4GE9A

Kynurenine aminotransferase ii inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
428
structure length
428
Chain Sequence
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNSGRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase, mitochondria
publication title Structure-Based Design of Irreversible Human KAT II Inhibitors: Discovery of New Potency-Enhancing Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 137
structure length 428
sequence length 428
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ge9A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ge9A03
1S06A 5M4BA 3LVJA 3FDDA 3USFA 2AY9A 1FG3A 2FNUA 2D64A 2Z20A 3F0HA 8AATA 4W5KA 5D5SA 1LKCA 2QBTA 1C0NA 4RLGA 1JS3A 3LVLB 4KXKA 3JZLA 1H0CA 4OBVA 1S0AA 1AMQA 1ASDA 3Q8NA 2VMNA 4B98A 3EI9A 2BI5A 1AIAA 1ARHA 1ASEA 2OKKA 3N5MA 1DTYA 1M7YA 1TASA 1V2DA 3QGUA 2W7FA 1AJSA 3GZCA 1IAYA 1AKCA 1M32A 2VMOA 4TV7A 1WKHA 1ZODA 1JF9A 1AY4A 1FC4A 1ARIA 1M0OA 4XQ2A 2AY7A 1W7LA 3WX9A 2CTZA 3FDBA 3JWAA 2CJHA 3N75A 2JISA 3L8AA 1ELQA 3FQ8A 4Q31A 2BWPA 2VLHA 3OKSA 4LNMA 4JF0A 4AO4A 2YHKA 3TCMA 3DXVA 2CINA 2YKUA 2W7HA 2YCTA 2Z9UA 5G09A 4E1OA 2BI2A 2DGLA 4Q76A 5EUNA 2VGTA 2VMSA 3NYTA 2AY1A 4RAEA 1TOIA 1ASCA 3ACZA 3G8MA 4OCAA 2YRRA 2NMPA 4N0WA 5G0AA 1U08A 1TARA 3MADA 5G2PA 1CZCA 3AOWA 1SF2A 3PA9A 4F5HA 5HHYA 1MGVA 2PB2A 2VGVA 1C7GA 3JU7A 3B8XA 3HBXA 4W1VA 5JAYA 1QIRA 3DRDA 3FQAA 4HF8A 3RI6A 4CBSA 3MAFB 3AEJA 1AIBA 3BN1A 1G4XA 3DZZA 4XEWA 1AMRA 4A0RA 4KAMA 3RCHA 3F9TA 3RUYA 3WCNA 4EU1A 4WXFA 3AOVA 1SZKA 3DYDA 4NOGA 1CZEA 1O62A 1UU0A 3DR4A 4I8AA 1QZ9A 3RBLA 1CS1A 2VMTA 1RV4A 1PMMA 2XH1A 4GEBA 2CJGA 3AEJC 1VJOA 2D63A 3MEBA 4H51A 4JE5A 1BW0A 1N2TA 4MKJA 1LC7A 1OHYA 3E2YA 3ZZJA 4ADEA 4ZM3A 1CQ8A 4XJPA 1SZSA 3HT4A 5EIGA 5DJ1A 3FFHA 2R0TA 1ARGA 4F4EA 4CXQA 3UE8A 1S09A 3A9ZA 2ZYJA 4WYFA 3ASBA 1RVYA 3VK4A 4F5KA 3IHJA 3W1IA 1ASGA 4MGRA 1YJYA 5EUDA 1I48A 3WLXA 2PO3A 1AHXA 1OXOA 4A0FA 2C81A 4CVQA 1G4VA 7AATA 1B9IA 2ZY2A 3CAIA 1WYVA 3NRAA 3KGXA 4JEWA 2BI3A 3WCOA 2JGTA 1BQDA 4W91A 2GMSA 3HMUA 3LY1A 4IYOA 4XJMA 2CSTA 3FZ8A 4M2KA 1AMAA 3VOMA 2OATA 1GEYA 4JF1A 3A8UX 1AY5A 2D61A 3L44A 5F8VA 4AO9A 1EQBA 1YNUA 2W7EA 4WLJA 3A9XA 1G7WA 4F5MA 3TFUA 4JEVA 3WY7A 3II0A 3NTJA 1WYTA 2DKJA 4W1WA 4WD2A 2C0RA 2W8VA 4JE5D 2CY8A 4AZJA 2ZP7A 1YIZA 1WYUB 1V2EA 2WK9A 2WK8A 3PGYA 1GD9A 1AX4A 1Z3ZA 2CANA 2VGZA 3PIUA 3EI6A 1AHYA 2BWOA 4J5UA 1LS3A 2VI9A 3NU8A 4QGRA 1IAXA 4P3MA 2X3LA 1C4KA 2DR1A 3FD0A 1O61A 1KKJA 1DKAA 3B1EA 3M5UA 1PMOA 4LW2A 3GZDA 2DOUA 4EB5A 1W7NA 2E7JA 3D6KA 2G6WA 5E5IA 4IY7A 4PIWA 4PFFA 1BJWA 4Y0IA 4DBCA 4F5IA 1QITA 1WSTA 1ELUA 4UQVA 2YCNA 3DXWA 4JEYA 4ISYA 2BYLA 2WKAA 4N0BA 4WBTA 2CFBA 4WYAA 4WYCA 3NX3A 3TFTA 2VGUA 3WGCA 3GZDC 3FVXA 4XK1A 4E3RA 2DGKA 1TOJA 3EZSA 5F9SA 4MQPA 1ARSA 1B9HA 1QJ5A 1XEYA 5D95A 2X5DA 4WYEA 1IJIA 3AELA 4PVFA 4MQRA 3VK3A 4RJ0A 4OBUA 2EZ2A 4RKCA 3GR9A 3JWBA 1Z7DA 2QA3A 4FL0A 1IUGA 4TN4A 1CQ7A 1O69A 2OKJA 1UU1A 5FT4A 1E5EA 1SPAA 1W23A 1VP4A 2BHXA 2QMAA 1KMKA 3AEPA 1EJIA 2BKWA 2EGYA 2FM1A 2CB1A 3R9AA 3LVMA 4UOYA 2ORDA 1XI9A 1MDXA 2AY3A 3DR7A 4K2MA 3G0TA 3E6GA 2BWNA 3CQ4A 1IX6A 4ADCA 1BJ4A 3MC6A 4RKDA 1TPLA 1W3UA 2W8TA 2TPLA 3FRKA 3R4TA 4K2IA 4WXBA 2VYCA 4XAUA 2Z9WA 2HUIA 3B1DA 4WB0B 1MLYA 3ZRRA 4ZWVA 2BIGA 3BS8A 1TATA 3UAKA 4AZKA 2ZY4A 1BS0A 5LHAA 2X5FA 1AHFA 3I4JA 2YOBA 2D5YA 3JTXA 4ZSWA 3TQXA 1AHEA 3FKDA 4IXSA 4KYOA 1B5OA 3EUCA 3GJUA 3KGWA 3P6KA 1GEXA 3BC8A 1IVRA 2V0YA 5DJ9A 1SVVA 4U2HA 3WKSA 4DQ6A 1GCKA 1MLZA 1SFFA 1ZOBA 3PD6B 4ZLVA 1AJSB 4UHMA 3PDBB 4ZDPA 4ATPA 4A6RA 3LV2A 3EIBA 1ASMA 4Y0DA 3WKRA 4EB7A 3FVUA 3GBXA 1PFFA 3E2FA 1RVUA 4ZASA 1YIYA 2W8JA 1ASLA 2EZ1A 1MDOA 4XJOA 4F5FA 1CL1A 2FQ6A 5E4ZA 4ADBA 4E3QA 4LNLA 4IX8A 4OT8A 1D7UA 3FSLA 3ZZKA 5BJ4A 1BJOB 2HORA 3VAXA 2YKYA 2E54A 1N31A 4GSAA 3T32A 3WGBA 3DODA 1BKGA 1S08A 2VMWA 3LG0A 4B9BA 3F6TA 5K8BA 4RJYA 1BT4A 5E3KA 1G7XA 2OGAA 4R8DA 3BWNA 3NYSA 5G4JA 4EFFA 1OXPA 2VGWA 4JEZA 3DC1A 4IXOA 4A6TA 2EH6A 1ECXA 2VIBA 4LC3A 1UU2A 4RIZA 3ECDA 1I41A 4WYGA 5EAVA 4BA4A 2VMPA 3CBFA 3E2ZB 5HDMA 1LW5A 2VMRA 1WKGA 3FFRA 1PG8A 5DX5A 4GE9A 2VMQA 3LVKA 3RCHB 5M4DA 4Q6RA 2R5CB 2R5EA 4XJLA 1CQ6A 3PAAA 5I92A 1V2FA 3CQ5A 1N8PA 1MDZA 2E7IA 2QB3A 1GC3A 4ITXA 4J8LA 1MAPA 4UHOA 3VP6A 4A6UA 4F5GA 5EAAA 1VEFA 5AX8A 4IW7A 1X29A 1TOGA 9AATA 4F5LA 1MAQA 3AEMA 2DKBA 2FN6A 3FZ7A 2AY6A 1B4XA 1AY8A 4MKKA 1X2AA 1GC2A 2VMYA 2AY4A 3MBBA 4BMKA 2YKXA 2ZY3A 1QISA 3CQ6A 2CH2A 4CBRA 5M46A 1X28A 2GSAA 3COGA 2BI1A 4Y0HA 5EFSA 4A72A 2JJGA 2JJFA 2GQNA 4P7YA 2HOYA 4LNJA 4A0GA 3DU4A 4O6ZA 2BIEA 4RM1A 1KKPA 4GDYA 3QI6A 2W8UA 2O0RA 3NNKA 2OGEA 2R2NA 3BCAA 3E9KA 1B8GA 3HLMA 2D66A 4AH3A 3FTBA 2YCPA 1D2FA 4OMAA 4UHNA 2ZC0A 1ZC9A 2BYJA 3BCXA 4ATQA 4ZAHA 2GMUA 3EI5A 2HP2A 4CXRA 1GC0A 2FNIA 3EIAA 2ZUKA 3N0LA 5EUEA 2QLRA 3NUIA 1DJUA 3FVSA 1I43A 3NU7A 3QBOA 3QPGA 4MQQA 4WB0A 4ZDOA 2HOZA 2Z67A 2Z9VA 3MAFA 3K40A 2AY2A 1ASFA 1BJNA 2O1BA 2PB0A 3FCRA 5LH9A 2W7LA 3ZRQA 2E7UA 5FT6A 3K28A 2CH1A 1E5FA 4GE7A 2VGSA 3AENB 1AJRA 1C9CA 3UWCA 1ARTA 4BQ0A 3G7QA 3PD6A 1AMSA 2GB3A 2W7GA 3PDBA 1ASAA 4FFCA 4ZDLA 5EQCA 3JW9A 2ZSLA 2W7MA 1ASNA 1C7NA 3QN6A 4ZSYA 2DGMA 1AICA 1UKJA 3QHXA 2FYFA 1OHWA 1YOOA 2CJDA 4RITA 1RV3A 3AATA 4MY5A 5DB5A 1J04A 3H7FA 3W1HA 1D7SA 4PFNA 2AEUA 3OP7A 1FG7A 2D7YA 3H14A 1D7VA 3HVYA 1BJOA 1LC5A 4LW4A 2ZY5A 3MC6C 3RQ1A 3PJ0A 3QM2A 1QGNA 2JG2A 2VMVA 2D65A 2AY8A 1H1CA 1JS6A 3VK2A 1W7MA 2JJHA 3AEOA 2BIAA 1T3IA 2ZSMA 1DJEA 1CJ0A 3ATHA 1ASBA 1IX7A 2W7KA 4F5JA 3NUBA 2Z1YA 2JJEA 1M6SA 3E2ZA 1EG5A 1DGEA 2AEVA 4L0OA 4DGTA 2W7JA 3ZRPA 1DJ9A 1M0PA 2F8JA 2YKVA 2VMUA 3PDXA 2W8WA 4W1XA 2R5CA 3EI7A 1M0QA 3GSBA 1CL2A 3I5TA 2VMXA 3E77A 4M2JA 4TMRA 1ORDA 3P1TA 2ZJGA 4ITGA 2EPJA 1D7RA 4IXZA 3A2BA 3BB8A 1IX8A 3BV0A 2V1PA 4M2MA 5J8QA 1WYUA 3FZ6A 2VLFA 1TOKA 4A0HA 2HP1A 1O4SA 2D7ZA 1KL1A 2Z61A 3NYUA 4BHDA 3A9YA 3HQTA 4OYTA 2C7TA 3BCBA 3PPLA 1P3WA 1GBNA 1M4NA 3I16A 3ISLA 4EMYA 4OC9A 1GEWA 3ELEA 5BJ3A 5M49A 1Y4IA 1V72A 3FQ7A 4R5ZA 3BWNC 4R2NA 1SZUA 4WLHA 5TF5A 4WYDA 2VI8A 2EO5A 1B5PA 3HDOA 4OTLA 2BI9A 1IBJA 2RFVA 2VMZA 3B1CA 4ZM4A 1AHGA 3KKIA 5G2QA 1GDEA 1LK9A 2HZPA 1LC8A 1AKAA 2W7DA 1BQAA 1DGDA 4ADDA 2X8UA 3IF2A 5EIGB 3KE3A 2Z9XA 3TATA 1AAWA 5FT8A 1M0NA 3NDNA 2C44A 4MSOA 4Q75A 3B46A 1GC4A 1OATA 1LW4A 4WXGA 2Z1ZA 3MKJA 1DFOA 4JEXA 2QB2A 1X0MA 4GE4A 4BA5A 1AAMA 1YJZA 3WZFA 1JG8A 4ZWMA 3BWOA 3AEMC 4WP0A 2AY5A 4AOAA 1WYVB 1YJSA 1S07A 5IWQA 2YRIA 1QJ3A 3AV7A 3RBFA 4HVKA 2Q7WA 1YAAA 3EZ1A 5HXXA 3K7YA 4IYOB 2AATA 4U1TA 5FT5A 1KL2A 1OHVA 5G4IA 2HUFA 2VIAA 2HUUA 3MAUA 1KMJA 3AENA 3ASAA 3GWPA 2HOXA 4E77A 1I29A 1C7OA 5C6UA 2O7CA 3HL2A 1TOEA 3EI8A 2W7IA 3W1JA 4A00A 2OQXA 3LWSA 4GRXA 4W8IA 4K2BA 4R5FA 2XBNA 3ELPA 1AKBA 1WYTB 2WK7A 3GETA 1J32A
