4GE9A

Kynurenine aminotransferase ii inhibitors
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
428
structure length
428
Chain Sequence
MNYARFITAASAARNPSPIRTMTDILSRGPKSMISLAGGLPNPNMFPFKTAVITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSLRDILSRWKPEDAKNPQKNTPKFLYTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNSGRVPTFLSMDVDGRVIRADSFSKIISSGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEWGEEGFMAHVDRVIDFYSNQKDAILAAADKWLTGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFYVDSSAPSPYLRASFSSASPEQMDVAFQVLAQLIKESLLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine/alpha-aminoadipate aminotransferase, mitochondria
publication title Structure-Based Design of Irreversible Human KAT II Inhibitors: Discovery of New Potency-Enhancing Interactions.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 137
structure length 428
sequence length 428
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.39: 2-aminoadipate transaminase.
pdb deposition date 2012-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4ge9A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4ge9A03
1N31A 1J32A 1WYVA 5DJ9A 2VMPA 2E7IA 2Z9UA 4N0BA 1ASCA 3A9ZA 1OXPA 3DU4A 3N0LA 4MQPA 3N75A 4WB0B 1DJEA 3W1HA 2BHXA 4PVFA 3QM2A 4UQVA 4ZDOA 3PPLA 3KGWA 1WYTA 5EFSA 1QISA 2Z67A 3NYSA 1ASLA 1AIAA 1OATA 3P1TA 2BI9A 4A6UA 4AO9A 2BYJA 3K7YA 4XJPA 2FNIA 1AMAA 1QGNA 1V2EA 5JAYA 4BQ0A 1ZC9A 3NX3A 1AMQA 1ARHA 1WYUB 4XK1A 3QGUA 4GSAA 1TOIA 4IX8A 2VGWA 1RVUA 2TPLA 4MKJA 1IX7A 1OHYA 3VAXA 1DJ9A 3AV7A 2R0TA 4OTLA 4DBCA 3VP6A 4F5IA 2OKKA 1Z3ZA 2X5FA 2YCPA 2QLRA 3Q8NA 2CSTA 3MAUA 4JEZA 4M2JA 3RBFA 2HP1A 4U2HA 4ATPA 3MAFB 3PAAA 1IX8A 3VK3A 2W7LA 3FFRA 1CZCA 4GE7A 5E5IA 3VK2A 1X28A 4RJYA 1BJWA 4A6TA 1SF2A 2YCTA 1KMJA 1BS0A 3K40A 1GC3A 2Z61A 2C44A 2OATA 2VGTA 3A9YA 4B98A 1C7OA 2FNUA 4ZM4A 1AX4A 3ELPA 1TOJA 1CS1A 3WLXA 3LY1A 1KKPA 3BWNA 