ZP7A 1IJIA 3CBFA 3JWBA 3T32A 3HL2A 2W8UA 1OATA 5EUNA 2HP2A 4PFNA 4R5ZA 3JWAA 3KGWA 4K2BA 1BJOB 3EI5A 5FT6A 1DGDA 1YOOA 4KXKA 1M0QA 3DODA 2VLHA 3NTJA 3RI6A 1MGVA 2WK9A 3NU8A 1G4XA 4OC9A 4ATQA 4F5GA 3LV2A 2BWNA 3RCHA 3E2FA 1CL1A 3LY1A 4A6UA 3PGYA 4B98A 4KAMA 1LC8A 1RV3A 3WKRA 5HDMA 3NYSA 1AKBA 1IX8A 3LG0A 4GE7A 1UU1A 4IXSA 2ZY3A 4A00A 1AY5A 1QJ3A 2X3LA 3FCRA 3TQXA 1OXPA 3RBFA 1CQ7A 4NOGA 1AMAA 1YIZA 4ZDLA 3W1JA 2ZUKA 4CVQA 3ASBA 1YNUA 3MC6C 4MQPA 1ASDA 2X8UA 4Y0IA 4UOYA 4GE4A 3PDXA 4IYOA 4Q75A 4KYOA 5EIGA 2C0RA 3TFUA 3NX3A 4JF0A 1N8PA 2DR1A 3EIBA 1CL2A 3BCAA 1IVRA 1ASCA 2FKIA 2W7FA 2YCPA 7AATA 4XJOA 4E3RA 1BQDA 3WLXA 4L0OA 1RVUA 1M0OA 2C44A 1IBJA 1ASFA 2Z9VA 3B8XA 5I92A 3COGA 4RKDA 2KFPA 3N7NA 3RQ1A 2GMUA 4H63Q 1WSTA 3MAFB 4ZDPA 4E77A 2QB3A 1C9CA 2FQ6A 2DGLA 2Z1ZA 3A2BA 3PA9A 1RVYA 3G0TA 4A0FA 4RJ0A 2ZC0A 1BJWA 4BA5A 3BCXA 4WYAA 4MY5A 2F8JA 1Z7DA 1KKJA 1WYTA 2D66A 1ORDA 1QJ5A 2VMTA 2BIEA 4JEYA 4ZWMA 5E4ZA 2BI9A 2PB2A 3K40A 2C81A 3FQ8A 4CXRA 2VLFA 1MDXA 4W1WA 1MDZA 2W8TA 4BQ0A 1ARTA 2BI3A 1B4XA 1DJEA 2G7JA 3ELPA 3NNKA 2VI8A 2QSRA 4AOAA 2BIAA 4RM1A 2R2NA 4BMKA 4I8AA 2VGWA 1AHFA 2HP1A 2YKYA 2YCNA 3B1EA 3FVXA 4GEBA 4JEZA 4M2JA 2W8WA 4EU1A 2QMAA 1AY8A 4DQ6A 1C7GA 1GD9A 3HVYA 1JS3A 1PMMA 3BS8A 2WK8A 4ZDOA 3FDDA 3JZLA 1ASMA 2RFVA 2EH6A 1AHXA 3RUYA 1M4NA 4JF1A 4O6ZA 4XJLA 4WLJA 2OGEA 3N4RA 2VMWA 4AZJA 5DJ1A 1GEXA 3D6KA 4R2NA 4A72A 4F5LA 3PD6A 3EI9A 3VK3A 1RV4A 3BN1A 1SVVA 1T3IA 2BI1A 4WB0A 2QA3A 3WKSA 1GC2A 2CJHA 2BIGA 4CXQA 1AJRA 1MLYA 3I16A 4K2MA 4W1XA 1ARGA 4ATPA 4K2IA 1WYUA 5BJ3A 1KL2A 3ATHA 1AKCA 4F5KA 3WY7A 3FVSA 4QGRA 4GDYA 3AEPA 5EQCA 2Z1YA 1QISA 1AMQA 1AKAA 1ASGA 4F5MA 4ZSWA 4U2HA 2JGTA 2VMUA 1GC4A 4A0HA 3CQ6A 3UWCA 3EI8A 1C4KA 4ISYA 4OT8A 2AY9A 2CH1A 2W7IA 3LVJA 1IX6A 1S06A 1CJ0A 2ZSLA 3PJ0A 3W1HA 1D7RA 2OKJA 2CANA 1AMSA 1DJUA 1SFFA 3MC6A 1V2FA 2JJEA 3MBBA 4F5JA 1GC0A 2ZSMA 3DC1A 1BJOA 3ZRRA 2Z9XA 1BJ4A 3DYDA 2W7JA 4A0RA 4Y0DA 3ZZJA 1BS0A 1B8GA 1G7WA 2QLRA 1UKJA 2DKBA 3L8AA 2BYJA 2ZY5A 4W91A 2Z61A 1WYVB 3ELEA 3UAKA 1EJIA 3QPGA 2R5CB 3QI6A 2EZ1A 4LNLA 2D7YA 2R0TA 4H51A 1TASA 5G4JA 3BB8A 2D64A 1SZUA 2CB1A 4GE9A 3F0HA 2GMSA 2D7ZA 1SPAA 3TFTA 1KKPA 1N2TA 4IW7A 1H1CA 2FNIA 1FC4A 4LNJA 4ZSYA 2Z9WA 4R5FA 4MQQA 5EUEA 2VMRA 5G2PA 1V2EA 2PO3A 1D7SA 3A8UX 3FFRA 3FVUA 1QGNA 4EFFA 3N4XA 2YCTA 3FZ6A 4M2MA 2CSTA 2CTZA 3I5TA 3ZZKA 1ECXA 4OMAA 2BWPA 1O69A 2EZ2A 2Q7WA 2JISA 4FFCA 3N0LA 4J5UA 1ARHA 2HZPA 4XQ2A 3HBXA 1LC5A 2VMPA 1GBNA 1Z3ZA 2GSAA 3EI7A 4HF8A 4JEXA 1AHGA 3NUIA 4WXFA 2BI2A 2W7EA 4K05A 5EAAA 1YAAA 3P1TA 2VMXA 3B46A 4UHNA 3H7FA 5D5SA 1MLZA 3MAFA 1GEWA 1V2DA 1TARA 1ARIA 2AY4A 2WKAA 1B5PA 3HMUA 3OKSA 3VOMA 1I29A 3QM2A 1M0NA 2QB2A 5AX8A 1V72A 1H0CA 4OYTA 1E5FA 2YKVA 1D7VA 4RAEA 2G6WA 2W7KA 4WYCA 2W7MA 5HXXA 1UU0A 1LK9A 3QGUA 3GJUA 1SZSA 3HT4A 4RIZA 2PB0A 2VGVA 1Y4IA 3EI6A 2WK7A 3FSLA 3GZDC 1OHVA 2DOUA 1DJ9A 1TOEA 2FM1A 3F6TA 1AHYA 1AX4A 3WX9A 1BQAA 2BWOA 4AZKA 3VK4A 4OBVA 3G8MA 1X29A 2BI5A 4DGTA 3BWNC 1AJSB 1IAXA 4XK1A 1YJYA 4OTLA 8AATA 4W5KA 5EFSA 3A9YA 2HOZA 2VIAA 3H9XA 2W7LA 1KMKA 1KMJA 1GEYA 1EG5A 3MEBA 5EAVA 3FRKA 1S08A 2JJGA 5HHYA 2DKJA 2GB3A 1ASNA 1E5EA 1O4SA 3B1DA 2ZY4A 5KTBA 2W7GA 5K8BA 1BT4A 1DKAA 3MKJA 3JW9A 3E2YA 4ADBA 3FTBA 1O62A 3WCNA 3A9XA 1AICA 2HOXA 4JEVA 4F5IA 1LW5A 4CBSA 1YIYA 1AAWA 1X0MA 3CQ5A 4ADCA 3R4TA 4F5HA 2E7IA 1J32A 3N75A 4UHMA 1D2FA 2YKUA 4ZM3A 4B9BA 3CQ4A 4P7YA 1P3WA 3AENB 4ZWVA 3EZ1A 1DTYA 4RKCA 5G09A 5G4IA 1U08A 3WZFA 4WYGA 2YRIA 1TATA 4RJYA 1X2AA 5EUDA 2C7TA 2XH1A 2VGUA 1GC3A 4BHDA 3TCMA 5M46A 2VMYA 5F8VA 1W7LA 3AEMC 2VMVA 2AY1A 3FKDA 3WGBA 4N0WA 4WP0A 2D63A 4RLGA 3TATA 2DGMA 5D95A 4R8DA 3FDBA 2W8VA 1D7UA 2TPLA 4XJPA 3BWOA 2VMNA 4CBRA 1AMRA 5FT5A 3K28A 1MDOA 4EMYA 1C7OA 4WD2A 3MADA 1GDEA 2FNUA 3PPLA 1BKGA 1OHYA 3PDBA 4WLHA 2ZY2A 