chains in the Genus database with same CATH superfamily
1S06A 5M4BA 3LVJA 3FDDA 3USFA 2AY9A 1FG3A 2FNUA 2D64A 2Z20A 3F0HA 8AATA 4W5KA 5D5SA 1LKCA 2QBTA 1C0NA 4RLGA 1JS3A 3LVLB 4KXKA 3JZLA 1H0CA 4OBVA 1S0AA 1AMQA 1ASDA 3N7NA 3Q8NA 2VMNA 4B98A 3EI9A 2BI5A 1AIAA 1ARHA 1ASEA 2OKKA 3N5MA 1DTYA 1M7YA 1TASA 1V2DA 3QGUA 2W7FA 1AJSA 3GZCA 1IAYA 1AKCA 1M32A 2VMOA 4TV7A 1WKHA 1ZODA 1JF9A 1AY4A 1FC4A 1ARIA 1M0OA 4XQ2A 2AY7A 1W7LA 3WX9A 2CTZA 3FDBA 3JWAA 2CJHA 3N75A 2JISA 3L8AA 1ELQA 3FQ8A 4Q31A 2BWPA 3N4SA 2VLHA 3OKSA 4LNMA 4JF0A 4AO4A 2YHKA 3TCMA 3DXVA 2CINA 2YKUA 3N4XA 2W7HA 2YCTA 2Z9UA 5G09A 4E1OA 2BI2A 2DGLA 4Q76A 5EUNA 2VGTA 2VMSA 3NYTA 2AY1A 4RAEA 1TOIA 1ASCA 3ACZA 3G8MA 4OCAA 2YRRA 2NMPA 4N0WA 5G0AA 1U08A 1TARA 3MADA 5G2PA 1CZCA 3AOWA 1SF2A 3PA9A 4F5HA 5HHYA 1MGVA 2PB2A 2VGVA 1C7GA 3JU7A 3B8XA 3HBXA 4W1VA 5JAYA 1QIRA 3DRDA 3FQAA 4HF8A 3RI6A 4CBSA 3MAFB 3AEJA 1AIBA 3BN1A 1G4XA 3DZZA 4XEWA 1AMRA 4A0RA 4KAMA 3RCHA 3F9TA 3RUYA 3WCNA 4EU1A 4WXFA 3AOVA 1SZKA 3DYDA 4NOGA 1CZEA 1O62A 1UU0A 3DR4A 4I8AA 1QZ9A 3RBLA 1CS1A 2VMTA 1RV4A 1PMMA 2XH1A 4GEBA 2CJGA 3AEJC 1VJOA 2D63A 3MEBA 4H51A 4JE5A 1BW0A 1N2TA 4MKJA 1LC7A 1OHYA 3E2YA 3ZZJA 4ADEA 4ZM3A 1CQ8A 4XJPA 1SZSA 3HT4A 5EIGA 5DJ1A 3FFHA 2R0TA 1ARGA 4F4EA 4CXQA 3N4RA 3UE8A 1S09A 3A9ZA 2ZYJA 4WYFA 3ASBA 1RVYA 3VK4A 4F5KA 3IHJA 3W1IA 1ASGA 4MGRA 1YJYA 5EUDA 4K05A 4H63Q 1I48A 3WLXA 2PO3A 1AHXA 1OXOA 4A0FA 2C81A 4CVQA 1G4VA 7AATA 1B9IA 2ZY2A 3CAIA 1WYVA 3NRAA 3KGXA 4JEWA 2BI3A 3WCOA 2JGTA 1BQDA 4W91A 2GMSA 3HMUA 3LY1A 4IYOA 4XJMA 2CSTA 3FZ8A 4M2KA 1AMAA 3VOMA 2OATA 1GEYA 4JF1A 3A8UX 1AY5A 2D61A 3L44A 5F8VA 4AO9A 1EQBA 1YNUA 2W7EA 4WLJA 3A9XA 1G7WA 4F5MA 3TFUA 4JEVA 3WY7A 3II0A 3NTJA 1WYTA 2DKJA 4W1WA 4WD2A 2C0RA 3H9XA 2W8VA 4JE5D 2CY8A 4AZJA 2ZP7A 1YIZA 1WYUB 1V2EA 2WK9A 2WK8A 3PGYA 1GD9A 1AX4A 1Z3ZA 2CANA 2VGZA 3PIUA 3EI6A 1AHYA 2BWOA 4J5UA 1LS3A 2VI9A 3NU8A 4QGRA 1IAXA 4P3MA 2X3LA 1C4KA 2DR1A 3FD0A 1O61A 1KKJA 1DKAA 3B1EA 3M5UA 1PMOA 4LW2A 3GZDA 2DOUA 4EB5A 1W7NA 2E7JA 3D6KA 2G6WA 5E5IA 4IY7A 4PIWA 4PFFA 1BJWA 4Y0IA 4DBCA 4F5IA 1QITA 1WSTA 1ELUA 4UQVA 2YCNA 3DXWA 4JEYA 4ISYA 2BYLA 2WKAA 4N0BA 4WBTA 2CFBA 4WYAA 4WYCA 3NX3A 3TFTA 2VGUA 3WGCA 3GZDC 3FVXA 4XK1A 4E3RA 2DGKA 1TOJA 3EZSA 5F9SA 4MQPA 1ARSA 1B9HA 1QJ5A 1XEYA 5D95A 2X5DA 4WYEA 1IJIA 3AELA 4PVFA 4MQRA 3VK3A 4RJ0A 4OBUA 2EZ2A 4RKCA 3GR9A 3JWBA 1Z7DA 2QA3A 4FL0A 1IUGA 4TN4A 1CQ7A 1O69A 2OKJA 1UU1A 5FT4A 1E5EA 1SPAA 1W23A 1VP4A 2BHXA 2QMAA 1KMKA 3AEPA 1EJIA 2BKWA 2EGYA 2FM1A 2CB1A 3R9AA 2EYQA 3LVMA 4UOYA 2ORDA 1XI9A 1MDXA 2AY3A 3DR7A 4K2MA 3G0TA 3E6GA 5KTBA 2BWNA 3CQ4A 1IX6A 4ADCA 1BJ4A 3MC6A 4RKDA 1TPLA 1W3UA 2W8TA 2TPLA 3FRKA 3R4TA 4K2IA 4WXBA 2VYCA 4XAUA 2Z9WA 2HUIA 3B1DA 4WB0B 1MLYA 3ZRRA 4ZWVA 2BIGA 3BS8A 1TATA 3UAKA 4AZKA 2ZY4A 1BS0A 5LHAA 2X5FA 1AHFA 3I4JA 2YOBA 2D5YA 3JTXA 4ZSWA 3TQXA 1AHEA 3FKDA 4IXSA 4KYOA 1B5OA 3EUCA 3GJUA 3KGWA 3P6KA 1GEXA 3BC8A 1IVRA 2V0YA 5DJ9A 1SVVA 4U2HA 3WKSA 4DQ6A 1GCKA 1MLZA 1SFFA 1ZOBA 3PD6B 4ZLVA 1AJSB 4UHMA 3PDBB 4ZDPA 4ATPA 4A6RA 3LV2A 3EIBA 1ASMA 4Y0DA 3WKRA 4EB7A 3FVUA 3GBXA 2A1VA 1PFFA 3E2FA 1RVUA 4ZASA 1YIYA 2W8JA 1ASLA 2EZ1A 1MDOA 4XJOA 4F5FA 1CL1A 2FQ6A 5E4ZA 4ADBA 4E3QA 4LNLA 4IX8A 4OT8A 1D7UA 3FSLA 3ZZKA 5BJ4A 1BJOB 2HORA 1KAFA 3VAXA 2YKYA 2E54A 1N31A 4GSAA 3T32A 3WGBA 3DODA 1BKGA 1S08A 2VMWA 3LG0A 4B9BA 3F6TA 5K8BA 4RJYA 1BT4A 5E3KA 1G7XA 2OGAA 4R8DA 3BWNA 3NYSA 5G4JA 4EFFA 1OXPA 2VGWA 4JEZA 3DC1A 4IXOA 4A6TA 2EH6A 1ECXA 2VIBA 4LC3A 1UU2A 4RIZA 3ECDA 1I41A 4WYGA 5EAVA 4BA4A 2VMPA 3CBFA 3E2ZB 5HDMA 1LW5A 2VMRA 1WKGA 3FFRA 1PG8A 5DX5A 4GE9A 2VMQA 3LVKA 3RCHB 5M4DA 4Q6RA 2R5CB 2R5EA 4XJLA 1CQ6A 3PAAA 5I92A 1V2FA 3CQ5A 1N8PA 1MDZA 2E7IA 2QB3A 1GC3A 4ITXA 4J8LA 1MAPA 4UHOA 3VP6A 4A6UA 4F5GA 5EAAA 1VEFA 5AX8A 4IW7A 1X29A 1TOGA 9AATA 4F5LA 1MAQA 3AEMA 2DKBA 2FN6A 3FZ7A 2AY6A 1B4XA 1AY8A 4MKKA 1X2AA 1GC2A 2VMYA 2AY4A 3MBBA 4BMKA 2YKXA 2ZY3A 1QISA 3CQ6A 2CH2A 4CBRA 5M46A 1X28A 2GSAA 3COGA 2BI1A 4Y0HA 5EFSA 4A72A 2JJGA 2JJFA 2GQNA 4P7YA 2HOYA 4LNJA 4A0GA 3DU4A 4O6ZA 2BIEA 4RM1A 1KKPA 4GDYA 3QI6A 2W8UA 2O0RA 3NNKA 2OGEA 2R2NA 3BCAA 3E9KA 1B8GA 3HLMA 2D66A 4AH3A 3FTBA 2YCPA 1D2FA 4OMAA 4UHNA 2ZC0A 2G7JA 1ZC9A 2BYJA 3BCXA 4ATQA 4ZAHA 2GMUA 3EI5A 2HP2A 4CXRA 1GC0A 2FNIA 3EIAA 2ZUKA 3N0LA 5EUEA 2QLRA 3NUIA 1DJUA 3FVSA 1I43A 3NU7A 3QBOA 3QPGA 4MQQA 4WB0A 4ZDOA 2HOZA 2Z67A 2QSRA 2Z9VA 3MAFA 3K40A 2AY2A 1ASFA 1BJNA 2O1BA 2PB0A 3FCRA 5LH9A 2W7LA 3ZRQA 2E7UA 2FKIA 5FT6A 3K28A 2CH1A 1E5FA 4GE7A 2VGSA 3AENB 1AJRA 1C9CA 3UWCA 1ARTA 4BQ0A 3G7QA 3PD6A 1AMSA 2GB3A 2W7GA 3PDBA 1ASAA 4FFCA 4ZDLA 5EQCA 3JW9A 2ZSLA 2W7MA 1ASNA 1C7NA 3QN6A 4ZSYA 2DGMA 1AICA 1UKJA 3QHXA 2FYFA 1OHWA 1YOOA 2CJDA 4RITA 1RV3A 3AATA 4MY5A 5DB5A 1J04A 3H7FA 3W1HA 1D7SA 4PFNA 2AEUA 3OP7A 1FG7A 2D7YA 3H14A 1D7VA 3HVYA 1BJOA 1LC5A 4LW4A 2ZY5A 3MC6C 3RQ1A 3PJ0A 3QM2A 1QGNA 2JG2A 2VMVA 2D65A 2AY8A 1H1CA 1JS6A 3VK2A 1W7MA 2JJHA 3AEOA 2BIAA 1T3IA 2ZSMA 1DJEA 1CJ0A 3ATHA 1ASBA 1IX7A 2W7KA 4F5JA 3NUBA 2Z1YA 2JJEA 1M6SA 3E2ZA 1EG5A 1DGEA 2AEVA 4L0OA 4DGTA 