4TMRA 1KL1A 3FFHA 4IXSA 5J8QA 3B1EA 2O0RA 3BCBA 4FL0A 3AELA 2CB1A 5EUEA 3RBLA 3G7QA 4Q75A 4Q6RA 2W7FA 2Z9WA 2VMWA 3DR4A 2AY7A 2AY1A 2JG2A 2OGEA 2X5DA 1SZSA 3COGA 3P6KA 4LW2A 4A6RA 3LVKA 1SZKA 5D5SA 3AOVA 3E2ZA 1LS3A 2VGVA 1W23A 3FSLA 3FTBA 3KKIA 3GJUA 3A9XA 3EUCA 1ASMA 4RKCA 2ZY5A 4W5KA 1CQ6A 3PD6A 1ARTA 9AATA 4P7YA 2D65A 4WBTA 4PIWA 2VYCA 1JF9A 3R9AA 1ELQA 1GEXA 2R5CA 3AEMC 2D61A 2AY5A 4WP0A 1CQ7A 4XJOA 2AY6A 4Q31A 4MY5A 1MDOA 2HUUA 3LWSA 2PB0A 4F5MA 1PFFA 1I41A 1W7MA 2VMSA 3DC1A 4ISYA 2DGMA 1BJOB 1S07A 2CANA 1X0MA 3IHJA 4JEYA 4UOYA 2AY9A 2W8TA 4IY7A 1S09A 2AY4A 3PJ0A 1IAYA 4NOGA 1MAPA 3ZRRA 1ZODA 3HLMA 4KAMA 3FDDA 3QBOA 4P3MA 1AJRA 1WSTA 2EPJA 2QBTA 4WB0A 3ZRQA 4AZJA 2ORDA 1QJ3A 2DOUA 2AY3A 4A72A 3HL2A 1AHXA 2GMUA 1G7XA 1ORDA 1MLYA 1V2FA 3A8UX 4L0OA 3D6KA 4RAEA 2AATA 8AATA 3JU7A 2R5EA 3E2YA 3RI6A 1LKCA 3TFTA 2BI2A 2EZ1A 4JE5D 2FN6A 4CBRA 1WYUA 3E77A 3QN6A 1AJSA 1M0NA 1MLZA 2VMOA 3LVMA 5EUDA 4HVKA 2Z9VA 3QI6A 3PA9A 2D63A 1AHYA 1I48A 1CL1A 5FT8A 1FG7A 3GBXA 5IWQA 3TATA 1W3UA 1ASGA 2ZUKA 4WLJA 5F9SA 2VLFA 1S06A 4KYOA 3FZ8A 4RITA 2HOXA 3VK4A 2CINA 1AHEA 1QITA 2CJHA 2BWPA 2VMRA 2EGYA 1TPLA 3FZ6A 5LH9A 3DRDA 4ITGA 1LW4A 2Q7WA 4EMYA 4PFFA 2PB2A 1EJIA 3AOWA 7AATA 1YAAA 3ASAA 2YOBA 3M5UA 2ZY3A 1AKCA 4ATQA 4F5LA 4K2IA 1GEWA 4WYAA 1UU0A 4F5FA 1C7GA 1XI9A 4K2MA 3EZSA 4GE4A 2C7TA 2W8VA 3AEPA 4AZKA 3JTXA 4WLHA 1I29A 4UHOA 1J04A 4WYCA 4EB7A 5FT4A 4XEWA 3DYDA 3RQ1A 4XQ2A 5HHYA 4ADCA 2FYFA 2RFVA 3LVLB 1BQAA 1ECXA 3EI7A 1O4SA 1GC0A 2HOZA 3BS8A 1BW0A 4RIZA 1YIZA 3BWNC 3WKRA 4OMAA 2VMTA 2W7DA 2AY8A 1TARA 2QMAA 3CQ6A 4R8DA 1QZ9A 4W1WA 4F5KA 3H7FA 5C6UA 4OC9A 2VGZA 1AY4A 2JISA 3GETA 2WKAA 1ASAA 1JS6A 2HORA 1MAQA 1ASDA 1V2DA 3RUYA 4LNMA 5I92A 3H14A 1TOKA 3G0TA 2HUIA 1CZEA 1IAXA 1LC5A 4EU1A 2VGUA 2WK9A 3EI8A 3F0HA 4ZDLA 3JWAA 5DB5A 2BIEA 3W1IA 2ZYJA 3WX9A 3ATHA 2CH1A 4HF8A 4F4EA 1AKBA 1B5OA 4ZSWA 2D7ZA 2ZC0A 2FQ6A 1ARIA 2EZ2A 