4ADDA 2WB6A 3A9ZA 3ASAA 1WYVA 1AHEA 4Q6RA 2R5CA 2A1VA 1C7NA 1IUGA 1AIBA 2EGYA 3GETA 4MQRA 3BV0A 4WB0B 3DXWA 5F9SA 1FG3A 1TPLA 3AATA 3KKIA 5C6UA 3CAIA 4MKKA 5TF5A 1PFFA 4FL0A 1ZOBA 5G2QA 4LW2A 2OQXA 3NYTA 4PVFA 2AY7A 2X5DA 1ASAA 2CINA 3E2ZB 5M4BA 2FN6A 3DR4A 4HVKA 3FQAA 1LC7A 1M0PA 2D5YA 2W7HA 1B5OA 2E54A 2VGSA 1X28A 3B1CA 1S07A 1B9HA 3F9TA 3HQTA 4WYEA 4J8LA 4WXBA 3NU7A 4LC3A 2EO5A 4ITXA 1M7YA 1EQBA 4UQVA 1J04A 3DRDA 3GZDA 1LS3A 2JG2A 2HOYA 3VK2A 2O1BA 3NUBA 1ASEA 2BYLA 1VP4A 2AEVA 2Z20A 3QN6A 3BWNA 1ASLA 2V0YA 2VGTA 3BCBA 4IXOA 4ADEA 2HUIA 3AEJC 1CS1A 1PMOA 2HUFA 3G7QA 1DFOA 3HLMA 1MAPA 3VP6A 3LVKA 4A6TA 2V1PA 1S09A 1W7MA 1YJSA 1WKGA 4F5FA 2CFBA 1G7XA 2YOBA 5M49A 1KL1A 3W1IA 1DGEA 4Q31A 2E7JA 4E1OA 1SF2A 1B9IA 3M5UA 1OHWA 4Y0HA 3EZSA 3N4SA 2HUUA 2XBNA 3RCHB 2HORA 4GRXA 2VIBA 1BJNA 4M2KA 4P3MA 4W1VA 3VAXA 4IY7A 4AO4A 4LW4A 4BA4A 2R5EA 1VJOA 1AJSA 3BC8A 1JG8A 2JJHA 3E9KA 4RITA 5DX5A 3RBLA 5FT4A 2YHKA 3ISLA 3JTXA 4Q76A 4F4EA 1O61A 3KE3A 1TOIA 3OP7A 4TMRA 3USFA 4ITGA 1ASBA 2VMSA 4IYOB 4E3QA 4AO9A 5E5IA 1LW4A 3GSBA 3R9AA 4PFFA 5EIGB 4ZASA 3ZRQA 3AEMA 2ZJGA 1ELUA 3MAUA 1AY4A 2D61A 1TOGA 1ARSA 2AY5A 2AY2A 2VGZA 2VMQA 3LVLB 2VMZA 2AY3A 1S0AA 3AOVA 2AY8A 3ECDA 2Z9UA 1TOJA 2AATA 1KAFA 1QZ9A 3NYUA 3PAAA 4XEWA 1CZEA 3EUCA 4XAUA 3DXVA 3DZZA 3NRAA 1M32A 1LKCA 3AENA 1BW0A 4IXZA 9AATA 1QITA 2EYQA 1IAYA 1UU2A 1AAMA 3FD0A 3ACZA 1CQ6A 1G4VA 1JS6A 3K7YA 4MKJA 1WYTB 5G0AA 3II0A 5J8QA 5M4DA 3N5MA 2E7UA 3AELA 3AV7A 2YRRA 1N31A 3DU4A 1PG8A 3HDOA 2ZYJA 4WYFA 4WYDA 1TOKA 3DR7A 4WXGA 2AY6A 1ZC9A 1I43A 1XI9A 5DJ9A 4EB7A 2OGAA 1ZODA 5IWQA 2GQNA 4A0GA 1M6SA 2EPJA 3NDNA 2NMPA 4DBCA 3EIAA 3FZ8A 1YJZA 2ORDA 1I48A 3L44A 3AEOA 2AEUA 3IHJA 3LWSA 2DGKA 3GWPA 4XJMA 1XEYA 4ZAHA 2FYFA 5JAYA 1CQ8A 2VI9A 3AOWA 3E77A 2O7CA 1FG7A 4AH3A 4OBUA 3KGXA 3ZRPA 3PIUA 3QHXA
chains in the Genus database with same CATH topology
2X5FA 3E6GA 2CJDA 1VEFA 1W3UA 2OKKA 3GZCA 3PD6B 2O0RA 2VYCA 1C0NA 2YKXA 1SZKA 3AEJA 3I4JA 1ELQA 1QIRA 5BJ4A 1OXOA 2QBTA 4A6RA 2D65A 5E3KA 3E2ZA 4W8IA 4TN4A 3FZ7A 2VMOA 1W7NA 3FQ7A 4ZM4A 2CH2A 1I41A 1JF9A 3FFHA 4MSOA 5DB5A 1IX7A 4ZLVA 1WYUB 3LVMA 3Q8NA 3QBOA 3GBXA 4LNMA 1W23A 2W8JA 4GSAA 4JEWA 4EB5A 1MAQA 2BHXA 4U1TA 1AIAA 2W7DA 1WKHA 1GCKA 3WCOA 3P6KA 2OATA 2JJFA 4PIWA 2CJGA 5FT8A 4IX8A 2BKWA 3GR9A 1CZCA 4OCAA 4UHOA 3PDBB 4WBTA 2CY8A 3UE8A 3WGCA 2ZP7A 1IJIA 3CBFA 3JWBA 3T32A 3HL2A 2W8UA 1OATA 5EUNA 2HP2A 4PFNA 4R5ZA 3JWAA 3KGWA 4K2BA 1BJOB 3EI5A 5FT6A 1DGDA 1YOOA 4KXKA 1M0QA 3DODA 2VLHA 3NTJA 3RI6A 1MGVA 2WK9A 3NU8A 1G4XA 4OC9A 4ATQA 4F5GA 3LV2A 2BWNA 3RCHA 3E2FA 1CL1A 3LY1A 4A6UA 3PGYA 4B98A 4KAMA 1LC8A 1RV3A 3WKRA 5HDMA 3NYSA 1AKBA 1IX8A 3LG0A 4GE7A 1UU1A 4IXSA 2ZY3A 4A00A 1AY5A 1QJ3A 2X3LA 3FCRA 3TQXA 1OXPA 3RBFA 1CQ7A 4NOGA 1AMAA 1YIZA 4ZDLA 3W1JA 2ZUKA 4CVQA 3ASBA 1YNUA 3MC6C 4MQPA 1ASDA 2X8UA 4Y0IA 4UOYA 4GE4A 3PDXA 4IYOA 4Q75A 4KYOA 5EIGA 2C0RA 3TFUA 3NX3A 4JF0A 1N8PA 2DR1A 3EIBA 1CL2A 3BCAA 1IVRA 1ASCA 2FKIA 2W7FA 2YCPA 7AATA 4XJOA 4E3RA 1BQDA 3WLXA 4L0OA 1RVUA 1M0OA 2C44A 1IBJA 1ASFA 2Z9VA 3B8XA 5I92A 3COGA 4RKDA 2KFPA 3N7NA 3RQ1A 2GMUA 4H63Q 1WSTA 3MAFB 4ZDPA 4E77A 2QB3A 1C9CA 2FQ6A 2DGLA 2Z1ZA 3A2BA 3PA9A 1RVYA 3G0TA 4A0FA 4RJ0A 2ZC0A 1BJWA 4BA5A 3BCXA 4WYAA 4MY5A 2F8JA 1Z7DA 1KKJA 1WYTA 2D66A 1ORDA 1QJ5A 2VMTA 2BIEA 4JEYA 4ZWMA 5E4ZA 2BI9A 2PB2A 3K40A 2C81A 3FQ8A 4CXRA 2VLFA 1MDXA 4W1WA 1MDZA 2W8TA 4BQ0A 1ARTA 2BI3A 1B4XA 1DJEA 2G7JA 3ELPA 3NNKA 2VI8A 2QSRA 4AOAA 2BIAA 4RM1A 2R2NA 4BMKA 4I8AA 2VGWA 1AHFA 2HP1A 2YKYA 2YCNA 3B1EA 3FVXA 4GEBA 4JEZA 4M2JA 2W8WA 4EU1A 2QMAA 1AY8A 4DQ6A 1C7GA 1GD9A 3HVYA 1JS3A 1PMMA 3BS8A 2WK8A 4ZDOA 3FDDA 3JZLA 1ASMA 2RFVA 2EH6A 1AHXA 3RUYA 1M4NA 4JF1A 4O6ZA 4XJLA 4WLJA 2OGEA 3N4RA 2VMWA 4AZJA 5DJ1A 1GEXA 3D6KA 4R2NA 4A72A 4F5LA 3PD6A 3EI9A 