2W7JA 3ZRPA 1DJ9A 1M0PA 2F8JA 2YKVA 2VMUA 3PDXA 2W8WA 4W1XA 2R5CA 3EI7A 1M0QA 3GSBA 1CL2A 3I5TA 2VMXA 3E77A 4M2JA 4TMRA 1ORDA 3P1TA 2ZJGA 4ITGA 2EPJA 1D7RA 4IXZA 3A2BA 3BB8A 1IX8A 3BV0A 2V1PA 4M2MA 5J8QA 1WYUA 3FZ6A 2VLFA 1TOKA 2KFPA 4A0HA 2HP1A 1O4SA 2D7ZA 1KL1A 2Z61A 3NYUA 4BHDA 3A9YA 3HQTA 4OYTA 2C7TA 3BCBA 3PPLA 1P3WA 1GBNA 1M4NA 3I16A 3ISLA 4EMYA 4OC9A 1GEWA 3ELEA 5BJ3A 5M49A 1Y4IA 1V72A 3FQ7A 4R5ZA 3BWNC 4R2NA 1SZUA 4WLHA 5TF5A 4WYDA 2VI8A 2EO5A 1B5PA 3HDOA 4OTLA 2BI9A 1IBJA 2RFVA 2VMZA 3B1CA 4ZM4A 1AHGA 3KKIA 5G2QA 1GDEA 1LK9A 2HZPA 1LC8A 1AKAA 2W7DA 1BQAA 1DGDA 4ADDA 2X8UA 3IF2A 5EIGB 3KE3A 2Z9XA 3TATA 1AAWA 5FT8A 1M0NA 3NDNA 2C44A 4MSOA 4Q75A 3B46A 1GC4A 1OATA 1LW4A 4WXGA 2Z1ZA 3MKJA 1DFOA 4JEXA 2QB2A 1X0MA 4GE4A 4BA5A 1AAMA 1YJZA 3WZFA 1JG8A 4ZWMA 3BWOA 3AEMC 4WP0A 2AY5A 4AOAA 1WYVB 1YJSA 1S07A 5IWQA 2YRIA 1QJ3A 3AV7A 3RBFA 4HVKA 2Q7WA 1YAAA 3EZ1A 5HXXA 3K7YA 4IYOB 2AATA 4U1TA 5FT5A 1KL2A 1OHVA 5G4IA 2HUFA 2VIAA 2HUUA 3MAUA 1KMJA 3AENA 3ASAA 3GWPA 2HOXA 4E77A 1I29A 1C7OA 5C6UA 2O7CA 3HL2A 1TOEA 3EI8A 2W7IA 3W1JA 4A00A 2OQXA 3LWSA 4GRXA 4W8IA 4K2BA 4R5FA 2XBNA 3ELPA 1AKBA 2WB6A 1WYTB 2WK7A 3GETA 1J32A
chains in the Genus database with same CATH topology
1S06A 5M4BA 3LVJA 3FDDA 3USFA 2AY9A 1FG3A 2FNUA 2D64A 2Z20A 3F0HA 8AATA 4W5KA 5D5SA 1LKCA 2QBTA 1C0NA 4RLGA 1JS3A 3LVLB 4KXKA 3JZLA 1H0CA 4OBVA 1S0AA 1AMQA 1ASDA 3N7NA 3Q8NA 2VMNA 4B98A 3EI9A 2BI5A 1AIAA 1ARHA 1ASEA 2OKKA 3N5MA 1DTYA 1M7YA 1TASA 1V2DA 3QGUA 2W7FA 1AJSA 3GZCA 1IAYA 1AKCA 1M32A 2VMOA 4TV7A 1WKHA 1ZODA 1JF9A 1AY4A 1FC4A 1ARIA 1M0OA 4XQ2A 2AY7A 1W7LA 3WX9A 2CTZA 3FDBA 3JWAA 2CJHA 3N75A 2JISA 3L8AA 1ELQA 3FQ8A 4Q31A 2BWPA 3N4SA 2VLHA 3OKSA 4LNMA 4JF0A 4AO4A 2YHKA 3TCMA 3DXVA 2CINA 2YKUA 3N4XA 2W7HA 2YCTA 2Z9UA 5G09A 4E1OA 2BI2A 2DGLA 4Q76A 5EUNA 2VGTA 2VMSA 3NYTA 2AY1A 4RAEA 1TOIA 1ASCA 3ACZA 3G8MA 4OCAA 2YRRA 2NMPA 4N0WA 5G0AA 1U08A 1TARA 3MADA 5G2PA 1CZCA 3AOWA 1SF2A 3PA9A 4F5HA 5HHYA 1MGVA 2PB2A 2VGVA 1C7GA 3JU7A 3B8XA 3HBXA 4W1VA 5JAYA 1QIRA 3DRDA 3FQAA 4HF8A 3RI6A 4CBSA 3MAFB 3AEJA 1AIBA 3BN1A 1G4XA 3DZZA 4XEWA 1AMRA 4A0RA 4KAMA 3RCHA 3F9TA 3RUYA 3WCNA 4EU1A 4WXFA 3AOVA 1SZKA 3DYDA 4NOGA 1CZEA 1O62A 1UU0A 3DR4A 4I8AA 1QZ9A 3RBLA 1CS1A 2VMTA 1RV4A 1PMMA 2XH1A 4GEBA 2CJGA 3AEJC 1VJOA 2D63A 3MEBA 4H51A 4JE5A 1BW0A 1N2TA 4MKJA 1LC7A 1OHYA 3E2YA 3ZZJA 4ADEA 4ZM3A 1CQ8A 4XJPA 1SZSA 3HT4A 5EIGA 5DJ1A 3FFHA 2R0TA 1ARGA 4F4EA 4CXQA 3N4RA 3UE8A 1S09A 3A9ZA 2ZYJA 4WYFA 3ASBA 1RVYA 3VK4A 4F5KA 3IHJA 3W1IA 1ASGA 4MGRA 1YJYA 5EUDA 4K05A 4H63Q 1I48A 3WLXA 2PO3A 1AHXA 1OXOA 4A0FA 2C81A 4CVQA 1G4VA 7AATA 1B9IA 2ZY2A 3CAIA 1WYVA 3NRAA 3KGXA 4JEWA 2BI3A 3WCOA 2JGTA 1BQDA 4W91A 2GMSA 3HMUA 3LY1A 4IYOA 4XJMA 2CSTA 3FZ8A 4M2KA 1AMAA 3VOMA 2OATA 1GEYA 4JF1A 3A8UX 1AY5A 2D61A 3L44A 5F8VA 4AO9A 1EQBA 1YNUA 2W7EA 4WLJA 3A9XA 1G7WA 4F5MA 3TFUA 4JEVA 3WY7A 3II0A 3NTJA 1WYTA 2DKJA 4W1WA 4WD2A 2C0RA 3H9XA 2W8VA 4JE5D 2CY8A 4AZJA 2ZP7A 1YIZA 1WYUB 1V2EA 2WK9A 2WK8A 3PGYA 1GD9A 1AX4A 1Z3ZA 2CANA 2VGZA 3PIUA 3EI6A 1AHYA 2BWOA 4J5UA 1LS3A 2VI9A 3NU8A 4QGRA 1IAXA 4P3MA 2X3LA 1C4KA 2DR1A 3FD0A 1O61A 1KKJA 1DKAA 3B1EA 3M5UA 1PMOA 4LW2A 3GZDA 2DOUA 4EB5A 1W7NA 2E7JA 3D6KA 2G6WA 5E5IA 4IY7A 4PIWA 4PFFA 1BJWA 4Y0IA 4DBCA 4F5IA 1QITA 1WSTA 1ELUA 4UQVA 2YCNA 3DXWA 4JEYA 4ISYA 2BYLA 2WKAA 4N0BA 4WBTA 2CFBA 4WYAA 4WYCA 3NX3A 3TFTA 2VGUA 3WGCA 3GZDC 3FVXA 4XK1A 4E3RA 2DGKA 1TOJA 3EZSA 5F9SA 4MQPA 1ARSA 1B9HA 1QJ5A 1XEYA 5D95A 2X5DA 4WYEA 1IJIA 3AELA 4PVFA 4MQRA 3VK3A 4RJ0A 4OBUA 2EZ2A 4RKCA 3GR9A 3JWBA 1Z7DA 2QA3A 4FL0A 1IUGA 4TN4A 1CQ7A 1O69A 2OKJA 1UU1A 5FT4A 1E5EA 1SPAA 1W23A 1VP4A 2BHXA 2QMAA 1KMKA 3AEPA 1EJIA 2BKWA 2EGYA 2FM1A 2CB1A 3R9AA 2EYQA 3LVMA 4UOYA 2ORDA 1XI9A 1MDXA 2AY3A 3DR7A 4K2MA 3G0TA 3E6GA 5KTBA 2BWNA 3CQ4A 1IX6A 4ADCA 1BJ4A 3MC6A 4RKDA 1TPLA 1W3UA 2W8TA 2TPLA 3FRKA 3R4TA 4K2IA 4WXBA 2VYCA 4XAUA 2Z9WA 2HUIA 3B1DA 4WB0B 1MLYA 3ZRRA 4ZWVA 2BIGA 3BS8A 1TATA 3UAKA 4AZKA 2ZY4A 1BS0A 5LHAA 2X5FA 1AHFA 3I4JA 2YOBA 2D5YA 3JTXA 4ZSWA 3TQXA 1AHEA 3FKDA 4IXSA 4KYOA 1B5OA 3EUCA 3GJUA 3KGWA 3P6KA 1GEXA 3BC8A 1IVRA 2V0YA 5DJ9A 1SVVA 4U2HA 3WKSA 4DQ6A 1GCKA 1MLZA 1SFFA 1ZOBA 3PD6B 4ZLVA 1AJSB 4UHMA 3PDBB 4ZDPA 4ATPA 4A6RA 3LV2A 3EIBA 1ASMA 4Y0DA 3WKRA 4EB7A 3FVUA 3GBXA 2A1VA 1PFFA 3E2FA 1RVUA 4ZASA 1YIYA 2W8JA 1ASLA 2EZ1A 1MDOA 4XJOA 4F5FA 1CL1A 2FQ6A 5E4ZA 4ADBA 4E3QA 4LNLA 4IX8A 4OT8A 1D7UA 3FSLA 3ZZKA 5BJ4A 1BJOB 2HORA 3VAXA 2YKYA 2E54A 1N31A 4GSAA 3T32A 3WGBA 3DODA 1BKGA 1S08A 2VMWA 3LG0A 4B9BA 3F6TA 5K8BA 4RJYA 1BT4A 5E3KA 1G7XA 2OGAA 4R8DA 3BWNA 3NYSA 5G4JA 4EFFA 1OXPA 2VGWA 4JEZA 3DC1A 4IXOA 4A6TA 2EH6A 1ECXA 2VIBA 4LC3A 1UU2A 4RIZA 3ECDA 1I41A 4WYGA 5EAVA 4BA4A 2VMPA 3CBFA 3E2ZB 5HDMA 1LW5A 2VMRA 1WKGA 3FFRA 1PG8A 5DX5A 4GE9A 2VMQA 3LVKA 3RCHB 5M4DA 4Q6RA 2R5CB 2R5EA 4XJLA 1CQ6A 3PAAA 5I92A 1V2FA 3CQ5A 1N8PA 1MDZA 2E7IA 2QB3A 1GC3A 4ITXA 4J8LA 1MAPA 4UHOA 3VP6A 4A6UA 4F5GA 5EAAA 1VEFA 5AX8A 4IW7A 1X29A 1TOGA 9AATA 4F5LA 1MAQA 3AEMA 2DKBA 2FN6A 3FZ7A 2AY6A 1B4XA 1AY8A 4MKKA 1X2AA 1GC2A 2VMYA 2AY4A 3MBBA 4BMKA 2YKXA 2ZY3A 1QISA 3CQ6A 2CH2A 4CBRA 5M46A 1X28A 2GSAA 3COGA 2BI1A 4Y0HA 5EFSA 4A72A 2JJGA 2JJFA 2GQNA 4P7YA 2HOYA 4LNJA 4A0GA 3DU4A 4O6ZA 2BIEA 4RM1A 1KKPA 4GDYA 3QI6A 2W8UA 2O0RA 3NNKA 2OGEA 2R2NA 3BCAA 3E9KA 1B8GA 3HLMA 2D66A 4AH3A 3FTBA 2YCPA 1D2FA 4OMAA 4UHNA 2ZC0A 2G7JA 1ZC9A 2BYJA 3BCXA 4ATQA 4ZAHA 2GMUA 3EI5A 2HP2A 4CXRA 1GC0A 2FNIA 3EIAA 2ZUKA 3N0LA 5EUEA 2QLRA 3NUIA 1DJUA 3FVSA 1I43A 3NU7A 3QBOA 3QPGA 4MQQA 4WB0A 4ZDOA 2HOZA 2Z67A 2QSRA 2Z9VA 3MAFA 3K40A 2AY2A 1ASFA 1BJNA 2O1BA 2PB0A 3FCRA 5LH9A 2W7LA 3ZRQA 2E7UA 2FKIA 5FT6A 3K28A 2CH1A 1E5FA 4GE7A 2VGSA 3AENB 1AJRA 1C9CA 3UWCA 1ARTA 4BQ0A 3G7QA 3PD6A 1AMSA 2GB3A 2W7GA 3PDBA 1ASAA 4FFCA 4ZDLA 5EQCA 3JW9A 2ZSLA 2W7MA 1ASNA 1C7NA 3QN6A 4ZSYA 2DGMA 1AICA 1UKJA 3QHXA 2FYFA 1OHWA 1YOOA 2CJDA 4RITA 