1P3WA 3MBBA 4H51A 3EI5A 5K8BA 1D7UA 1RVYA 1UU2A 1E5EA 2GB3A 2XH1A 3NUBA 4ZM3A 2G6WA 1KKJA 2YCNA 4E77A 5M49A 4F5JA 3BWOA 3K28A 3DXWA 3B1CA 3FVUA 1M32A 2R2NA 1VEFA 1IUGA 4MKKA 4LNJA 1FC4A 3PGYA 1M6SA 1W7LA 1WKGA 2QA3A 5AX8A 4A0RA 2VMVA 1ASEA 4N0WA 1AY8A 2FM1A 4WXFA 2VIBA 1ASFA 2ZY4A 4M2MA 3DXVA 4JEVA 1JS3A 3I4JA 3GR9A 4AH3A 1EG5A 1IX6A 3BV0A 3WGBA 3FZ7A 3R4TA 1D2FA 1AHGA 2YKYA 2E54A 4Y0DA 5LHAA 2W7HA 4E3QA 4W1VA 1LC8A 4UHNA 5G2QA 1QIRA 4RM1A 3AEJA 1YIYA 5BJ3A 5FT6A 4R2NA 3GZDA 4ZAHA 2AEUA 5EAAA 2DKBA 2E7UA 4R5FA 1BQDA 5G09A 2QB2A 1LC7A 2JJEA 1VP4A 4A0HA 4XJMA 4ITXA 5DJ1A 5FT5A 1D7VA 2VLHA 3NDNA 3RCHB 3FKDA 2VMNA 2QB3A 3QHXA 3E6GA 3GZCA 3OP7A 1B8GA 2DR1A 1RV4A 3F6TA 3AENB 2OKJA 1M0OA 3DR7A 2CJDA 2HZPA 1BT4A 4ADBA 2E7JA 2PO3A 1OHVA 2O1BA 3AEOA 4DGTA 3B8XA 3B46A 1MGVA 2Z9XA 3MC6C 1PMMA 2O7CA 4OCAA 2OQXA 4EB5A 5E3KA 4ZSYA 1GC2A 3MKJA 2VI8A 3NU8A 2JJFA 4IYOB 3AATA 2X8UA 3DZZA 3E2ZB 1DFOA 4LNLA 3L8AA 4GE9A 1S08A 1KL2A 4GDYA 1GDEA 1LK9A 3NRAA 5G4IA 1ASBA 4OBUA 2GSAA 1C4KA 1SFFA 1AHFA 1GD9A 1VJOA 3MAFA 2AEVA 1U08A 2BI3A 5G0AA 3NYUA 2BI1A 3T32A 1Z7DA 3MC6A 2CJGA 2DGLA 3QPGA 1ZOBA 1V72A 2GMSA 3EI6A 4ADEA 3WCNA 1QJ5A 1H0CA 1AY5A 4OT8A 1PMOA 2JJHA 1ARSA 1S0AA 5EIGB 2ZY2A 1IJIA 2HOYA 3N5MA 3I16A 2NMPA 1ASNA 3FRKA 3FD0A 3PDBB 4M2KA 4Y0HA 4MGRA 1D7RA 1M4NA 1YJZA 3UE8A 1G4VA 3BCXA 2W7EA 3BB8A 3A2BA 4FFCA 3KE3A 4UHMA 4K2BA 4JE5A 2BYLA 2Z20A 2Z1ZA 2C0RA 3UAKA 2VMXA 4U1TA 3VOMA 1GBNA 4LW4A 3ZRPA 4RKDA 4BA5A 4Q76A 3WZFA 3ELEA 2BWOA 4BMKA 2BWNA 1G4XA 1LW5A 2CH2A 4J8LA 1CJ0A 3II0A 4JF1A 1BJ4A 3CQ4A 2YRRA 1SVVA 4ZDPA 2ZSLA 1X29A 3NYTA 4CXQA 1AJSB 3TQXA 4A0FA 1AMSA 1JG8A 3ECDA 1DJUA 2AY2A 4WXGA 3NTJA 1X2AA 3BCAA 1T3IA 2W8JA 4BHDA 2JJGA 2JGTA 1FG3A 2BKWA 4IW7A 3ASBA 1EQBA 1BKGA 5E4ZA 2W7JA 1AKAA 3LVJA 1WYVB 1E5FA 4GEBA 1OXOA 1KMKA 3BC8A 3CAIA 4MQQA 1IBJA 1G7WA 1N8PA 3W1JA 3BN1A 4CVQA 1B4XA 1CL2A 3MADA 5EAVA 3WKSA 2BIAA 3USFA 