3VK3A 1RV4A 3BN1A 1SVVA 1T3IA 2BI1A 4WB0A 2QA3A 3WKSA 1GC2A 2CJHA 2BIGA 4CXQA 1AJRA 1MLYA 3I16A 4K2MA 4W1XA 1ARGA 4ATPA 4K2IA 1WYUA 5BJ3A 1KL2A 3ATHA 1AKCA 4F5KA 3WY7A 3FVSA 4QGRA 4GDYA 3AEPA 5EQCA 2Z1YA 1QISA 1AMQA 1AKAA 1ASGA 4F5MA 4ZSWA 4U2HA 2JGTA 2VMUA 1GC4A 4A0HA 3CQ6A 3UWCA 3EI8A 1C4KA 4ISYA 4OT8A 2AY9A 2CH1A 2W7IA 3LVJA 1IX6A 1S06A 1CJ0A 2ZSLA 3PJ0A 3W1HA 1D7RA 2OKJA 2CANA 1AMSA 1DJUA 1SFFA 3MC6A 1V2FA 2JJEA 3MBBA 4F5JA 1GC0A 2ZSMA 3DC1A 1BJOA 3ZRRA 2Z9XA 1BJ4A 3DYDA 2W7JA 4A0RA 4Y0DA 3ZZJA 1BS0A 1B8GA 1G7WA 2QLRA 1UKJA 2DKBA 3L8AA 2BYJA 2ZY5A 4W91A 2Z61A 1WYVB 3ELEA 3UAKA 1EJIA 3QPGA 2R5CB 3QI6A 2EZ1A 4LNLA 2D7YA 2R0TA 4H51A 1TASA 5G4JA 3BB8A 2D64A 1SZUA 2CB1A 4GE9A 3F0HA 2GMSA 2D7ZA 1SPAA 3TFTA 1KKPA 1N2TA 4IW7A 1H1CA 2FNIA 1FC4A 4LNJA 4ZSYA 2Z9WA 4R5FA 4MQQA 5EUEA 2VMRA 5G2PA 1V2EA 2PO3A 1D7SA 3A8UX 3FFRA 3FVUA 1QGNA 4EFFA 3N4XA 2YCTA 3FZ6A 4M2MA 2CSTA 2CTZA 3I5TA 3ZZKA 1ECXA 4OMAA 2BWPA 1O69A 2EZ2A 2Q7WA 2JISA 4FFCA 3N0LA 4J5UA 1ARHA 2HZPA 4XQ2A 3HBXA 1LC5A 2VMPA 1GBNA 1Z3ZA 2GSAA 3EI7A 4HF8A 4JEXA 1AHGA 3NUIA 4WXFA 2BI2A 2W7EA 4K05A 5EAAA 1YAAA 3P1TA 2VMXA 3B46A 4UHNA 3H7FA 5D5SA 1MLZA 3MAFA 1GEWA 1V2DA 1TARA 1ARIA 2AY4A 2WKAA 1B5PA 3HMUA 3OKSA 3VOMA 1I29A 3QM2A 1M0NA 2QB2A 5AX8A 1V72A 1H0CA 4OYTA 1E5FA 2YKVA 1D7VA 4RAEA 2G6WA 2W7KA 4WYCA 2W7MA 5HXXA 1UU0A 1LK9A 3QGUA 3GJUA 1SZSA 3HT4A 4RIZA 2PB0A 2VGVA 1Y4IA 3EI6A 2WK7A 3FSLA 3GZDC 1OHVA 2DOUA 1DJ9A 1TOEA 2FM1A 3F6TA 1AHYA 1AX4A 3WX9A 1BQAA 2BWOA 4AZKA 3VK4A 4OBVA 3G8MA 1X29A 2BI5A 4DGTA 3BWNC 1AJSB 1IAXA 4XK1A 1YJYA 4OTLA 8AATA 4W5KA 5EFSA 3A9YA 2HOZA 2VIAA 3H9XA 2W7LA 1KMKA 1KMJA 1GEYA 1EG5A 3MEBA 5EAVA 3FRKA 1S08A 2JJGA 5HHYA 2DKJA 2GB3A 1ASNA 1E5EA 1O4SA 3B1DA 2ZY4A 5KTBA 2W7GA 5K8BA 1BT4A 1DKAA 3MKJA 3JW9A 3E2YA 4ADBA 3FTBA 1O62A 3WCNA 3A9XA 1AICA 2HOXA 4JEVA 4F5IA 1LW5A 4CBSA 1YIYA 1AAWA 1X0MA 3CQ5A 4ADCA 3R4TA 4F5HA 2E7IA 1J32A 3N75A 4UHMA 1D2FA 2YKUA 4ZM3A 4B9BA 3CQ4A 4P7YA 1P3WA 3AENB 4ZWVA 3EZ1A 1DTYA 4RKCA 5G09A 5G4IA 1U08A 3WZFA 4WYGA 2YRIA 1TATA 4RJYA 1X2AA 5EUDA 2C7TA 2XH1A 2VGUA 1GC3A 4BHDA 3TCMA 5M46A 2VMYA 5F8VA 1W7LA 3AEMC 2VMVA 2AY1A 3FKDA 3WGBA 4N0WA 4WP0A 2D63A 4RLGA 3TATA 2DGMA 5D95A 4R8DA 3FDBA 2W8VA 1D7UA 2TPLA 4XJPA 3BWOA 2VMNA 4CBRA 1AMRA 5FT5A 3K28A 1MDOA 4EMYA 1C7OA 4WD2A 3MADA 1GDEA 2FNUA 3PPLA 1BKGA 1OHYA 3PDBA 4WLHA 2ZY2A 4ADDA 2WB6A 3A9ZA 3ASAA 1WYVA 1AHEA 4Q6RA 2R5CA 2A1VA 1C7NA 1IUGA 1AIBA 2EGYA 3GETA 4MQRA 3BV0A 4WB0B 3DXWA 5F9SA 1FG3A 1TPLA 3AATA 3KKIA 5C6UA 3CAIA 4MKKA 5TF5A 1PFFA 4FL0A 1ZOBA 5G2QA 4LW2A 2OQXA 3NYTA 4PVFA 2AY7A 2X5DA 1ASAA 2CINA 3E2ZB 5M4BA 2FN6A 3DR4A 4HVKA 3FQAA 1LC7A 1M0PA 2D5YA 2W7HA 1B5OA 2E54A 2VGSA 1X28A 3B1CA 1S07A 1B9HA 3F9TA 3HQTA 4WYEA 4J8LA 4WXBA 3NU7A 4LC3A 2EO5A 4ITXA 1M7YA 1EQBA 4UQVA 1J04A 3DRDA 3GZDA 1LS3A 2JG2A 2HOYA 3VK2A 2O1BA 3NUBA 1ASEA 2BYLA 1VP4A 2AEVA 2Z20A 3QN6A 3BWNA 1ASLA 2V0YA 2VGTA 3BCBA 4IXOA 4ADEA 2HUIA 3AEJC 1CS1A 1PMOA 2HUFA 3G7QA 1DFOA 3HLMA 1MAPA 3VP6A 3LVKA 4A6TA 2V1PA 1S09A 1W7MA 1YJSA 1WKGA 4F5FA 2CFBA 1G7XA 2YOBA 5M49A 1KL1A 3W1IA 1DGEA 4Q31A 2E7JA 4E1OA 1SF2A 1B9IA 3M5UA 1OHWA 4Y0HA 3EZSA 3N4SA 2HUUA 2XBNA 3RCHB 2HORA 4GRXA 2VIBA 1BJNA 4M2KA 4P3MA 4W1VA 3VAXA 4IY7A 4AO4A 4LW4A 4BA4A 2R5EA 1VJOA 1AJSA 3BC8A 1JG8A 2JJHA 3E9KA 4RITA 5DX5A 3RBLA 5FT4A 2YHKA 3ISLA 3JTXA 4Q76A 4F4EA 1O61A 3KE3A 1TOIA 3OP7A 4TMRA 3USFA 4ITGA 1ASBA 2VMSA 4IYOB 4E3QA 4AO9A 5E5IA 1LW4A 3GSBA 3R9AA 4PFFA 5EIGB 4ZASA 3ZRQA 3AEMA 2ZJGA 1ELUA 3MAUA 1AY4A 2D61A 1TOGA 1ARSA 2AY5A 2AY2A 2VGZA 2VMQA 3LVLB 2VMZA 2AY3A 1S0AA 3AOVA 2AY8A 3ECDA 2Z9UA 1TOJA 2AATA 1QZ9A 3NYUA 4XEWA 3PAAA 1CZEA 3EUCA 4XAUA 3DXVA 3DZZA 3NRAA 1M32A 1LKCA 3AENA 1BW0A 4IXZA 9AATA 1QITA 2EYQA 1IAYA 1UU2A 1AAMA 3FD0A 3ACZA 1CQ6A 1G4VA 1JS6A 3K7YA 4MKJA 1WYTB 5G0AA 3II0A 5J8QA 5M4DA 3N5MA 2E7UA 3AELA 3AV7A 2YRRA 1N31A 3DU4A 1PG8A 3HDOA 2ZYJA 4WYFA 4WYDA 1TOKA 3DR7A 4WXGA 2AY6A 1ZC9A 1I43A 1XI9A 5DJ9A 4EB7A 2OGAA 1ZODA 5IWQA 2GQNA 4A0GA 1M6SA 2EPJA 3NDNA 2NMPA 4DBCA 3EIAA 3FZ8A 1YJZA 2ORDA 1I48A 3L44A 3AEOA 2AEUA 3IHJA 3LWSA 2DGKA 3GWPA 4XJMA 1XEYA 4ZAHA 2FYFA 5JAYA 1CQ8A 2VI9A 3AOWA 3E77A 2O7CA 1FG7A 4AH3A 4OBUA 3KGXA 3ZRPA 3PIUA 3QHXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N4X A;  5KTB A;  3N7N A;  3N4S A;  3N4R A; 