1RV3A 3AATA 4MY5A 5DB5A 1J04A 3H7FA 3W1HA 1D7SA 4PFNA 2AEUA 3OP7A 1FG7A 2D7YA 3H14A 1D7VA 3HVYA 1BJOA 1LC5A 4LW4A 2ZY5A 3MC6C 3RQ1A 3PJ0A 3QM2A 1QGNA 2JG2A 2VMVA 2D65A 2AY8A 1H1CA 1JS6A 3VK2A 1W7MA 2JJHA 3AEOA 2BIAA 1T3IA 2ZSMA 1DJEA 1CJ0A 3ATHA 1ASBA 1IX7A 2W7KA 4F5JA 3NUBA 2Z1YA 2JJEA 1M6SA 3E2ZA 1EG5A 1DGEA 2AEVA 4L0OA 4DGTA 2W7JA 3ZRPA 1DJ9A 1M0PA 2F8JA 2YKVA 2VMUA 3PDXA 2W8WA 4W1XA 2R5CA 3EI7A 1M0QA 3GSBA 1CL2A 3I5TA 2VMXA 3E77A 4M2JA 4TMRA 1ORDA 3P1TA 2ZJGA 4ITGA 2EPJA 1D7RA 4IXZA 3A2BA 3BB8A 1IX8A 3BV0A 2V1PA 4M2MA 5J8QA 1WYUA 3FZ6A 2VLFA 1TOKA 2KFPA 4A0HA 2HP1A 1O4SA 2D7ZA 1KL1A 2Z61A 3NYUA 4BHDA 3A9YA 3HQTA 4OYTA 2C7TA 3BCBA 3PPLA 1P3WA 1GBNA 1M4NA 3I16A 3ISLA 4EMYA 4OC9A 1GEWA 3ELEA 5BJ3A 5M49A 1Y4IA 1V72A 3FQ7A 4R5ZA 3BWNC 4R2NA 1SZUA 4WLHA 5TF5A 4WYDA 2VI8A 2EO5A 1B5PA 3HDOA 4OTLA 2BI9A 1IBJA 2RFVA 2VMZA 3B1CA 4ZM4A 1AHGA 3KKIA 5G2QA 1GDEA 1LK9A 2HZPA 1LC8A 1AKAA 2W7DA 1BQAA 1DGDA 4ADDA 2X8UA 3IF2A 5EIGB 3KE3A 2Z9XA 3TATA 1AAWA 5FT8A 1M0NA 3NDNA 2C44A 4MSOA 4Q75A 3B46A 1GC4A 1OATA 1LW4A 4WXGA 2Z1ZA 3MKJA 1DFOA 4JEXA 2QB2A 1X0MA 4GE4A 4BA5A 1AAMA 1YJZA 3WZFA 1JG8A 4ZWMA 3BWOA 3AEMC 4WP0A 2AY5A 4AOAA 1WYVB 1YJSA 1S07A 5IWQA 2YRIA 1QJ3A 3AV7A 3RBFA 4HVKA 2Q7WA 1YAAA 3EZ1A 5HXXA 3K7YA 4IYOB 2AATA 4U1TA 5FT5A 1KL2A 1OHVA 5G4IA 2HUFA 2VIAA 2HUUA 3MAUA 1KMJA 3AENA 3ASAA 3GWPA 2HOXA 4E77A 1I29A 1C7OA 5C6UA 2O7CA 3HL2A 1TOEA 3EI8A 2W7IA 3W1JA 4A00A 2OQXA 3LWSA 4GRXA 4W8IA 4K2BA 4R5FA 2XBNA 3ELPA 1AKBA 2WB6A 1WYTB 2WK7A 3GETA 1J32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S06 A;  5M4B A;  3LVJ A;  3FDD A;  3USF A;  2AY9 A;  1FG3 A;  2FNU A;  2D64 A;  2Z20 A;  3F0H A;  8AAT A;  4W5K A;  5D5S A;  1LKC A;  2QBT A;  1C0N A;  4RLG A;  1JS3 A;  3LVL B;  4KXK A;  3JZL A;  1H0C A;  4OBV A;  1S0A A;  1AMQ A;  1ASD A;  3Q8N A;  2VMN A;  4B98 A;  3EI9 A;  2BI5 A;  1AIA A;  1ARH A;  1ASE A;  2OKK A;  3N5M A;  1DTY A;  1M7Y A;  1TAS A;  1V2D A;  3QGU A;  2W7F A;  1AJS A;  3GZC A;  1IAY A;  1AKC A;  1M32 A;  2VMO A;  4TV7 A;  1WKH A;  1ZOD A;  1JF9 A;  1AY4 A;  1FC4 A;  1ARI A;  1M0O A;  4XQ2 A;  2AY7 A;  1W7L A;  3WX9 A;  2CTZ A;  3FDB A;  3JWA A;  2CJH A;  3N75 A;  2JIS A;  3L8A A;  1ELQ A;  3FQ8 A;  4Q31 A;  2BWP A;  2VLH A;  3OKS A;  4LNM A;  4JF0 A;  4AO4 A;  2YHK A;  3TCM A;  3DXV A;  2CIN A;  2YKU A;  2W7H A;  2YCT A;  2Z9U A;  5G09 A;  4E1O A;  2BI2 A;  2DGL A;  4Q76 A;  5EUN A;  2VGT A;  2VMS A;  3NYT A;  2AY1 A;  4RAE A;  1TOI A;  1ASC A;  3ACZ A;  3G8M A;  4OCA A;  2YRR A;  2NMP A;  4N0W A;  5G0A A;  1U08 A;  1TAR A;  3MAD A;  5G2P A;  1CZC A;  3AOW A;  1SF2 A;  3PA9 A;  4F5H A;  5HHY A;  1MGV A;  2PB2 A;  2VGV A;  1C7G A;  3JU7 A;  3B8X A;  3HBX A;  4W1V A;  5JAY A;  1QIR A;  3DRD A;  3FQA A;  4HF8 A;  3RI6 A;  4CBS A;  3MAF B;  3AEJ A;  1AIB A;  3BN1 A;  1G4X A;  3DZZ A;  4XEW A;  1AMR A;  4A0R A;  4KAM A;  3RCH A;  3F9T A;  3RUY A;  3WCN A;  4EU1 A;  4WXF A;  3AOV A;  1SZK A;  3DYD A;  4NOG A;  1CZE A;  1O62 A;  1UU0 A;  3DR4 A;  4I8A A;  1QZ9 A;  3RBL A;  1CS1 A;  2VMT A;  1RV4 A;  1PMM A;  2XH1 A;  4GEB A;  2CJG A;  3AEJ C;  1VJO A;  2D63 A;  3MEB A;  4H51 A;  4JE5 A;  1BW0 A;  1N2T A;  4MKJ A;  1LC7 A;  1OHY A;  3E2Y A;  3ZZJ A;  4ADE A;  4ZM3 A;  1CQ8 A;  4XJP A;  1SZS A;  3HT4 A;  5EIG A;  5DJ1 A;  3FFH A;  2R0T A;  1ARG A;  4F4E A;  4CXQ A;  3UE8 A;  1S09 A;  3A9Z A;  2ZYJ A;  4WYF A;  3ASB A;  1RVY A;  3VK4 A;  4F5K A;  3IHJ A;  3W1I A;  1ASG A;  4MGR A;  1YJY A;  5EUD A;  1I48 A;  3WLX A;  2PO3 A;  1AHX A;  1OXO A;  4A0F A;  2C81 A;  4CVQ A;  1G4V A;  7AAT A;  1B9I A;  2ZY2 A;  3CAI A;  1WYV A;  3NRA A;  3KGX A;  4JEW A;  2BI3 A;  3WCO A;  2JGT A;  1BQD A;  4W91 A;  2GMS A;  3HMU A;  3LY1 A;  4IYO A;  4XJM A;  2CST A;  3FZ8 A;  4M2K A;  1AMA A;  3VOM A;  2OAT A;  1GEY A;  4JF1 A;  3A8U X;  1AY5 A;  2D61 A;  3L44 A;  5F8V A;  4AO9 A;  1EQB A;  1YNU A;  2W7E A;  4WLJ A;  3A9X A;  1G7W A;  4F5M A;  3TFU A;  4JEV A;  3WY7 A;  3II0 A;  3NTJ A;  1WYT A;  2DKJ A;  4W1W A;  4WD2 A;  2C0R A;  2W8V A;  4JE5 D;  2CY8 A;  4AZJ A;  2ZP7 A;  1YIZ A;  1WYU B;  1V2E A;  2WK9 A;  2WK8 A;  3PGY A;  1GD9 A;  1AX4 A;  1Z3Z A;  2CAN A;  2VGZ A;  3PIU A;  3EI6 A;  1AHY A;  2BWO A;  4J5U A;  1LS3 A;  2VI9 A;  3NU8 A;  4QGR A;  1IAX A;  4P3M A;  2X3L A;  1C4K A;  2DR1 A;  3FD0 A;  1O61 A;  1KKJ A;  1DKA A;  3B1E A;  3M5U A;  1PMO A;  4LW2 A;  3GZD A;  2DOU A;  4EB5 A;  1W7N A;  2E7J A;  3D6K A;  2G6W A;  5E5I A;  4IY7 A;  4PIW A;  4PFF A;  1BJW A;  4Y0I A;  4DBC A;  4F5I A;  1QIT A;  1WST A;  1ELU A;  4UQV A;  2YCN A;  3DXW A;  4JEY A;  4ISY A;  2BYL A;  2WKA A;  4N0B A;  4WBT A;  2CFB A;  4WYA A;  4WYC A;  3NX3 A;  3TFT A;  2VGU A;  3WGC A;  3GZD C;  3FVX A;  4XK1 A;  4E3R A;  2DGK A;  1TOJ A;  3EZS A;  5F9S A;  4MQP A;  1ARS A;  1B9H A;  1QJ5 A;  1XEY A;  5D95 A;  2X5D A;  4WYE A;  1IJI A;  3AEL A;  4PVF A;  4MQR A;  3VK3 A;  4RJ0 A;  4OBU A;  2EZ2 A;  4RKC A;  3GR9 A;  3JWB A;  1Z7D A;  2QA3 A;  4FL0 A;  1IUG A;  4TN4 A;  1CQ7 A;  1O69 A;  2OKJ A;  1UU1 A;  5FT4 A;  1E5E A;  1SPA A;  1W23 A;  1VP4 A;  2BHX A;  2QMA A;  1KMK A;  3AEP A;  1EJI A;  2BKW A;  2EGY A;  2FM1 A;  2CB1 A;  3R9A A;  3LVM A;  4UOY A;  2ORD A;  1XI9 A;  1MDX A;  2AY3 A;  3DR7 A;  4K2M A;  3G0T A;  3E6G A;  2BWN A;  3CQ4 A;  1IX6 A;  4ADC A;  1BJ4 A;  3MC6 A;  4RKD A;  1TPL A;  1W3U A;  2W8T A;  2TPL A;  3FRK A;  3R4T A;  4K2I A;  4WXB A;  2VYC A;  4XAU A;  2Z9W A;  2HUI A;  3B1D A;  4WB0 B;  1MLY A;  3ZRR A;  4ZWV A;  2BIG A;  3BS8 A;  1TAT A;  3UAK A;  4AZK A;  2ZY4 A;  1BS0 A;  5LHA A;  2X5F A;  1AHF A;  3I4J A;  2YOB A;  2D5Y A;  3JTX A;  4ZSW A;  3TQX A;  1AHE A;  3FKD A;  4IXS A;  4KYO A;  1B5O A;  3EUC A;  3GJU A;  3KGW A;  3P6K A;  1GEX A;  3BC8 A;  1IVR A;  2V0Y A;  5DJ9 A;  1SVV A;  4U2H A;  3WKS A;  4DQ6 A;  1GCK