1AAMA 1GC4A 1N2TA 1YJSA 2VMYA 1WYTB 3KGXA 4WYFA 1BJOA 1DKAA 4AO4A 3OKSA 5G4JA 5HXXA 2VMQA 1TOEA 3AEJC 3IF2A 1TASA 3L44A 5G2PA 5F8VA 3RCHA 1AIBA 1PG8A 3B1DA 3GZDC 2V1PA 2VGSA 1C7NA 2BI5A 1B5PA 1SZUA 2HP2A 3CQ5A 4MSOA 2YKVA 3JW9A 3HVYA 2W7MA 3AENA 1M0PA 3UWCA 2D66A 4IXOA 4OYTA 2OGAA 5HDMA 2DKJA 2D7YA 3TFUA 3GWPA 4W1XA 2X3LA 2ZJGA 3FVSA 4ZLVA 3HT4A 4ADDA 4RLGA 4JEXA 3F9TA 4DQ6A 1RV3A 1M7YA 4ZWMA 4J5UA 4OBVA 3ZZKA 4E3RA 4MQRA 2WK7A 4EFFA 1SPAA 5TF5A 2YKXA 4RJ0A 3GSBA 4CXRA 2CTZA 1MDZA 1O69A 4WXBA 4IYOA 1TOGA 2Z1YA 1AICA 4IXZA 4Y0IA 1DTYA 3E2FA 2D64A 2YHKA 1YJYA 1B9IA 4WYGA 3EI9A 4CBSA 3HQTA 2D5YA 1GEYA 3LV2A 2GQNA 1C0NA 4BA4A 3CBFA 3EIAA 4WD2A 2C81A 4JF0A 1ARGA 4A0GA 1W7NA 3NNKA 3ZZJA 5EQCA 5M4DA 1IVRA 1GCKA 1AMRA 1YNUA 3ISLA 4PFNA 3ACZA 4KXKA 5EUNA 2W7IA 2ZP7A 2VI9A 3PDXA 5EIGA 3FQ7A 3I5TA 2VMZA 3PDBA 4F5HA 3NU7A 1WKHA 2W8WA 4ZWVA 4ZASA 4TV7A 2CFBA 1DGDA 4WYDA 2V0YA 4LC3A 1DGEA 1H1CA 2HUFA 3LG0A 4XJLA 5BJ4A 1I43A 1UU1A 2WK8A 5DX5A 1YOOA 2YRIA 2W7KA 5M4BA 1TATA 3EIBA 3JZLA 3PIUA 1C9CA 3WGCA 1M0QA 2ZSMA 1UKJA 3AEMA 1CQ8A 3FQ8A 3JWBA 4W8IA 3G8MA 2EO5A 1AAWA 3WY7A 4F5GA 3HDOA 4E1OA 3EZ1A 3PD6B 4R5ZA 3E9KA 5D95A 3NUIA 3FVXA 4GRXA 3FQAA 1XEYA 1OHWA 3FDBA 4AOAA 1BJNA 2W8UA 4WYEA 4A00A 4B9BA 4XAUA 1ELUA 2R5CB 5M46A 2W7GA 4TN4A 1O61A 3DODA 1D7SA 3HBXA 3TCMA 2CY8A 4JEWA 1MDXA 2YKUA 2XBNA 2F8JA 3HMUA 3FCRA 4I8AA 2BIGA 1B9HA 2VIAA 3MEBA 3WCOA 2VMUA 1O62A 2DGKA 4W91A 2EH6A 4O6ZA 1Y4IA 4QGRA
chains in the Genus database with same CATH superfamily
1N31A 1J32A 1WYVA 5DJ9A 2VMPA 2E7IA 2Z9UA 4N0BA 1ASCA 3A9ZA 1OXPA 3DU4A 3N0LA 4MQPA 3N75A 4WB0B 1DJEA 3W1HA 2BHXA 4PVFA 3QM2A 4UQVA 4ZDOA 3PPLA 3KGWA 1WYTA 5EFSA 1QISA 2Z67A 3NYSA 1ASLA 1AIAA 1OATA 3P1TA 2BI9A 4A6UA 4AO9A 2BYJA 3K7YA 2FKIA 4XJPA 2FNIA 1AMAA 1QGNA 1V2EA 5JAYA 4BQ0A 1ZC9A 3NX3A 1AMQA 1ARHA 1WYUB 4XK1A 3QGUA 4GSAA 1TOIA 4IX8A 2VGWA 1RVUA 2TPLA 4MKJA 1IX7A 1OHYA 3VAXA 