#chains in the Genus database with same CATH topology
 2X5F A;  3E6G A;  2CJD A;  1VEF A;  1W3U A;  2OKK A;  3GZC A;  3PD6 B;  2O0R A;  2VYC A;  1C0N A;  2YKX A;  1SZK A;  3AEJ A;  3I4J A;  1ELQ A;  1QIR A;  5BJ4 A;  1OXO A;  2QBT A;  4A6R A;  2D65 A;  5E3K A;  3E2Z A;  4W8I A;  4TN4 A;  3FZ7 A;  2VMO A;  1W7N A;  3FQ7 A;  4ZM4 A;  2CH2 A;  1I41 A;  1JF9 A;  3FFH A;  4MSO A;  5DB5 A;  1IX7 A;  4ZLV A;  1WYU B;  3LVM A;  3Q8N A;  3QBO A;  3GBX A;  4LNM A;  1W23 A;  2W8J A;  4GSA A;  4JEW A;  4EB5 A;  1MAQ A;  2BHX A;  4U1T A;  1AIA A;  2W7D A;  1WKH A;  1GCK A;  3WCO A;  3P6K A;  2OAT A;  2JJF A;  4PIW A;  2CJG A;  5FT8 A;  4IX8 A;  2BKW A;  3GR9 A;  1CZC A;  4OCA A;  4UHO A;  3PDB B;  4WBT A;  2CY8 A;  3UE8 A;  3WGC A;  2ZP7 A;  1IJI A;  3CBF A;  3JWB A;  3T32 A;  3HL2 A;  2W8U A;  1OAT A;  5EUN A;  2HP2 A;  4PFN A;  4R5Z A;  3JWA A;  3KGW A;  4K2B A;  1BJO B;  3EI5 A;  5FT6 A;  1DGD A;  1YOO A;  4KXK A;  1M0Q A;  3DOD A;  2VLH A;  3NTJ A;  3RI6 A;  1MGV A;  2WK9 A;  3NU8 A;  1G4X A;  4OC9 A;  4ATQ A;  4F5G A;  3LV2 A;  2BWN A;  3RCH A;  3E2F A;  1CL1 A;  3LY1 A;  4A6U A;  3PGY A;  4B98 A;  4KAM A;  1LC8 A;  1RV3 A;  3WKR A;  5HDM A;  3NYS A;  1AKB A;  1IX8 A;  3LG0 A;  4GE7 A;  1UU1 A;  4IXS A;  2ZY3 A;  4A00 A;  1AY5 A;  1QJ3 A;  2X3L A;  3FCR A;  3TQX A;  1OXP A;  3RBF A;  1CQ7 A;  4NOG A;  1AMA A;  1YIZ A;  4ZDL A;  3W1J A;  2ZUK A;  4CVQ A;  3ASB A;  1YNU A;  3MC6 C;  4MQP A;  1ASD A;  2X8U A;  4Y0I A;  4UOY A;  4GE4 A;  3PDX A;  4IYO A;  4Q75 A;  4KYO A;  5EIG A;  2C0R A;  3TFU A;  3NX3 A;  4JF0 A;  1N8P A;  2DR1 A;  3EIB A;  1CL2 A;  3BCA A;  1IVR A;  1ASC A;  2FKI A;  2W7F A;  2YCP A;  7AAT A;  4XJO A;  4E3R A;  1BQD A;  3WLX A;  4L0O A;  1RVU A;  1M0O A;  2C44 A;  1IBJ A;  1ASF A;  2Z9V A;  3B8X A;  5I92 A;  3COG A;  4RKD A;  2KFP A;  3N7N A;  3RQ1 A;  2GMU A;  4H63 Q;  1WST A;  3MAF B;  4ZDP A;  4E77 A;  2QB3 A;  1C9C A;  2FQ6 A;  2DGL A;  2Z1Z A;  3A2B A;  3PA9 A;  1RVY A;  3G0T A;  4A0F A;  4RJ0 A;  2ZC0 A;  1BJW A;  4BA5 A;  3BCX A;  4WYA A;  4MY5 A;  2F8J A;  1Z7D A;  1KKJ A;  1WYT A;  2D66 A;  1ORD A;  1QJ5 A;  2VMT A;  2BIE A;  4JEY A;  4ZWM A;  5E4Z A;  2BI9 A;  2PB2 A;  3K40 A;  2C81 A;  3FQ8 A;  4CXR A;  2VLF A;  1MDX A;  4W1W A;  1MDZ A;  2W8T A;  4BQ0 A;  1ART A;  2BI3 A;  1B4X A;  1DJE A;  2G7J A;  3ELP A;  3NNK A;  2VI8 A;  2QSR A;  4AOA A;  2BIA A;  4RM1 A;  2R2N A;  4BMK A;  4I8A A;  2VGW A;  1AHF A;  2HP1 A;  2YKY A;  2YCN A;  3B1E A;  3FVX A;  4GEB A;  4JEZ A;  4M2J A;  2W8W A;  4EU1 A;  2QMA A;  1AY8 A;  4DQ6 A;  1C7G A;  1GD9 A;  3HVY A;  1JS3 A;  1PMM A;  3BS8 A;  2WK8 A;  4ZDO A;  3FDD A;  3JZL A;  1ASM A;  2RFV A;  2EH6 A;  1AHX A;  3RUY A;  1M4N A;  4JF1 A;  4O6Z A;  4XJL A;  4WLJ A;  2OGE A;  3N4R A;  2VMW A;  4AZJ A;  5DJ1 A;  1GEX A;  3D6K A;  4R2N A;  4A72 A;  4F5L A;  3PD6 A;  3EI9 A;  3VK3 A;  1RV4 A;  3BN1 A;  1SVV A;  1T3I A;  2BI1 A;  4WB0 A;  2QA3 A;  3WKS A;  1GC2 A;  2CJH A;  2BIG A;  4CXQ A;  1AJR A;  1MLY A;  3I16 A;  4K2M A;  4W1X A;  1ARG A;  4ATP A;  4K2I A;  1WYU A;  5BJ3 A;  1KL2 A;  3ATH A;  1AKC A;  4F5K A;  3WY7 A;  3FVS A;  4QGR A;  4GDY A;  3AEP A;  5EQC A;  2Z1Y A;  1QIS A;  1AMQ A;  1AKA A;  1ASG A;  4F5M A;  4ZSW A;  4U2H A;  