A;  1MLZ A;  1SFF A;  1ZOB A;  3PD6 B;  4ZLV A;  1AJS B;  4UHM A;  3PDB B;  4ZDP A;  4ATP A;  4A6R A;  3LV2 A;  3EIB A;  1ASM A;  4Y0D A;  3WKR A;  4EB7 A;  3FVU A;  3GBX A;  1PFF A;  3E2F A;  1RVU A;  4ZAS A;  1YIY A;  2W8J A;  1ASL A;  2EZ1 A;  1MDO A;  4XJO A;  4F5F A;  1CL1 A;  2FQ6 A;  5E4Z A;  4ADB A;  4E3Q A;  4LNL A;  4IX8 A;  4OT8 A;  1D7U A;  3FSL A;  3ZZK A;  5BJ4 A;  1BJO B;  2HOR A;  3VAX A;  2YKY A;  2E54 A;  1N31 A;  4GSA A;  3T32 A;  3WGB A;  3DOD A;  1BKG A;  1S08 A;  2VMW A;  3LG0 A;  4B9B A;  3F6T A;  5K8B A;  4RJY A;  1BT4 A;  5E3K A;  1G7X A;  2OGA A;  4R8D A;  3BWN A;  3NYS A;  5G4J A;  4EFF A;  1OXP A;  2VGW A;  4JEZ A;  3DC1 A;  4IXO A;  4A6T A;  2EH6 A;  1ECX A;  2VIB A;  4LC3 A;  1UU2 A;  4RIZ A;  3ECD A;  1I41 A;  4WYG A;  5EAV A;  4BA4 A;  2VMP A;  3CBF A;  3E2Z B;  5HDM A;  1LW5 A;  2VMR A;  1WKG A;  3FFR A;  1PG8 A;  5DX5 A;  4GE9 A;  2VMQ A;  3LVK A;  3RCH B;  5M4D A;  4Q6R A;  2R5C B;  2R5E A;  4XJL A;  1CQ6 A;  3PAA A;  5I92 A;  1V2F A;  3CQ5 A;  1N8P A;  1MDZ A;  2E7I A;  2QB3 A;  1GC3 A;  4ITX A;  4J8L A;  1MAP A;  4UHO A;  3VP6 A;  4A6U A;  4F5G A;  5EAA A;  1VEF A;  5AX8 A;  4IW7 A;  1X29 A;  1TOG A;  9AAT A;  4F5L A;  1MAQ A;  3AEM A;  2DKB A;  2FN6 A;  3FZ7 A;  2AY6 A;  1B4X A;  1AY8 A;  4MKK A;  1X2A A;  1GC2 A;  2VMY A;  2AY4 A;  3MBB A;  4BMK A;  2YKX A;  2ZY3 A;  1QIS A;  3CQ6 A;  2CH2 A;  4CBR A;  5M46 A;  1X28 A;  2GSA A;  3COG A;  2BI1 A;  4Y0H A;  5EFS A;  4A72 A;  2JJG A;  2JJF A;  2GQN A;  4P7Y A;  2HOY A;  4LNJ A;  4A0G A;  3DU4 A;  4O6Z A;  2BIE A;  4RM1 A;  1KKP A;  4GDY A;  3QI6 A;  2W8U A;  2O0R A;  3NNK A;  2OGE A;  2R2N A;  3BCA A;  3E9K A;  1B8G A;  3HLM A;  2D66 A;  4AH3 A;  3FTB A;  2YCP A;  1D2F A;  4OMA A;  4UHN A;  2ZC0 A;  1ZC9 A;  2BYJ A;  3BCX A;  4ATQ A;  4ZAH A;  2GMU A;  3EI5 A;  2HP2 A;  4CXR A;  1GC0 A;  2FNI A;  3EIA A;  2ZUK A;  3N0L A;  5EUE A;  2QLR A;  3NUI A;  1DJU A;  3FVS A;  1I43 A;  3NU7 A;  3QBO A;  3QPG A;  4MQQ A;  4WB0 A;  4ZDO A;  2HOZ A;  2Z67 A;  2Z9V A;  3MAF A;  3K40 A;  2AY2 A;  1ASF A;  1BJN A;  2O1B A;  2PB0 A;  3FCR A;  5LH9 A;  2W7L A;  3ZRQ A;  2E7U A;  5FT6 A;  3K28 A;  2CH1 A;  1E5F A;  4GE7 A;  2VGS A;  3AEN B;  1AJR A;  1C9C A;  3UWC A;  1ART A;  4BQ0 A;  3G7Q A;  3PD6 A;  1AMS A;  2GB3 A;  2W7G A;  3PDB A;  1ASA A;  4FFC A;  4ZDL A;  5EQC A;  3JW9 A;  2ZSL A;  2W7M A;  1ASN A;  1C7N A;  3QN6 A;  4ZSY A;  2DGM A;  1AIC A;  1UKJ A;  3QHX A;  2FYF A;  1OHW A;  1YOO A;  2CJD A;  4RIT A;  1RV3 A;  3AAT A;  4MY5 A;  5DB5 A;  1J04 A;  3H7F A;  3W1H A;  1D7S A;  4PFN A;  2AEU A;  3OP7 A;  1FG7 A;  2D7Y A;  3H14 A;  1D7V A;  3HVY A;  1BJO A;  1LC5 A;  4LW4 A;  2ZY5 A;  3MC6 C;  3RQ1 A;  3PJ0 A;  3QM2 A;  1QGN A;  2JG2 A;  2VMV A;  2D65 A;  2AY8 A;  1H1C A;  1JS6 A;  3VK2 A;  1W7M A;  2JJH A;  3AEO A;  2BIA A;  1T3I A;  2ZSM A;  1DJE A;  1CJ0 A;  3ATH A;  1ASB A;  1IX7 A;  2W7K A;  4F5J A;  3NUB A;  2Z1Y A;  2JJE A;  1M6S A;  3E2Z A;  1EG5 A;  1DGE A;  2AEV A;  4L0O A;  4DGT A;  2W7J A;  3ZRP A;  1DJ9 A;  1M0P A;  2F8J A;  2YKV A;  2VMU A;  3PDX A;  2W8W A;  4W1X A;  2R5C A;  3EI7 A;  1M0Q A;  3GSB A;  1CL2 A;  3I5T A;  2VMX A;  3E77 A;  4M2J A;  4TMR A;  1ORD A;  3P1T A;  2ZJG A;  4ITG A;  2EPJ A;  1D7R A;  4IXZ A;  3A2B A;  3BB8 A;  1IX8 A;  3BV0 A;  2V1P A;  4M2M A;  5J8Q A;  1WYU A;  3FZ6 A;  2VLF A;  1TOK A;  4A0H A;  2HP1 A;  1O4S A;  2D7Z A;  1KL1 A;  2Z61 A;  3NYU A;  4BHD A;  3A9Y A;  3HQT A;  4OYT A;  2C7T A;  3BCB A;  3PPL A;  1P3W A;  1GBN A;  1M4N A;  3I16 A;  3ISL A;  4EMY A;  4OC9 A;  1GEW A;  3ELE A;  5BJ3 A;  5M49 A;  1Y4I A;  1V72 A;  3FQ7 A;  4R5Z A;  3BWN C;  4R2N A;  1SZU A;  4WLH A;  5TF5 A;  4WYD A;  2VI8 A;  2EO5 A;  1B5P A;  3HDO A;  4OTL A;  2BI9 A;  1IBJ A;  2RFV A;  2VMZ A;  3B1C A;  4ZM4 A;  1AHG A;  3KKI A;  5G2Q A;  1GDE A;  1LK9 A;  2HZP A;  1LC8 A;  1AKA A;  2W7D A;  1BQA A;  1DGD A;  4ADD A;  2X8U A;  3IF2 A;  5EIG B;  3KE3 A;  2Z9X A;  3TAT A;  1AAW A;  5FT8 A;  1M0N A;  3NDN A;  2C44 A;  4MSO A;  4Q75 A;  3B46 A;  1GC4 A;  1OAT A;  1LW4 A;  4WXG A;  2Z1Z A;  3MKJ A;  1DFO A;  4JEX A;  2QB2 A;  1X0M A;  4GE4 A;  4BA5 A;  1AAM A;  1YJZ A;  3WZF A;  1JG8 A;  4ZWM A;  3BWO A;  3AEM C;  4WP0 A;  2AY5 A;  4AOA A;  1WYV B;  1YJS A;  1S07 A;  5IWQ A;  2YRI A;  1QJ3 A;  3AV7 A;  3RBF A;  4HVK A;  2Q7W A;  1YAA A;  3EZ1 A;  5HXX A;  3K7Y A;  4IYO B;  2AAT A;  4U1T A;  5FT5 A;  1KL2 A;  1OHV A;  5G4I A;  2HUF A;  2VIA A;  2HUU A;  3MAU A;  1KMJ A;  3AEN A;  3ASA A;  3GWP A;  2HOX A;  4E77 A;  1I29 A;  1C7O A;  5C6U A;  2O7C A;  3HL2 A;  1TOE A;  3EI8 A;  2W7I A;  3W1J A;  4A00 A;  2OQX A;  3LWS A;  4GRX A;  4W8I A;  4K2B A;  4R5F A;  2XBN A;  3ELP A;  1AKB A;  1WYT B;  2WK7 A;  3GET A;  1J32 A; 
#chains in the Genus database with same CATH topology
 1S06 A;  5M4B A;  3LVJ A;  3FDD A;  3USF A;  2AY9 A;  1FG3 A;  2FNU A;  2D64 A;  2Z20 A;  3F0H A;  8AAT A;  4W5K A;  5D5S A;  1LKC A;  2QBT A;  1C0N A;  4RLG A;  1JS3 A;  3LVL B;  4KXK A;  3JZL A;  1H0C A;  4OBV A;  1S0A A;  1AMQ A;  1ASD A;  3N7N A;  3Q8N A;  2VMN A;  4B98 A;  3EI9 A;  2BI5 A;  1AIA A;  1ARH A;  1ASE A;  2OKK A;  3N5M A;  1DTY A;  1M7Y A;  1TAS A;  1V2D A;  3QGU A;  2W7F A;  1AJS A;  3GZC A;  1IAY A;  1AKC A;  1M32 A;  2VMO A;  4TV7 A;  1WKH A;  1ZOD A;  1JF9 A;  1AY4 A;  1FC4 A;  1ARI A;  1M0O A;  4XQ2 A;  2AY7 A;  1W7L A;  3WX9 A;  2CTZ A;  3FDB A;  3JWA A;  2CJH A;  3N75 A;  2JIS A;  3L8A A;  1ELQ A;  3FQ8 A;  4Q31 A;  2BWP A;  3N4S A;  2VLH A;  3OKS A;  4LNM A;  4JF0 A;  4AO4 A;  2YHK A;  3TCM A;  3DXV A;  2CIN A;  2YKU A;  3N4X A;  2W7H A;  2YCT A;  2Z9U A;  5G09 A;  4E1O A;  2BI2 A;  2DGL A;  4Q76 A;  5EUN A;  2VGT A;  2VMS A;  3NYT A;  2AY1 A;  4RAE A;  1TOI A;  1ASC A;  3ACZ A;  3G8M A;  4OCA A;  2YRR A;  2NMP A;  