1DJ9A 3AV7A 2R0TA 4OTLA 4DBCA 3VP6A 4F5IA 2OKKA 1Z3ZA 2X5FA 2YCPA 2QLRA 3Q8NA 2CSTA 3MAUA 4JEZA 4M2JA 3RBFA 2HP1A 4U2HA 4ATPA 3MAFB 3PAAA 1IX8A 3VK3A 2W7LA 3FFRA 1CZCA 4GE7A 5E5IA 3VK2A 1X28A 4RJYA 1BJWA 4A6TA 1SF2A 2YCTA 1KMJA 1BS0A 3K40A 1GC3A 2Z61A 2C44A 2OATA 2VGTA 3A9YA 4B98A 1C7OA 2FNUA 4ZM4A 1AX4A 3ELPA 1TOJA 1CS1A 3WLXA 3LY1A 1KKPA 3BWNA 4TMRA 1KL1A 3FFHA 4IXSA 5J8QA 3B1EA 2O0RA 3BCBA 4FL0A 3AELA 2CB1A 5EUEA 3RBLA 3G7QA 4Q75A 4Q6RA 2W7FA 2Z9WA 2VMWA 3DR4A 2AY7A 2AY1A 2JG2A 2OGEA 2X5DA 1SZSA 3COGA 3P6KA 4LW2A 4A6RA 3LVKA 1SZKA 5D5SA 3AOVA 3E2ZA 1LS3A 2VGVA 1W23A 3FSLA 3FTBA 3KKIA 2A1VA 3GJUA 3A9XA 3EUCA 1ASMA 4RKCA 2ZY5A 4W5KA 1CQ6A 3PD6A 1ARTA 9AATA 4P7YA 2D65A 4WBTA 4PIWA 2VYCA 1JF9A 3R9AA 1ELQA 1GEXA 2R5CA 3AEMC 2D61A 2AY5A 4WP0A 1CQ7A 4XJOA 2AY6A 4Q31A 4MY5A 1MDOA 2HUUA 3LWSA 2PB0A 4F5MA 1PFFA 1I41A 1W7MA 2VMSA 3DC1A 4ISYA 2DGMA 1BJOB 1S07A 2CANA 1X0MA 3IHJA 4JEYA 4UOYA 2AY9A 2W8TA 4IY7A 1S09A 2AY4A 3PJ0A 1IAYA 4NOGA 1MAPA 3ZRRA 1ZODA 3HLMA 4KAMA 3FDDA 3QBOA 4P3MA 1AJRA 1WSTA 2EPJA 2QBTA 4WB0A 3ZRQA 4AZJA 2ORDA 1QJ3A 2DOUA 4H63Q 2AY3A 4A72A 3HL2A 2WB6A 1AHXA 2GMUA 1G7XA 1ORDA 1MLYA 1V2FA 3A8UX 4L0OA 3D6KA 4RAEA 2AATA 8AATA 3JU7A 2R5EA 3E2YA 3RI6A 1LKCA 3TFTA 2BI2A 2EZ1A 4JE5D 2FN6A 4CBRA 1WYUA 3E77A 3QN6A 1AJSA 1M0NA 1MLZA 2VMOA 3LVMA 5EUDA 4HVKA 2Z9VA 3QI6A 3PA9A 2D63A 1AHYA 1I48A 1CL1A 5FT8A 1FG7A 3GBXA 5IWQA 3TATA 1W3UA 1ASGA 2ZUKA 4WLJA 5F9SA 2VLFA 1S06A 4KYOA 3FZ8A 3N4XA 4RITA 2HOXA 3VK4A 2CINA 1AHEA 1QITA 2CJHA 2BWPA 2VMRA 2EGYA 1TPLA 3FZ6A 5LH9A 3DRDA 4ITGA 1LW4A 2Q7WA 4EMYA 4PFFA 2PB2A 1EJIA 3AOWA 7AATA 1YAAA 3ASAA 2YOBA 3M5UA 2ZY3A 1AKCA 4ATQA 4F5LA 4K2IA 1GEWA 4WYAA 1UU0A 4F5FA 1C7GA 5KTBA 1XI9A 4K2MA 3EZSA 4GE4A 2C7TA 2W8VA 3AEPA 4AZKA 3JTXA 4WLHA 1I29A 4UHOA 1J04A 4WYCA 4EB7A 5FT4A 4XEWA 3DYDA 3RQ1A 4XQ2A 5HHYA 4ADCA 2FYFA 2RFVA 3LVLB 1BQAA 1ECXA 3EI7A 1O4SA 1GC0A 2HOZA 3BS8A 