2JGT A;  2VMU A;  1GC4 A;  4A0H A;  3CQ6 A;  3UWC A;  3EI8 A;  1C4K A;  4ISY A;  4OT8 A;  2AY9 A;  2CH1 A;  2W7I A;  3LVJ A;  1IX6 A;  1S06 A;  1CJ0 A;  2ZSL A;  3PJ0 A;  3W1H A;  1D7R A;  2OKJ A;  2CAN A;  1AMS A;  1DJU A;  1SFF A;  3MC6 A;  1V2F A;  2JJE A;  3MBB A;  4F5J A;  1GC0 A;  2ZSM A;  3DC1 A;  1BJO A;  3ZRR A;  2Z9X A;  1BJ4 A;  3DYD A;  2W7J A;  4A0R A;  4Y0D A;  3ZZJ A;  1BS0 A;  1B8G A;  1G7W A;  2QLR A;  1UKJ A;  2DKB A;  3L8A A;  2BYJ A;  2ZY5 A;  4W91 A;  2Z61 A;  1WYV B;  3ELE A;  3UAK A;  1EJI A;  3QPG A;  2R5C B;  3QI6 A;  2EZ1 A;  4LNL A;  2D7Y A;  2R0T A;  4H51 A;  1TAS A;  5G4J A;  3BB8 A;  2D64 A;  1SZU A;  2CB1 A;  4GE9 A;  3F0H A;  2GMS A;  2D7Z A;  1SPA A;  3TFT A;  1KKP A;  1N2T A;  4IW7 A;  1H1C A;  2FNI A;  1FC4 A;  4LNJ A;  4ZSY A;  2Z9W A;  4R5F A;  4MQQ A;  5EUE A;  2VMR A;  5G2P A;  1V2E A;  2PO3 A;  1D7S A;  3A8U X;  3FFR A;  3FVU A;  1QGN A;  4EFF A;  3N4X A;  2YCT A;  3FZ6 A;  4M2M A;  2CST A;  2CTZ A;  3I5T A;  3ZZK A;  1ECX A;  4OMA A;  2BWP A;  1O69 A;  2EZ2 A;  2Q7W A;  2JIS A;  4FFC A;  3N0L A;  4J5U A;  1ARH A;  2HZP A;  4XQ2 A;  3HBX A;  1LC5 A;  2VMP A;  1GBN A;  1Z3Z A;  2GSA A;  3EI7 A;  4HF8 A;  4JEX A;  1AHG A;  3NUI A;  4WXF A;  2BI2 A;  2W7E A;  4K05 A;  5EAA A;  1YAA A;  3P1T A;  2VMX A;  3B46 A;  4UHN A;  3H7F A;  5D5S A;  1MLZ A;  3MAF A;  1GEW A;  1V2D A;  1TAR A;  1ARI A;  2AY4 A;  2WKA A;  1B5P A;  3HMU A;  3OKS A;  3VOM A;  1I29 A;  3QM2 A;  1M0N A;  2QB2 A;  5AX8 A;  1V72 A;  1H0C A;  4OYT A;  1E5F A;  2YKV A;  1D7V A;  4RAE A;  2G6W A;  2W7K A;  4WYC A;  2W7M A;  5HXX A;  1UU0 A;  1LK9 A;  3QGU A;  3GJU A;  1SZS A;  3HT4 A;  4RIZ A;  2PB0 A;  2VGV A;  1Y4I A;  3EI6 A;  2WK7 A;  3FSL A;  3GZD C;  1OHV A;  2DOU A;  1DJ9 A;  1TOE A;  2FM1 A;  3F6T A;  1AHY A;  1AX4 A;  3WX9 A;  1BQA A;  2BWO A;  4AZK A;  3VK4 A;  4OBV A;  3G8M A;  1X29 A;  2BI5 A;  4DGT A;  3BWN C;  1AJS B;  1IAX A;  4XK1 A;  1YJY A;  4OTL A;  8AAT A;  4W5K A;  5EFS A;  3A9Y A;  2HOZ A;  2VIA A;  3H9X A;  2W7L A;  1KMK A;  1KMJ A;  1GEY A;  1EG5 A;  3MEB A;  5EAV A;  3FRK A;  1S08 A;  2JJG A;  5HHY A;  2DKJ A;  2GB3 A;  1ASN A;  1E5E A;  1O4S A;  3B1D A;  2ZY4 A;  5KTB A;  2W7G A;  5K8B A;  1BT4 A;  1DKA A;  3MKJ A;  3JW9 A;  3E2Y A;  4ADB A;  3FTB A;  1O62 A;  3WCN A;  3A9X A;  1AIC A;  2HOX A;  4JEV A;  4F5I A;  1LW5 A;  4CBS A;  1YIY A;  1AAW A;  1X0M A;  3CQ5 A;  4ADC A;  3R4T A;  4F5H A;  2E7I A;  1J32 A;  3N75 A;  4UHM A;  1D2F A;  2YKU A;  4ZM3 A;  4B9B A;  3CQ4 A;  4P7Y A;  1P3W A;  3AEN B;  4ZWV A;  3EZ1 A;  1DTY A;  4RKC A;  5G09 A;  5G4I A;  1U08 A;  3WZF A;  4WYG A;  2YRI A;  1TAT A;  4RJY A;  1X2A A;  5EUD A;  2C7T A;  2XH1 A;  2VGU A;  1GC3 A;  4BHD A;  3TCM A;  5M46 A;  2VMY A;  5F8V A;  1W7L A;  3AEM C;  2VMV A;  2AY1 A;  3FKD A;  3WGB A;  4N0W A;  4WP0 A;  2D63 A;  4RLG A;  3TAT A;  2DGM A;  5D95 A;  4R8D A;  3FDB A;  2W8V A;  1D7U A;  2TPL A;  4XJP A;  3BWO A;  2VMN A;  4CBR A;  1AMR A;  5FT5 A;  3K28 A;  1MDO A;  4EMY A;  1C7O A;  4WD2 A;  3MAD A;  1GDE A;  2FNU A;  3PPL A;  1BKG A;  1OHY A;  3PDB A;  4WLH A;  2ZY2 A;  4ADD A;  2WB6 A;  3A9Z A;  3ASA A;  1WYV A;  1AHE A;  4Q6R A;  2R5C A;  2A1V A;  1C7N A;  1IUG A;  1AIB A;  2EGY A;  3GET A;  4MQR A;  3BV0 A;  4WB0 B;  3DXW A;  5F9S A;  1FG3 A;  1TPL A;  3AAT A;  3KKI A;  5C6U A;  3CAI A;  4MKK A;  5TF5 A;  1PFF A;  4FL0 A;  1ZOB A;  5G2Q A;  4LW2 A;  2OQX A;  3NYT A;  4PVF A;  2AY7 A;  2X5D A;  1ASA A;  2CIN A;  3E2Z B;  5M4B A;  2FN6 A;  3DR4 A;  4HVK A;  3FQA A;  1LC7 A;  1M0P A;  2D5Y A;  2W7H A;  1B5O A;  2E54 A;  2VGS A;  1X28 A;  3B1C A;  1S07 A;  1B9H A;  3F9T A;  3HQT A;  4WYE A;  4J8L A;  4WXB A;  3NU7 A;  4LC3 A;  2EO5 A;  4ITX A;  1M7Y A;  1EQB A;  