4N0W A;  5G0A A;  1U08 A;  1TAR A;  3MAD A;  5G2P A;  1CZC A;  3AOW A;  1SF2 A;  3PA9 A;  4F5H A;  5HHY A;  1MGV A;  2PB2 A;  2VGV A;  1C7G A;  3JU7 A;  3B8X A;  3HBX A;  4W1V A;  5JAY A;  1QIR A;  3DRD A;  3FQA A;  4HF8 A;  3RI6 A;  4CBS A;  3MAF B;  3AEJ A;  1AIB A;  3BN1 A;  1G4X A;  3DZZ A;  4XEW A;  1AMR A;  4A0R A;  4KAM A;  3RCH A;  3F9T A;  3RUY A;  3WCN A;  4EU1 A;  4WXF A;  3AOV A;  1SZK A;  3DYD A;  4NOG A;  1CZE A;  1O62 A;  1UU0 A;  3DR4 A;  4I8A A;  1QZ9 A;  3RBL A;  1CS1 A;  2VMT A;  1RV4 A;  1PMM A;  2XH1 A;  4GEB A;  2CJG A;  3AEJ C;  1VJO A;  2D63 A;  3MEB A;  4H51 A;  4JE5 A;  1BW0 A;  1N2T A;  4MKJ A;  1LC7 A;  1OHY A;  3E2Y A;  3ZZJ A;  4ADE A;  4ZM3 A;  1CQ8 A;  4XJP A;  1SZS A;  3HT4 A;  5EIG A;  5DJ1 A;  3FFH A;  2R0T A;  1ARG A;  4F4E A;  4CXQ A;  3N4R A;  3UE8 A;  1S09 A;  3A9Z A;  2ZYJ A;  4WYF A;  3ASB A;  1RVY A;  3VK4 A;  4F5K A;  3IHJ A;  3W1I A;  1ASG A;  4MGR A;  1YJY A;  5EUD A;  4K05 A;  4H63 Q;  1I48 A;  3WLX A;  2PO3 A;  1AHX A;  1OXO A;  4A0F A;  2C81 A;  4CVQ A;  1G4V A;  7AAT A;  1B9I A;  2ZY2 A;  3CAI A;  1WYV A;  3NRA A;  3KGX A;  4JEW A;  2BI3 A;  3WCO A;  2JGT A;  1BQD A;  4W91 A;  2GMS A;  3HMU A;  3LY1 A;  4IYO A;  4XJM A;  2CST A;  3FZ8 A;  4M2K A;  1AMA A;  3VOM A;  2OAT A;  1GEY A;  4JF1 A;  3A8U X;  1AY5 A;  2D61 A;  3L44 A;  5F8V A;  4AO9 A;  1EQB A;  1YNU A;  2W7E A;  4WLJ A;  3A9X A;  1G7W A;  4F5M A;  3TFU A;  4JEV A;  3WY7 A;  3II0 A;  3NTJ A;  1WYT A;  2DKJ A;  4W1W A;  4WD2 A;  2C0R A;  3H9X A;  2W8V A;  4JE5 D;  2CY8 A;  4AZJ A;  2ZP7 A;  1YIZ A;  1WYU B;  1V2E A;  2WK9 A;  2WK8 A;  3PGY A;  1GD9 A;  1AX4 A;  1Z3Z A;  2CAN A;  2VGZ A;  3PIU A;  3EI6 A;  1AHY A;  2BWO A;  4J5U A;  1LS3 A;  2VI9 A;  3NU8 A;  4QGR A;  1IAX A;  4P3M A;  2X3L A;  1C4K A;  2DR1 A;  3FD0 A;  1O61 A;  1KKJ A;  1DKA A;  3B1E A;  3M5U A;  1PMO A;  4LW2 A;  3GZD A;  2DOU A;  4EB5 A;  1W7N A;  2E7J A;  3D6K A;  2G6W A;  5E5I A;  4IY7 A;  4PIW A;  4PFF A;  1BJW A;  4Y0I A;  4DBC A;  4F5I A;  1QIT A;  1WST A;  1ELU A;  4UQV A;  2YCN A;  3DXW A;  4JEY A;  4ISY A;  2BYL A;  2WKA A;  4N0B A;  4WBT A;  2CFB A;  4WYA A;  4WYC A;  3NX3 A;  3TFT A;  2VGU A;  3WGC A;  3GZD C;  3FVX A;  4XK1 A;  4E3R A;  2DGK A;  1TOJ A;  3EZS A;  5F9S A;  4MQP A;  1ARS A;  1B9H A;  1QJ5 A;  1XEY A;  5D95 A;  2X5D A;  4WYE A;  1IJI A;  3AEL A;  4PVF A;  4MQR A;  3VK3 A;  4RJ0 A;  4OBU A;  2EZ2 A;  4RKC A;  3GR9 A;  3JWB A;  1Z7D A;  2QA3 A;  4FL0 A;  1IUG A;  4TN4 A;  1CQ7 A;  1O69 A;  2OKJ A;  1UU1 A;  5FT4 A;  1E5E A;  1SPA A;  1W23 A;  1VP4 A;  2BHX A;  2QMA A;  1KMK A;  3AEP A;  1EJI A;  2BKW A;  2EGY A;  2FM1 A;  2CB1 A;  3R9A A;  2EYQ A;  3LVM A;  4UOY A;  2ORD A;  1XI9 A;  1MDX A;  2AY3 A;  3DR7 A;  4K2M A;  3G0T A;  3E6G A;  5KTB A;  2BWN A;  3CQ4 A;  1IX6 A;  4ADC A;  1BJ4 A;  3MC6 A;  4RKD A;  1TPL A;  1W3U A;  2W8T A;  2TPL A;  3FRK A;  3R4T A;  4K2I A;  4WXB A;  2VYC A;  4XAU A;  2Z9W A;  2HUI A;  3B1D A;  4WB0 B;  1MLY A;  3ZRR A;  4ZWV A;  2BIG A;  3BS8 A;  1TAT A;  3UAK A;  4AZK A;  2ZY4 A;  1BS0 A;  5LHA A;  2X5F A;  1AHF A;  3I4J A;  2YOB A;  2D5Y A;  3JTX A;  4ZSW A;  3TQX A;  1AHE A;  3FKD A;  4IXS A;  4KYO A;  1B5O A;  3EUC A;  3GJU A;  3KGW A;  3P6K A;  1GEX A;  3BC8 A;  1IVR A;  2V0Y A;  5DJ9 A;  1SVV A;  4U2H A;  3WKS A;  4DQ6 A;  1GCK A;  1MLZ A;  1SFF A;  1ZOB A;  3PD6 B;  4ZLV A;  1AJS B;  4UHM A;  3PDB B;  4ZDP A;  4ATP A;  4A6R A;  3LV2 A;  3EIB A;  1ASM A;  4Y0D A;  3WKR A;  4EB7 A;  3FVU A;  3GBX A;  2A1V A;  1PFF A;  3E2F A;  1RVU A;  4ZAS A;  1YIY A;  2W8J A;  1ASL A;  2EZ1 A;  1MDO A;  4XJO A;  4F5F A;  1CL1 A;  2FQ6 A;  5E4Z A;  4ADB A;  4E3Q A;  4LNL A;  4IX8 A;  4OT8 A;  1D7U A;  3FSL A;  3ZZK A;  5BJ4 A;  1BJO B;  2HOR A;  1KAF A;  3VAX A;  2YKY A;  2E54 A;  1N31 A;  4GSA A;  3T32 A;  3WGB A;  3DOD A;  1BKG A;  1S08 A;  2VMW A;  3LG0 A;  4B9B A;  3F6T A;  5K8B A;  4RJY A;  1BT4 A;  5E3K A;  1G7X A;  2OGA A;  4R8D A;  3BWN A;  3NYS A;  5G4J A;  4EFF A;  1OXP A;  2VGW A;  4JEZ A;  3DC1 A;  4IXO A;  4A6T A;  2EH6 A;  1ECX A;  2VIB A;  4LC3 A;  1UU2 A;  4RIZ A;  3ECD A;  1I41 A;  4WYG A;  5EAV A;  4BA4 A;  2VMP A;  3CBF A;  3E2Z B;  5HDM A;  1LW5 A;  2VMR A;  1WKG A;  3FFR A;  1PG8 A;  5DX5 A;  4GE9 A;  2VMQ A;  3LVK A;  3RCH B;  5M4D A;  4Q6R A;  2R5C B;  2R5E A;  4XJL A;  1CQ6 A;  3PAA A;  5I92 A;  1V2F A;  3CQ5 A;  1N8P A;  1MDZ A;  2E7I A;  2QB3 A;  1GC3 A;  4ITX A;  4J8L A;  1MAP A;  4UHO A;  3VP6 A;  4A6U A;  4F5G A;  5EAA A;  1VEF A;  5AX8 A;  4IW7 A;  1X29 A;  1TOG A;  9AAT A;  4F5L A;  1MAQ A;  3AEM A;  2DKB A;  2FN6 A;  3FZ7 A;  2AY6 A;  1B4X A;  1AY8 A;  4MKK A;  1X2A A;  1GC2 A;  2VMY A;  2AY4 A;  3MBB A;  4BMK A;  2YKX A;  2ZY3 A;  1QIS A;  3CQ6 A;  2CH2 A;  4CBR A;  5M46 A;  1X28 A;  2GSA A;  3COG A;  2BI1 A;  4Y0H A;  5EFS A;  4A72 A;  2JJG A;  2JJF A;  2GQN A;  4P7Y A;  2HOY A;  4LNJ A;  4A0G A;  3DU4 A;  4O6Z A;  2BIE A;  4RM1 A;  1KKP A;  4GDY A;  3QI6 A;  2W8U A;  2O0R A;  3NNK A;  2OGE A;  2R2N A;  3BCA A;  3E9K A;  1B8G A;  3HLM A;  2D66 A;  4AH3 A;  3FTB A;  2YCP A;  1D2F A;  4OMA A;  4UHN A;  2ZC0 A;  2G7J A;  1ZC9 A;  2BYJ A;  3BCX A;  4ATQ A;  4ZAH A;  2GMU A;  3EI5 A;  2HP2 A;  4CXR A;  1GC0 A;  2FNI A;  3EIA A;  2ZUK A;  3N0L A;  5EUE A;  2QLR A;  3NUI A;  1DJU A;  3FVS A;  1I43 A;  3NU7 A;  3QBO A;  3QPG A;  4MQQ A;  4WB0 A;  4ZDO A;  2HOZ A;  2Z67 A;  2QSR A;  2Z9V A;  3MAF A;  3K40 A;  2AY2 A;  1ASF A;  1BJN A;  2O1B A;  2PB0 A;  3FCR A;  5LH9 A;  2W7L A;  3ZRQ A;  2E7U A;  2FKI A;  5FT6 A;  3K28 A;  2CH1 A;  1E5F A;  4GE7 A;  2VGS A;  3AEN B;  1AJR A;  1C9C A;  3UWC A;  1ART A;  4BQ0 A;  3G7Q A;  3PD6 A;  1AMS A;  2GB3 A;  2W7G A;  3PDB A;  1ASA A;  4FFC A;  4ZDL A;  5EQC A;  3JW9 A;  2ZSL A;  2W7M A;  1ASN A;  1C7N A;  3QN6 A;  