1BW0A 4RIZA 1YIZA 3BWNC 3WKRA 4OMAA 2VMTA 2W7DA 2AY8A 1TARA 2QMAA 3CQ6A 4R8DA 1QZ9A 4W1WA 4F5KA 3H7FA 2G7JA 5C6UA 4OC9A 2VGZA 1AY4A 2JISA 3GETA 2WKAA 1ASAA 1JS6A 2HORA 1MAQA 1ASDA 1V2DA 3RUYA 4LNMA 5I92A 3H14A 1TOKA 3G0TA 2HUIA 1CZEA 1IAXA 1LC5A 4EU1A 2VGUA 2WK9A 3EI8A 3F0HA 4ZDLA 3JWAA 5DB5A 2BIEA 3W1IA 2ZYJA 3WX9A 3ATHA 2CH1A 4HF8A 4F4EA 1AKBA 1B5OA 4ZSWA 2D7ZA 2ZC0A 2FQ6A 1ARIA 2EZ2A 1P3WA 3MBBA 4H51A 3EI5A 5K8BA 1D7UA 1RVYA 1UU2A 1E5EA 2GB3A 2XH1A 3NUBA 4ZM3A 2G6WA 1KKJA 2YCNA 4E77A 5M49A 4F5JA 3BWOA 3K28A 3DXWA 3B1CA 3FVUA 1M32A 2R2NA 1VEFA 1IUGA 4MKKA 4LNJA 1FC4A 3PGYA 1M6SA 1W7LA 1WKGA 2QA3A 5AX8A 4A0RA 2VMVA 1ASEA 4N0WA 1AY8A 2FM1A 4WXFA 2VIBA 1ASFA 2ZY4A 4M2MA 3DXVA 4JEVA 1JS3A 3I4JA 3GR9A 4AH3A 1EG5A 1IX6A 3BV0A 3WGBA 3FZ7A 3R4TA 1D2FA 1AHGA 2YKYA 2E54A 4Y0DA 5LHAA 2W7HA 4E3QA 4W1VA 1LC8A 4UHNA 5G2QA 1QIRA 4RM1A 3AEJA 1YIYA 5BJ3A 5FT6A 4R2NA 3GZDA 4ZAHA 2AEUA 5EAAA 2DKBA 2E7UA 2QSRA 4R5FA 1BQDA 5G09A 2QB2A 1LC7A 2JJEA 1VP4A 4A0HA 4XJMA 4ITXA 5DJ1A 5FT5A 1D7VA 2VLHA 3NDNA 3RCHB 3FKDA 2VMNA 2QB3A 3QHXA 3E6GA 3GZCA 3OP7A 1B8GA 2DR1A 1RV4A 3N4SA 3F6TA 3AENB 2OKJA 1M0OA 3DR7A 2CJDA 2HZPA 1BT4A 4ADBA 2E7JA 2PO3A 1OHVA 3N7NA 2O1BA 3AEOA 4DGTA 3B8XA 3B46A 2KFPA 1MGVA 2Z9XA 3MC6C 1PMMA 2O7CA 4OCAA 3H9XA 2OQXA 4EB5A 5E3KA 4ZSYA 1GC2A 3MKJA 2VI8A 3NU8A 2JJFA 4IYOB 3AATA 2X8UA 3DZZA 3E2ZB 1DFOA 4LNLA 3L8AA 4GE9A 1S08A 1KL2A 4GDYA 1GDEA 1LK9A 3NRAA 5G4IA 1ASBA 4OBUA 2GSAA 1C4KA 1SFFA 1AHFA 1GD9A 1VJOA 3MAFA 2AEVA 1U08A 2BI3A 5G0AA 3NYUA 2BI1A 3T32A 1Z7DA 3MC6A 2CJGA 2DGLA 3QPGA 1ZOBA 1V72A 4K05A 2GMSA 3EI6A 4ADEA 3WCNA 1QJ5A 1H0CA 1AY5A 4OT8A 1PMOA 2JJHA 1ARSA 1S0AA 5EIGB 2ZY2A 1IJIA 2HOYA 3N5MA 3I16A 2NMPA 1ASNA 3FRKA 3FD0A 3PDBB 4M2KA 4Y0HA 4MGRA 1D7RA 1M4NA 1YJZA 3UE8A 1G4VA 3BCXA 2W7EA 3BB8A 3A2BA 4FFCA 3KE3A 4UHMA 4K2BA 4JE5A 2BYLA 2Z20A 2Z1ZA 2C0RA 3UAKA 2VMXA 4U1TA 3VOMA 1GBNA 4LW4A 3ZRPA 4RKDA 4BA5A 