4UQV A;  1J04 A;  3DRD A;  3GZD A;  1LS3 A;  2JG2 A;  2HOY A;  3VK2 A;  2O1B A;  3NUB A;  1ASE A;  2BYL A;  1VP4 A;  2AEV A;  2Z20 A;  3QN6 A;  3BWN A;  1ASL A;  2V0Y A;  2VGT A;  3BCB A;  4IXO A;  4ADE A;  2HUI A;  3AEJ C;  1CS1 A;  1PMO A;  2HUF A;  3G7Q A;  1DFO A;  3HLM A;  1MAP A;  3VP6 A;  3LVK A;  4A6T A;  2V1P A;  1S09 A;  1W7M A;  1YJS A;  1WKG A;  4F5F A;  2CFB A;  1G7X A;  2YOB A;  5M49 A;  1KL1 A;  3W1I A;  1DGE A;  4Q31 A;  2E7J A;  4E1O A;  1SF2 A;  1B9I A;  3M5U A;  1OHW A;  4Y0H A;  3EZS A;  3N4S A;  2HUU A;  2XBN A;  3RCH B;  2HOR A;  4GRX A;  2VIB A;  1BJN A;  4M2K A;  4P3M A;  4W1V A;  3VAX A;  4IY7 A;  4AO4 A;  4LW4 A;  4BA4 A;  2R5E A;  1VJO A;  1AJS A;  3BC8 A;  1JG8 A;  2JJH A;  3E9K A;  4RIT A;  5DX5 A;  3RBL A;  5FT4 A;  2YHK A;  3ISL A;  3JTX A;  4Q76 A;  4F4E A;  1O61 A;  3KE3 A;  1TOI A;  3OP7 A;  4TMR A;  3USF A;  4ITG A;  1ASB A;  2VMS A;  4IYO B;  4E3Q A;  4AO9 A;  5E5I A;  1LW4 A;  3GSB A;  3R9A A;  4PFF A;  5EIG B;  4ZAS A;  3ZRQ A;  3AEM A;  2ZJG A;  1ELU A;  3MAU A;  1AY4 A;  2D61 A;  1TOG A;  1ARS A;  2AY5 A;  2AY2 A;  2VGZ A;  2VMQ A;  3LVL B;  2VMZ A;  2AY3 A;  1S0A A;  3AOV A;  2AY8 A;  3ECD A;  2Z9U A;  1TOJ A;  2AAT A;  1KAF A;  1QZ9 A;  3NYU A;  3PAA A;  4XEW A;  1CZE A;  3EUC A;  4XAU A;  3DXV A;  3DZZ A;  3NRA A;  1M32 A;  1LKC A;  3AEN A;  1BW0 A;  4IXZ A;  9AAT A;  1QIT A;  2EYQ A;  1IAY A;  1UU2 A;  1AAM A;  3FD0 A;  3ACZ A;  1CQ6 A;  1G4V A;  1JS6 A;  3K7Y A;  4MKJ A;  1WYT B;  5G0A A;  3II0 A;  5J8Q A;  5M4D A;  3N5M A;  2E7U A;  3AEL A;  3AV7 A;  2YRR A;  1N31 A;  3DU4 A;  1PG8 A;  3HDO A;  2ZYJ A;  4WYF A;  4WYD A;  1TOK A;  3DR7 A;  4WXG A;  2AY6 A;  1ZC9 A;  1I43 A;  1XI9 A;  5DJ9 A;  4EB7 A;  2OGA A;  1ZOD A;  5IWQ A;  2GQN A;  4A0G A;  1M6S A;  2EPJ A;  3NDN A;  2NMP A;  4DBC A;  3EIA A;  3FZ8 A;  1YJZ A;  2ORD A;  1I48 A;  3L44 A;  3AEO A;  2AEU A;  3IHJ A;  3LWS A;  2DGK A;  3GWP A;  4XJM A;  1XEY A;  4ZAH A;  2FYF A;  5JAY A;  1CQ8 A;  2VI9 A;  3AOW A;  3E77 A;  2O7C A;  1FG7 A;  4AH3 A;  4OBU A;  3KGX A;  3ZRP A;  3PIU A;  3QHX A; 
#chains in the Genus database with same CATH homology
 2X5F A;  3E6G A;  2CJD A;  1VEF A;  1W3U A;  2OKK A;  3GZC A;  3PD6 B;  2O0R A;  2VYC A;  1C0N A;  2YKX A;  1SZK A;  3AEJ A;  3I4J A;  1ELQ A;  1QIR A;  5BJ4 A;  1OXO A;  2QBT A;  4A6R A;  2D65 A;  5E3K A;  3E2Z A;  4W8I A;  4TN4 A;  3FZ7 A;  2VMO A;  1W7N A;  3FQ7 A;  4ZM4 A;  2CH2 A;  1I41 A;  1JF9 A;  3FFH A;  4MSO A;  5DB5 A;  1IX7 A;  4ZLV A;  1WYU B;  3LVM A;  3Q8N A;  3QBO A;  3GBX A;  4LNM A;  1W23 A;  2W8J A;  4GSA A;  4JEW A;  4EB5 A;  1MAQ A;  2BHX A;  4U1T A;  1AIA A;  2W7D A;  1WKH A;  1GCK A;  3WCO A;  3P6K A;  2OAT A;  2JJF A;  4PIW A;  2CJG A;  5FT8 A;  4IX8 A;  2BKW A;  3GR9 A;  1CZC A;  4OCA A;  4UHO A;  3PDB B;  4WBT A;  2CY8 A;  3UE8 A;  3WGC A;  2ZP7 A;  1IJI A;  3CBF A;  3JWB A;  3T32 A;  3HL2 A;  2W8U A;  1OAT A;  5EUN A;  2HP2 A;  4PFN A;  4R5Z A;  3JWA A;  3KGW A;  4K2B A;  1BJO B;  3EI5 A;  5FT6 A;  1DGD A;  1YOO A;  4KXK A;  1M0Q A;  3DOD A;  2VLH A;  3NTJ A;  3RI6 A;  1MGV A;  2WK9 A;  3NU8 A;  1G4X A;  4OC9 A;  4ATQ A;  4F5G A;  3LV2 A;  2BWN A;  3RCH A;  3E2F A;  1CL1 A;  3LY1 A;  4A6U A;  3PGY A;  4B98 A;  4KAM A;  1LC8 A;  1RV3 A;  3WKR A;  5HDM A;  3NYS A;  1AKB A;  1IX8 A;  3LG0 A;  4GE7 A;  1UU1 A;  4IXS A;  2ZY3 A;  4A00 A;  1AY5 A;  1QJ3 A;  2X3L A;  3FCR A;  3TQX A;  1OXP A;  3RBF A;  1CQ7 A;  4NOG A;  1AMA A;  1YIZ A;  4ZDL A;  3W1J A;  2ZUK A;  4CVQ A;  3ASB A;  1YNU A;  3MC6 C;  4MQP A;  1ASD A;  2X8U A;  4Y0I A;  4UOY A;  4GE4 A;  3PDX A;  4IYO A;  4Q75 A;  4KYO A;  5EIG A;  2C0R A;  3TFU A;  3NX3 A;  4JF0 A;  1N8P A;  2DR1 A;  3EIB A;  1CL2 A;  3BCA A;  1IVR A;  1ASC