4ZSY A;  2DGM A;  1AIC A;  1UKJ A;  3QHX A;  2FYF A;  1OHW A;  1YOO A;  2CJD A;  4RIT A;  1RV3 A;  3AAT A;  4MY5 A;  5DB5 A;  1J04 A;  3H7F A;  3W1H A;  1D7S A;  4PFN A;  2AEU A;  3OP7 A;  1FG7 A;  2D7Y A;  3H14 A;  1D7V A;  3HVY A;  1BJO A;  1LC5 A;  4LW4 A;  2ZY5 A;  3MC6 C;  3RQ1 A;  3PJ0 A;  3QM2 A;  1QGN A;  2JG2 A;  2VMV A;  2D65 A;  2AY8 A;  1H1C A;  1JS6 A;  3VK2 A;  1W7M A;  2JJH A;  3AEO A;  2BIA A;  1T3I A;  2ZSM A;  1DJE A;  1CJ0 A;  3ATH A;  1ASB A;  1IX7 A;  2W7K A;  4F5J A;  3NUB A;  2Z1Y A;  2JJE A;  1M6S A;  3E2Z A;  1EG5 A;  1DGE A;  2AEV A;  4L0O A;  4DGT A;  2W7J A;  3ZRP A;  1DJ9 A;  1M0P A;  2F8J A;  2YKV A;  2VMU A;  3PDX A;  2W8W A;  4W1X A;  2R5C A;  3EI7 A;  1M0Q A;  3GSB A;  1CL2 A;  3I5T A;  2VMX A;  3E77 A;  4M2J A;  4TMR A;  1ORD A;  3P1T A;  2ZJG A;  4ITG A;  2EPJ A;  1D7R A;  4IXZ A;  3A2B A;  3BB8 A;  1IX8 A;  3BV0 A;  2V1P A;  4M2M A;  5J8Q A;  1WYU A;  3FZ6 A;  2VLF A;  1TOK A;  2KFP A;  4A0H A;  2HP1 A;  1O4S A;  2D7Z A;  1KL1 A;  2Z61 A;  3NYU A;  4BHD A;  3A9Y A;  3HQT A;  4OYT A;  2C7T A;  3BCB A;  3PPL A;  1P3W A;  1GBN A;  1M4N A;  3I16 A;  3ISL A;  4EMY A;  4OC9 A;  1GEW A;  3ELE A;  5BJ3 A;  5M49 A;  1Y4I A;  1V72 A;  3FQ7 A;  4R5Z A;  3BWN C;  4R2N A;  1SZU A;  4WLH A;  5TF5 A;  4WYD A;  2VI8 A;  2EO5 A;  1B5P A;  3HDO A;  4OTL A;  2BI9 A;  1IBJ A;  2RFV A;  2VMZ A;  3B1C A;  4ZM4 A;  1AHG A;  3KKI A;  5G2Q A;  1GDE A;  1LK9 A;  2HZP A;  1LC8 A;  1AKA A;  2W7D A;  1BQA A;  1DGD A;  4ADD A;  2X8U A;  3IF2 A;  5EIG B;  3KE3 A;  2Z9X A;  3TAT A;  1AAW A;  5FT8 A;  1M0N A;  3NDN A;  2C44 A;  4MSO A;  4Q75 A;  3B46 A;  1GC4 A;  1OAT A;  1LW4 A;  4WXG A;  2Z1Z A;  3MKJ A;  1DFO A;  4JEX A;  2QB2 A;  1X0M A;  4GE4 A;  4BA5 A;  1AAM A;  1YJZ A;  3WZF A;  1JG8 A;  4ZWM A;  3BWO A;  3AEM C;  4WP0 A;  2AY5 A;  4AOA A;  1WYV B;  1YJS A;  1S07 A;  5IWQ A;  2YRI A;  1QJ3 A;  3AV7 A;  3RBF A;  4HVK A;  2Q7W A;  1YAA A;  3EZ1 A;  5HXX A;  3K7Y A;  4IYO B;  2AAT A;  4U1T A;  5FT5 A;  1KL2 A;  1OHV A;  5G4I A;  2HUF A;  2VIA A;  2HUU A;  3MAU A;  1KMJ A;  3AEN A;  3ASA A;  3GWP A;  2HOX A;  4E77 A;  1I29 A;  1C7O A;  5C6U A;  2O7C A;  3HL2 A;  1TOE A;  3EI8 A;  2W7I A;  3W1J A;  4A00 A;  2OQX A;  3LWS A;  4GRX A;  4W8I A;  4K2B A;  4R5F A;  2XBN A;  3ELP A;  1AKB A;  2WB6 A;  1WYT B;  2WK7 A;  3GET A;  1J32 A; 
#chains in the Genus database with same CATH homology
 1S06 A;  5M4B A;  3LVJ A;  3FDD A;  3USF A;  2AY9 A;  1FG3 A;  2FNU A;  2D64 A;  2Z20 A;  3F0H A;  8AAT A;  4W5K A;  5D5S A;  1LKC A;  2QBT A;  1C0N A;  4RLG A;  1JS3 A;  3LVL B;  4KXK A;  3JZL A;  1H0C A;  4OBV A;  1S0A A;  1AMQ A;  1ASD A;  3N7N A;  3Q8N A;  2VMN A;  4B98 A;  3EI9 A;  2BI5 A;  1AIA A;  1ARH A;  1ASE A;  2OKK A;  3N5M A;  1DTY A;  1M7Y A;  1TAS A;  1V2D A;  3QGU A;  2W7F A;  1AJS A;  3GZC A;  1IAY A;  1AKC A;  1M32 A;  2VMO A;  4TV7 A;  1WKH A;  1ZOD A;  1JF9 A;  1AY4 A;  1FC4 A;  1ARI A;  1M0O A;  4XQ2 A;  2AY7 A;  1W7L A;  3WX9 A;  2CTZ A;  3FDB A;  3JWA A;  2CJH A;  3N75 A;  2JIS A;  3L8A A;  1ELQ A;  3FQ8 A;  4Q31 A;  2BWP A;  3N4S A;  2VLH A;  3OKS A;  4LNM A;  4JF0 A;  4AO4 A;  2YHK A;  3TCM A;  3DXV A;  2CIN A;  2YKU A;  3N4X A;  2W7H A;  2YCT A;  2Z9U A;  5G09 A;  4E1O A;  2BI2 A;  2DGL A;  4Q76 A;  5EUN A;  2VGT A;  2VMS A;  3NYT A;  2AY1 A;  4RAE A;  1TOI A;  1ASC A;  3ACZ A;  3G8M A;  4OCA A;  2YRR A;  2NMP A;  4N0W A;  5G0A A;  1U08 A;  1TAR A;  3MAD A;  5G2P A;  1CZC A;  3AOW A;  1SF2 A;  3PA9 A;  4F5H A;  5HHY A;  1MGV A;  2PB2 A;  2VGV A;  1C7G A;  3JU7 A;  3B8X A;  3HBX A;  4W1V A;  5JAY A;  1QIR A;  3DRD A;  3FQA A;  4HF8 A;  3RI6 A;  4CBS A;  3MAF B;  3AEJ A;  1AIB A;  3BN1 A;  1G4X A;  3DZZ A;  4XEW A;  1AMR A;  4A0R A;  4KAM A;  3RCH A;  3F9T A;  3RUY A;  3WCN A;  4EU1 A;  4WXF A;  3AOV A;  1SZK A;  3DYD A;  4NOG A;  1CZE A;  1O62 A;  1UU0 A;  3DR4 A;  4I8A A;  1QZ9 A;  3RBL A;  1CS1 A;  2VMT A;  1RV4 A;  1PMM A;  2XH1 A;  4GEB A;  2CJG A;  3AEJ C;  1VJO A;  2D63 A;  3MEB A;  4H51 A;  4JE5 A;  1BW0 A;  1N2T A;  4MKJ A;  1LC7 A;  1OHY A;  3E2Y A;  3ZZJ A;  4ADE A;  4ZM3 A;  1CQ8 A;  4XJP A;  1SZS A;  3HT4 A;  5EIG A;  5DJ1 A;  3FFH A;  2R0T A;  1ARG A;  4F4E A;  4CXQ A;  3N4R A;  3UE8 A;  1S09 A;  3A9Z A;  2ZYJ A;  4WYF A;  3ASB A;  1RVY A;  3VK4 A;  4F5K A;  3IHJ A;  3W1I A;  1ASG A;  4MGR A;  1YJY A;  5EUD A;  4K05 A;  4H63 Q;  1I48 A;  3WLX A;  2PO3 A;  1AHX A;  1OXO A;  4A0F A;  2C81 A;  4CVQ A;  1G4V A;  7AAT A;  1B9I A;  2ZY2 A;  3CAI A;  1WYV A;  3NRA A;  3KGX A;  4JEW A;  2BI3 A;  3WCO A;  2JGT A;  1BQD A;  4W91 A;  2GMS A;  3HMU A;  3LY1 A;  4IYO A;  4XJM A;  2CST A;  3FZ8 A;  4M2K A;  1AMA A;  3VOM A;  2OAT A;  1GEY A;  4JF1 A;  3A8U X;  1AY5 A;  2D61 A;  3L44 A;  5F8V A;  4AO9 A;  1EQB A;  1YNU A;  2W7E A;  4WLJ A;  3A9X A;  1G7W A;  4F5M A;  3TFU A;  4JEV A;  3WY7 A;  3II0 A;  3NTJ A;  1WYT A;  2DKJ A;  4W1W A;  4WD2 A;  2C0R A;  3H9X A;  2W8V A;  4JE5 D;  2CY8 A;  4AZJ A;  2ZP7 A;  1YIZ A;  1WYU B;  1V2E A;  2WK9 A;  2WK8 A;  3PGY A;  1GD9 A;  1AX4 A;  1Z3Z A;  2CAN A;  2VGZ A;  3PIU A;  3EI6 A;  1AHY A;  2BWO A;  4J5U A;  1LS3 A;  2VI9 A;  3NU8 A;  4QGR A;  1IAX A;  4P3M A;  2X3L A;  1C4K A;  2DR1 A;  3FD0 A;  1O61 A;  1KKJ A;  1DKA A;  3B1E A;  3M5U A;  1PMO A;  4LW2 A;  3GZD A;  2DOU A;  4EB5 A;  1W7N A;  2E7J A;  3D6K A;  2G6W A;  5E5I A;  4IY7 A;  4PIW A;  4PFF A;  1BJW A;  4Y0I A;  4DBC A;  4F5I A;  1QIT A;  1WST A;  1ELU A;  4UQV A;  2YCN A;  3DXW A;  4JEY A;  4ISY A;  2BYL A;  2WKA A;  4N0B A;  4WBT A;  2CFB A;  4WYA A;  4WYC A;  3NX3 A;  3TFT A;  2VGU A;  3WGC A;  3GZD C;  3FVX A;  4XK1 A;  4E3R A;  2DGK A;  1TOJ A;  3EZS A;  5F9S A;  4MQP A;  1ARS A;  1B9H A;  1QJ5 A;  1XEY A;  5D95 A;  2X5D A;  4WYE A;  1IJI A;  3AEL A;  4PVF A;  4MQR A;  3VK3 A;  4RJ0 A;  4OBU A;  2EZ2 A;  4RKC A;  3GR9 A;  3JWB A;  1Z7D A;  2QA3 A;  4FL0 A;  1IUG A;  4TN4 A;  1CQ7 A;  1O69 A;  2OKJ A;  1UU1 A;  5FT4 A;  1E5E A;  1SPA A;  1W23 A;  1VP4 A;  2BHX A;  2QMA A;  1KMK A;  3AEP A;  1EJI A;  2BKW A;  2EGY A;  2FM1 A;  2CB1 A;  3R9A A;  2EYQ A;  3LVM A;  4UOY A;  2ORD A;  1XI9 A;  1MDX A;  2AY3 A;  3DR7 A;  4K2M A;  3G0T A;  3E6G A;  5KTB A;  2BWN A;  3CQ4 A;  1IX6 A;  4ADC A;  1BJ4 A;  3MC6 A;  4RKD A;  1TPL A;  1W3U A;  2W8T A;  2TPL A;  3FRK A;  3R4T A;  4K2I A;  4WXB A;  2VYC A;  4XAU A;  2Z9W A;  2HUI A;  3B1D A;  4WB0 B;  1MLY A;  3ZRR A;  4ZWV A;  2BIG A;  3BS8 A;  1TAT A;  3UAK A;  4AZK A;  2ZY4 A;  1BS0 A;  5LHA A;  2X5F A;  1AHF A;  3I4J A;  2YOB A;  2D5Y A;  3JTX A;  4ZSW A;  3TQX A;  1AHE A;  3FKD A;  4IXS A;  4KYO A;  1B5O A;  3EUC A;  3GJU A;  3KGW A;  3P6K A;  1GEX A;  3BC8 A;  1IVR A;  2V0Y A;  5DJ9 A;  1SVV A;  4U2H A;  3WKS A;  4DQ6 A;  1GCK A;  1MLZ A;  1SFF A;  1ZOB A;  3PD6 B;  4ZLV A;  1AJS B;  4UHM A;  3PDB B;  4ZDP A;  4ATP A;  4A6R A;  3LV2 A;  3EIB A;  1ASM A;  4Y0D A;  3WKR A;  4EB7 A;  3FVU A;  3GBX A;  2A1V A;  1PFF A;  3E2F A;  1RVU A;  4ZAS A;  1YIY A;  2W8J A;  1ASL A;  2EZ1 A;  1MDO A;  4XJO A;  4F5F A;  1CL1 A;  2FQ6 A;  5E4Z A;  4ADB A;  4E3Q A;  4LNL A;  4IX8 A;  4OT8 A;  1D7U A;  3FSL A;  3ZZK A;  5BJ4 A;  1BJO B;  2HOR A;  3VAX A;  2YKY A;  2E54 A;  1N31 A;  4GSA A;  3T32 A;  3WGB A;  3DOD A;  1BKG A;  1S08 A;  2VMW A;  3LG0 A;  4B9B A;  3F6T A;  5K8B A;  4RJY A;  1BT4 A;  5E3K A;  1G7X A;  2OGA A;  4R8D A;  3BWN A;  3NYS A;  5G4J A;  4EFF A;  1OXP A;  2VGW A;  4JEZ A;  3DC1 A;  4IXO A;  4A6T A;  2EH6 A;  1ECX A;  2VIB A;  4LC3 A;  1UU2 A;  4RIZ A;  3ECD A;  1I41 A;  4WYG A;  5EAV A;  4BA4 A;  2VMP A;  3CBF A;  3E2Z B;  5HDM A;  1LW5 A;  2VMR A;  1WKG A;  3FFR A;  1PG8 A;  5DX5 A;  4GE9 A;  2VMQ A;  3LVK A;  3RCH B;  5M4D A;  4Q6R A;  2R5C B;  2R5E A;  4XJL A;  1CQ6 A;  3PAA A;  5I92 A;  1V2F A;  3CQ5 A;  1N8P A;  1MDZ A;  2E7I A;  2QB3 A;  1GC3 A;  4ITX A;  4J8L A;  1MAP A;  4UHO A;  3VP6 A;  4A6U A;  4F5G A;  5EAA A;  1VEF A;  5AX8 A;  4IW7 A;  1X29 A;  1TOG A;  9AAT A;  4F5L A;  1MAQ A;  3AEM A;  2DKB A;  2FN6 A;  3FZ7 A;  2AY6 A;  1B4X A;  1AY8 A;  4MKK A;  1X2A A;  1GC2 A;  2VMY A;  2AY4 A;  3MBB A;  4BMK A;  2YKX A;  2ZY3 A;  1QIS A;  3CQ6 A;  2CH2 A;  4CBR A;  5M46 A;  1X28 A;  2GSA A;  3COG A;  2BI1 A;  4Y0H A;  5EFS A;  4A72 A;  2JJG A;  2JJF A;  2GQN A;  4P7Y A;  2HOY A;  4LNJ A;  4A0G A;  3DU4 A;  4O6Z A;  2BIE A;  4RM1 A;  1KKP A;  4GDY A;  3QI6 A;  2W8U A;  2O0R A;  3NNK A;  2OGE A;  2R2N A;  3BCA A;  3E9K A;  1B8G A;  3HLM A;  2D66 A;  4AH3 A;  3FTB A;  2YCP A;  1D2F A;  4OMA A;  4UHN A;  2ZC0 A;  2G7J A;  1ZC9 A;  2BYJ A;  3BCX A;  4ATQ A;  4ZAH A;  2GMU A;  3EI5 A;  2HP2 A;  4CXR A;  1GC0 A;  2FNI A;  3EIA A;  2ZUK A;  3N0L A;  5EUE A;  2QLR A;  3NUI A;  1DJU A;  3FVS A;  1I43 A;  3NU7 A;  3QBO A;  3QPG A;  4MQQ A;  4WB0 A;  4ZDO A;  2HOZ A;  2Z67 A;  2QSR A;  2Z9V A;  3MAF A;  3K40 A;  2AY2 A;  1ASF A;  1BJN A;  2O1B A;  2PB0 A;  3FCR A;  5LH9 A;  2W7L A;  3ZRQ A;  2E7U A;  2FKI A;  5FT6 A;  3K28 A;  2CH1 A;  1E5F A;  4GE7 A;  2VGS A;  3AEN B;  1AJR A;  1C9C A;  3UWC A;  1ART A;  4BQ0 A;  3G7Q A;  3PD6 A;  1AMS A;  2GB3 A;  2W7G A;  3PDB A;  1ASA A;  4FFC A;  4ZDL A;  5EQC A;  3JW9 A;  2ZSL A;  2W7M A;  1ASN A;  1C7N A;  3QN6 A;  4ZSY A;  2DGM A;  1AIC A;  1UKJ A;  3QHX A;  2FYF A;  1OHW A;  1YOO A;  2CJD A;  4RIT A;  1RV3 A;  3AAT A;  4MY5 A;  5DB5 A;  1J04 A;  3H7F A;  3W1H A;  1D7S A;  4PFN A;  2AEU A;  3OP7 A;  1FG7 A;  2D7Y A;  3H14 A;  1D7V A;  3HVY A;  1BJO A;  1LC5 A;  4LW4 A;  2ZY5 A;  3MC6 C;  3RQ1 A;  3PJ0 A;  3QM2 A;  1QGN A;  2JG2 A;  2VMV A;  2D65 A;  2AY8 A;  1H1C A;  1JS6 A;  3VK2 A;  1W7M A;  2JJH A;  3AEO A;  2BIA A;  1T3I A;  2ZSM A;  1DJE A;  1CJ0 A;  3ATH A;  1ASB A;  1IX7 A;  2W7K A;  4F5J A;  3NUB A;  2Z1Y A;  2JJE A;  1M6S A;  3E2Z A;  1EG5 A;  1DGE A;  2AEV A;  4L0O A;  4DGT A;  2W7J A;  3ZRP A;  1DJ9 A;  1M0P A;  2F8J A;  2YKV A;  2VMU A;  3PDX A;  2W8W A;  4W1X A;  2R5C A;  3EI7 A;  1M0Q A;  3GSB A;  1CL2 A;  3I5T A;  2VMX A;  3E77 A;  4M2J A;  4TMR A;  1ORD A;  3P1T A;  2ZJG A;  4ITG A;  2EPJ A;  1D7R A;  4IXZ A;  3A2B A;  3BB8 A;  1IX8 A;  3BV0 A;  2V1P A;  4M2M A;  5J8Q A;  1WYU A;  3FZ6 A;  2VLF A;  1TOK A;  2KFP A;  4A0H A;  2HP1 A;  1O4S A;  2D7Z A;  1KL1 A;  2Z61 A;  3NYU A;  4BHD A;  3A9Y A;  3HQT A;  4OYT A;  2C7T A;  3BCB A;  3PPL A;  1P3W A;  1GBN A;  1M4N A;  3I16 A;  3ISL A;  4EMY A;  4OC9 A;  1GEW A;  3ELE A;  5BJ3 A;  5M49 A;  1Y4I A;  1V72 A;  3FQ7 A;  4R5Z A;  3BWN C;  4R2N A;  1SZU A;  4WLH A;  5TF5 A;  4WYD A;  2VI8 A;  2EO5 A;  1B5P A;  3HDO A;  4OTL A;  2BI9 A;  1IBJ A;  2RFV A;  2VMZ A;  3B1C A;  4ZM4 A;  1AHG A;  3KKI A;  5G2Q A;  1GDE A;  1LK9 A;  2HZP A;  1LC8 A;  1AKA A;  2W7D A;  1BQA A;  1DGD A;  4ADD A;  2X8U A;  3IF2 A;  5EIG B;  3KE3 A;  2Z9X A;  3TAT A;  1AAW A;  5FT8 A;  1M0N A;  3NDN A;  2C44 A;  4MSO A;  4Q75 A;  3B46 A;  1GC4 A;  1OAT A;  1LW4 A;  4WXG A;  2Z1Z A;  3MKJ A;  1DFO A;  4JEX A;  2QB2 A;  1X0M A;  4GE4 A;  4BA5 A;  1AAM A;  1YJZ A;  3WZF A;  1JG8 A;  4ZWM A;  3BWO A;  3AEM C;  4WP0 A;  2AY5 A;  4AOA A;  1WYV B;  1YJS A;  1S07 A;  5IWQ A;  2YRI A;  1QJ3 A;  3AV7 A;  3RBF A;  4HVK A;  2Q7W A;  1YAA A;  3EZ1 A;  5HXX A;  3K7Y A;  4IYO B;  2AAT A;  4U1T A;  5FT5 A;  1KL2 A;  1OHV A;  5G4I A;  2HUF A;  2VIA A;  2HUU A;  3MAU A;  1KMJ A;  3AEN A;  3ASA A;  3GWP A;  2HOX A;  4E77 A;  1I29 A;  1C7O A;  5C6U A;  2O7C A;  3HL2 A;  1TOE A;  3EI8 A;  2W7I A;  3W1J A;  4A00 A;  2OQX A;  3LWS A;  4GRX A;  4W8I A;  4K2B A;  4R5F A;  2XBN A;  3ELP A;  1AKB A;  2WB6 A;  1WYT B;  2WK7 A;  3GET A;  1J32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...