4Q76A 3WZFA 3ELEA 2BWOA 4BMKA 2BWNA 1G4XA 1LW5A 2CH2A 4J8LA 1CJ0A 3II0A 4JF1A 1BJ4A 3CQ4A 2YRRA 1SVVA 4ZDPA 2ZSLA 1X29A 3NYTA 4CXQA 1AJSB 3TQXA 4A0FA 1AMSA 1JG8A 3ECDA 1DJUA 2AY2A 4WXGA 3NTJA 1X2AA 3BCAA 1T3IA 2W8JA 4BHDA 2JJGA 2JGTA 1FG3A 2BKWA 4IW7A 3ASBA 1EQBA 1BKGA 5E4ZA 2W7JA 1AKAA 3LVJA 1WYVB 1E5FA 4GEBA 1OXOA 1KMKA 3BC8A 3CAIA 4MQQA 1IBJA 1G7WA 1N8PA 3W1JA 3BN1A 4CVQA 1B4XA 1CL2A 3MADA 5EAVA 3WKSA 2BIAA 3USFA 1AAMA 1GC4A 1N2TA 1YJSA 2VMYA 1WYTB 3KGXA 4WYFA 1BJOA 1DKAA 4AO4A 3OKSA 5G4JA 5HXXA 2VMQA 1TOEA 3AEJC 3IF2A 1TASA 3L44A 5G2PA 5F8VA 3RCHA 1AIBA 1PG8A 3B1DA 3GZDC 2V1PA 2VGSA 1C7NA 2BI5A 1B5PA 1SZUA 2HP2A 3CQ5A 4MSOA 2YKVA 3JW9A 3HVYA 2W7MA 3AENA 1M0PA 3UWCA 2D66A 4IXOA 4OYTA 2OGAA 5HDMA 2DKJA 2D7YA 3TFUA 3GWPA 4W1XA 2X3LA 2ZJGA 3FVSA 4ZLVA 2EYQA 3HT4A 4ADDA 4RLGA 4JEXA 3F9TA 4DQ6A 1RV3A 1M7YA 4ZWMA 4J5UA 4OBVA 3ZZKA 4E3RA 1KAFA 4MQRA 2WK7A 4EFFA 1SPAA 5TF5A 2YKXA 4RJ0A 3GSBA 4CXRA 2CTZA 1MDZA 1O69A 4WXBA 4IYOA 1TOGA 2Z1YA 1AICA 4IXZA 4Y0IA 1DTYA 3E2FA 2D64A 2YHKA 1YJYA 1B9IA 4WYGA 3EI9A 4CBSA 3HQTA 2D5YA 1GEYA 3LV2A 2GQNA 1C0NA 4BA4A 3CBFA 3EIAA 4WD2A 2C81A 4JF0A 1ARGA 4A0GA 1W7NA 3NNKA 3ZZJA 5EQCA 5M4DA 1IVRA 1GCKA 1AMRA 1YNUA 3ISLA 4PFNA 3ACZA 4KXKA 5EUNA 2W7IA 2ZP7A 2VI9A 3PDXA 5EIGA 3FQ7A 3I5TA 2VMZA 3PDBA 4F5HA 3NU7A 1WKHA 2W8WA 4ZWVA 4ZASA 4TV7A 2CFBA 1DGDA 4WYDA 2V0YA 4LC3A 1DGEA 1H1CA 2HUFA 3LG0A 4XJLA 5BJ4A 1I43A 1UU1A 2WK8A 5DX5A 1YOOA 2YRIA 2W7KA 5M4BA 1TATA 3EIBA 3JZLA 3PIUA 1C9CA 3WGCA 1M0QA 2ZSMA 1UKJA 3AEMA 1CQ8A 3FQ8A 3JWBA 4W8IA 3G8MA 2EO5A 1AAWA 3WY7A 4F5GA 3HDOA 4E1OA 3EZ1A 3PD6B 4R5ZA 3E9KA 5D95A 3NUIA 3FVXA 4GRXA 3FQAA 1XEYA 1OHWA 3FDBA 4AOAA 1BJNA 2W8UA 4WYEA 4A00A 4B9BA 4XAUA 1ELUA 2R5CB 5M46A 2W7GA 4TN4A 1O61A 3DODA 1D7SA 3HBXA 3TCMA 2CY8A 4JEWA 1MDXA 2YKUA 2XBNA 2F8JA 3HMUA 3FCRA 3N4RA 4I8AA 2BIGA 1B9HA 2VIAA 3MEBA 3WCOA 2VMUA 1O62A 2DGKA 4W91A 2EH6A 4O6ZA 1Y4IA 4QGRA