A;  2FKI A;  2W7F A;  2YCP A;  7AAT A;  4XJO A;  4E3R A;  1BQD A;  3WLX A;  4L0O A;  1RVU A;  1M0O A;  2C44 A;  1IBJ A;  1ASF A;  2Z9V A;  3B8X A;  5I92 A;  3COG A;  4RKD A;  2KFP A;  3N7N A;  3RQ1 A;  2GMU A;  4H63 Q;  1WST A;  3MAF B;  4ZDP A;  4E77 A;  2QB3 A;  1C9C A;  2FQ6 A;  2DGL A;  2Z1Z A;  3A2B A;  3PA9 A;  1RVY A;  3G0T A;  4A0F A;  4RJ0 A;  2ZC0 A;  1BJW A;  4BA5 A;  3BCX A;  4WYA A;  4MY5 A;  2F8J A;  1Z7D A;  1KKJ A;  1WYT A;  2D66 A;  1ORD A;  1QJ5 A;  2VMT A;  2BIE A;  4JEY A;  4ZWM A;  5E4Z A;  2BI9 A;  2PB2 A;  3K40 A;  2C81 A;  3FQ8 A;  4CXR A;  2VLF A;  1MDX A;  4W1W A;  1MDZ A;  2W8T A;  4BQ0 A;  1ART A;  2BI3 A;  1B4X A;  1DJE A;  2G7J A;  3ELP A;  3NNK A;  2VI8 A;  2QSR A;  4AOA A;  2BIA A;  4RM1 A;  2R2N A;  4BMK A;  4I8A A;  2VGW A;  1AHF A;  2HP1 A;  2YKY A;  2YCN A;  3B1E A;  3FVX A;  4GEB A;  4JEZ A;  4M2J A;  2W8W A;  4EU1 A;  2QMA A;  1AY8 A;  4DQ6 A;  1C7G A;  1GD9 A;  3HVY A;  1JS3 A;  1PMM A;  3BS8 A;  2WK8 A;  4ZDO A;  3FDD A;  3JZL A;  1ASM A;  2RFV A;  2EH6 A;  1AHX A;  3RUY A;  1M4N A;  4JF1 A;  4O6Z A;  4XJL A;  4WLJ A;  2OGE A;  3N4R A;  2VMW A;  4AZJ A;  5DJ1 A;  1GEX A;  3D6K A;  4R2N A;  4A72 A;  4F5L A;  3PD6 A;  3EI9 A;  3VK3 A;  1RV4 A;  3BN1 A;  1SVV A;  1T3I A;  2BI1 A;  4WB0 A;  2QA3 A;  3WKS A;  1GC2 A;  2CJH A;  2BIG A;  4CXQ A;  1AJR A;  1MLY A;  3I16 A;  4K2M A;  4W1X A;  1ARG A;  4ATP A;  4K2I A;  1WYU A;  5BJ3 A;  1KL2 A;  3ATH A;  1AKC A;  4F5K A;  3WY7 A;  3FVS A;  4QGR A;  4GDY A;  3AEP A;  5EQC A;  2Z1Y A;  1QIS A;  1AMQ A;  1AKA A;  1ASG A;  4F5M A;  4ZSW A;  4U2H A;  2JGT A;  2VMU A;  1GC4 A;  4A0H A;  3CQ6 A;  3UWC A;  3EI8 A;  1C4K A;  4ISY A;  4OT8 A;  2AY9 A;  2CH1 A;  2W7I A;  3LVJ A;  1IX6 A;  1S06 A;  1CJ0 A;  2ZSL A;  3PJ0 A;  3W1H A;  1D7R A;  2OKJ A;  2CAN A;  1AMS A;  1DJU A;  1SFF A;  3MC6 A;  1V2F A;  2JJE A;  3MBB A;  4F5J A;  1GC0 A;  2ZSM A;  3DC1 A;  1BJO A;  3ZRR A;  2Z9X A;  1BJ4 A;  3DYD A;  2W7J A;  4A0R A;  4Y0D A;  3ZZJ A;  1BS0 A;  1B8G A;  1G7W A;  2QLR A;  1UKJ A;  2DKB A;  3L8A A;  2BYJ A;  2ZY5 A;  4W91 A;  2Z61 A;  1WYV B;  3ELE A;  3UAK A;  1EJI A;  3QPG A;  2R5C B;  3QI6 A;  2EZ1 A;  4LNL A;  2D7Y A;  2R0T A;  4H51 A;  1TAS A;  5G4J A;  3BB8 A;  2D64 A;  1SZU A;  2CB1 A;  4GE9 A;  3F0H A;  2GMS A;  2D7Z A;  1SPA A;  3TFT A;  1KKP A;  1N2T A;  4IW7 A;  1H1C A;  2FNI A;  1FC4 A;  4LNJ A;  4ZSY A;  2Z9W A;  4R5F A;  4MQQ A;  5EUE A;  2VMR A;  5G2P A;  1V2E A;  2PO3 A;  1D7S A;  3A8U X;  3FFR A;  3FVU A;  1QGN A;  4EFF A;  3N4X A;  2YCT A;  3FZ6 A;  4M2M A;  2CST A;  2CTZ A;  3I5T A;  3ZZK A;  1ECX A;  4OMA A;  2BWP A;  1O69 A;  2EZ2 A;  2Q7W A;  2JIS A;  4FFC A;  3N0L A;  4J5U A;  1ARH A;  2HZP A;  4XQ2 A;  3HBX A;  1LC5 A;  2VMP A;  1GBN A;  1Z3Z A;  2GSA A;  3EI7 A;  4HF8 A;  4JEX A;  1AHG A;  3NUI A;  4WXF A;  2BI2 A;  2W7E A;  4K05 A;  5EAA A;  1YAA A;  3P1T A;  2VMX A;  3B46 A;  4UHN A;  3H7F A;  5D5S A;  1MLZ A;  3MAF A;  1GEW A;  1V2D A;  1TAR A;  1ARI A;  2AY4 A;  2WKA A;  1B5P A;  3HMU A;  3OKS A;  3VOM A;  1I29 A;  3QM2 A;  1M0N A;  2QB2 A;  5AX8 A;  1V72 A;  1H0C A;  4OYT A;  1E5F A;  2YKV A;  1D7V A;  4RAE A;  2G6W A;  2W7K A;  4WYC A;  2W7M A;  5HXX A;  1UU0 A;  1LK9 A;  3QGU A;  3GJU A;  1SZS A;  3HT4 A;  4RIZ A;  2PB0 A;  2VGV A;  1Y4I A;  3EI6 A;  2WK7 A;  3FSL A;  3GZD C;  1OHV A;  2DOU A;  1DJ9 A;  1TOE A;  2FM1 A;  3F6T A;  1AHY A;  1AX4 A;  3WX9 A;  1BQA A;  2BWO A;  4AZK A;  3VK4 A;  4OBV A;  3G8M A;  1X29 A;  2BI5 A;  4DGT A;  3BWN C;  1AJS B;  1IAX A;  4XK1 A;  1YJY A;  4OTL A;  8AAT A;  4W5K A;  5EFS A;  3A9Y A;  2HOZ A;  2VIA A;  3H9X A;  2W7L A;  1KMK A;  1KMJ A;  1GEY A;  1EG5 A;  3MEB A;  5EAV A;  3FRK A;  1S08 A;  2JJG A;  5HHY A;  2DKJ A;  2GB3 A;  1ASN A;  1E5E A;  1O4S A;  3B1D A;  2ZY4 A;  5KTB A;  2W7G A;  5K8B A;  1BT4 A;  1DKA A;  3MKJ A;  3JW9 A;  3E2Y A;  4ADB A;  3FTB A;  1O62 A;  3WCN A;  3A9X A;  1AIC A;  2HOX A;  4JEV A;  4F5I A;  1LW5 A;  4CBS A;  1YIY A;  1AAW A;  1X0M A;  3CQ5 A;  4ADC A;  3R4T A;  4F5H A;  2E7I A;  1J32 A;  3N75 A;  4UHM A;  1D2F A;  2YKU A;  4ZM3 A;  4B9B A;  3CQ4 A;  4P7Y A;  1P3W A;  3AEN B;  4ZWV A;  3EZ1 A;  1DTY A;  4RKC A;  5G09 A;  5G4I A;  1U08 A;  3WZF A;  4WYG A;  2YRI A;  1TAT A;  4RJY A;  1X2A A;  5EUD A;  2C7T A;  2XH1 A;  2VGU A;  1GC3 A;  4BHD A;  3TCM A;  5M46 A;  2VMY A;  5F8V A;  1W7L A;  3AEM C;  2VMV A;  2AY1 A;  3FKD A;  3WGB A;  4N0W A;  4WP0 A;  2D63 A;  4RLG A;  3TAT A;  2DGM A;  5D95 A;  4R8D A;  3FDB A;  2W8V A;  1D7U A;  2TPL A;  4XJP A;  3BWO A;  2VMN A;  4CBR A;  1AMR A;  5FT5 A;  3K28 A;  1MDO A;  4EMY A;  1C7O A;  4WD2 A;  3MAD A;  1GDE A;  2FNU A;  3PPL A;  1BKG A;  1OHY A;  3PDB A;  4WLH A;  2ZY2 A;  4ADD A;  2WB6 A;  3A9Z A;  3ASA A;  1WYV A;  1AHE A;  4Q6R A;  2R5C A;  2A1V A;  1C7N A;  1IUG A;  1AIB A;  2EGY A;  3GET A;  4MQR A;  3BV0 A;  4WB0 B;  3DXW A;  5F9S A;  1FG3 A;  1TPL A;  3AAT A;  3KKI A;  5C6U A;  3CAI A;  4MKK A;  5TF5 A;  1PFF A;  4FL0 A;  1ZOB A;  5G2Q A;  4LW2 A;  2OQX A;  3NYT A;  4PVF A;  2AY7 A;  2X5D A;  1ASA A;  2CIN A;  3E2Z B;  5M4B A;  2FN6 A;  3DR4 A;  4HVK A;  3FQA A;  1LC7 A;  1M0P A;  2D5Y A;  2W7H A;  1B5O A;  2E54 A;  2VGS A;  1X28 A;  3B1C A;  1S07 A;  1B9H A;  3F9T A;  3HQT A;  4WYE A;  4J8L A;  4WXB A;  3NU7 A;  4LC3 A;  2EO5 A;  4ITX A;  1M7Y A;  1EQB A;  4UQV A;  1J04 A;  3DRD A;  3GZD A;  1LS3 A;  2JG2 A;  2HOY A;  3VK2 A;  2O1B A;  3NUB A;  1ASE A;  2BYL A;  1VP4 A;  2AEV A;  2Z20 A;  3QN6 A;  3BWN A;  1ASL A;  2V0Y A;  2VGT A;  3BCB A;  4IXO A;  4ADE A;  2HUI A;  3AEJ C;  1CS1 A;  1PMO A;  2HUF A;  3G7Q A;  1DFO A;  3HLM A;  1MAP A;  3VP6 A;  3LVK A;  4A6T A;  2V1P A;  1S09 A;  1W7M A;  1YJS A;  1WKG A;  4F5F A;  2CFB A;  1G7X A;  2YOB A;  5M49 A;  1KL1 A;  3W1I A;  1DGE A;  4Q31 A;  2E7J A;  4E1O A;  1SF2 A;  1B9I A;  3M5U A;  1OHW A;  4Y0H A;  3EZS A;  3N4S A;  2HUU A;  2XBN A;  3RCH B;  2HOR A;  4GRX A;  2VIB A;  1BJN A;  4M2K A;  4P3M A;  4W1V A;  3VAX A;  4IY7 A;  4AO4 A;  4LW4 A;  4BA4 A;  2R5E A;  1VJO A;  1AJS A;  3BC8 A;  1JG8 A;  2JJH A;  3E9K A;  4RIT A;  5DX5 A;  3RBL A;  5FT4 A;  2YHK A;  3ISL A;  3JTX A;  4Q76 A;  4F4E A;  1O61 A;  3KE3 A;  1TOI A;  3OP7 A;  4TMR A;  3USF A;  4ITG A;  1ASB A;  2VMS A;  4IYO B;  4E3Q A;  4AO9 A;  5E5I A;  1LW4 A;  3GSB A;  3R9A A;  4PFF A;  5EIG B;  4ZAS A;  3ZRQ A;  3AEM A;  2ZJG A;  1ELU A;  3MAU A;  1AY4 A;  2D61 A;  1TOG A;  1ARS A;  2AY5 A;  2AY2 A;  2VGZ A;  2VMQ A;  3LVL B;  2VMZ A;  2AY3 A;  1S0A A;  3AOV A;  2AY8 A;  3ECD A;  2Z9U A;  1TOJ A;  2AAT A;  1QZ9 A;  3NYU A;  4XEW A;  3PAA A;  1CZE A;  3EUC A;  4XAU A;  3DXV A;  3DZZ A;  3NRA A;  1M32 A;  1LKC A;  3AEN A;  1BW0 A;  4IXZ A;  9AAT A;  1QIT A;  2EYQ A;  1IAY A;  1UU2 A;  1AAM A;  3FD0 A;  3ACZ A;  1CQ6 A;  1G4V A;  1JS6 A;  3K7Y A;  4MKJ A;  1WYT B;  5G0A A;  3II0 A;  5J8Q A;  5M4D A;  3N5M A;  2E7U A;  3AEL A;  3AV7 A;  2YRR A;  1N31 A;  3DU4 A;  1PG8 A;  3HDO A;  2ZYJ A;  4WYF A;  4WYD A;  1TOK A;  3DR7 A;  4WXG A;  2AY6 A;  1ZC9 A;  1I43 A;  1XI9 A;  5DJ9 A;  4EB7 A;  2OGA A;  1ZOD A;  5IWQ A;  2GQN A;  4A0G A;  1M6S A;  2EPJ A;  3NDN A;  2NMP A;  4DBC A;  3EIA A;  3FZ8 A;  1YJZ A;  2ORD A;  1I48 A;  3L44 A;  3AEO A;  2AEU A;  3IHJ A;  3LWS A;  2DGK A;  3GWP A;  4XJM A;  1XEY A;  4ZAH A;  2FYF A;  5JAY A;  1CQ8 A;  2VI9 A;  3AOW A;  3E77 A;  2O7C A;  1FG7 A;  4AH3 A;  4OBU A;  3KGX A;  3ZRP A;  3PIU A;  3QHX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...