chains in the Genus database with same CATH topology
1N31A 1J32A 1WYVA 5DJ9A 2VMPA 2E7IA 2Z9UA 4N0BA 1ASCA 3A9ZA 1OXPA 3DU4A 3N0LA 4MQPA 3N75A 4WB0B 1DJEA 3W1HA 2BHXA 4PVFA 3QM2A 4UQVA 4ZDOA 3PPLA 3KGWA 1WYTA 5EFSA 1QISA 2Z67A 3NYSA 1ASLA 1AIAA 1OATA 3P1TA 2BI9A 4A6UA 4AO9A 2BYJA 3K7YA 2FKIA 4XJPA 2FNIA 1AMAA 1QGNA 1V2EA 5JAYA 4BQ0A 1ZC9A 3NX3A 1AMQA 1ARHA 1WYUB 4XK1A 3QGUA 4GSAA 1TOIA 4IX8A 2VGWA 1RVUA 2TPLA 4MKJA 1IX7A 1OHYA 3VAXA 1DJ9A 3AV7A 2R0TA 4OTLA 4DBCA 3VP6A 4F5IA 2OKKA 1Z3ZA 2X5FA 2YCPA 2QLRA 3Q8NA 2CSTA 3MAUA 4JEZA 4M2JA 3RBFA 2HP1A 4U2HA 4ATPA 3MAFB 3PAAA 1IX8A 3VK3A 2W7LA 3FFRA 1CZCA 4GE7A 5E5IA 3VK2A 1X28A 4RJYA 1BJWA 4A6TA 1SF2A 2YCTA 1KMJA 1BS0A 3K40A 1GC3A 2Z61A 2C44A 2OATA 2VGTA 3A9YA 4B98A 1C7OA 2FNUA 4ZM4A 1AX4A 3ELPA 1TOJA 1CS1A 3WLXA 3LY1A 1KKPA 3BWNA 4TMRA 1KL1A 3FFHA 4IXSA 5J8QA 3B1EA 2O0RA 3BCBA 4FL0A 3AELA 2CB1A 5EUEA 3RBLA 3G7QA 4Q75A 4Q6RA 2W7FA 2Z9WA 2VMWA 3DR4A 2AY7A 2AY1A 2JG2A 2OGEA 2X5DA 1SZSA 3COGA 3P6KA 4LW2A 4A6RA 3LVKA 1SZKA 5D5SA 3AOVA 3E2ZA 1LS3A 2VGVA 1W23A 3FSLA 3FTBA 3KKIA 2A1VA 3GJUA 3A9XA 3EUCA 1ASMA 4RKCA 2ZY5A 4W5KA 1CQ6A 3PD6A 1ARTA 9AATA 4P7YA 2D65A 4WBTA 4PIWA 2VYCA 1JF9A 3R9AA 1ELQA 1GEXA 2R5CA 3AEMC 2D61A 2AY5A 4WP0A 1CQ7A 4XJOA 2AY6A 4Q31A 4MY5A 1MDOA 2HUUA 3LWSA 2PB0A 4F5MA 1PFFA 1I41A 1W7MA 2VMSA 3DC1A 4ISYA 2DGMA 1BJOB 1S07A 2CANA 1X0MA 3IHJA 4JEYA 4UOYA 2AY9A 2W8TA 4IY7A 1S09A 2AY4A 3PJ0A 1IAYA 4NOGA 1MAPA 3ZRRA 1ZODA 3HLMA 4KAMA 3FDDA 3QBOA 4P3MA 1AJRA 1WSTA 2EPJA 2QBTA 4WB0A 3ZRQA 4AZJA 2ORDA 1QJ3A 2DOUA 4H63Q 2AY3A 4A72A 3HL2A 2WB6A 1AHXA 2GMUA 1G7XA 1ORDA 1MLYA 1V2FA 3A8UX 4L0OA 3D6KA 4RAEA 2AATA 8AATA 3JU7A 2R5EA 3E2YA 3RI6A 1LKCA 3TFTA 2BI2A 2EZ1A 4JE5D 2FN6A 4CBRA 1WYUA 3E77A 3QN6A 1AJSA 1M0NA 1MLZA 2VMOA 3LVMA 5EUDA 4HVKA 2Z9VA 3QI6A 3PA9A 2D63A 1AHYA 1I48A 1CL1A 5FT8A 1FG7A 3GBXA 5IWQA 3TATA 1W3UA 1ASGA 2ZUKA 4WLJA 5F9SA 2VLFA 1S06A 4KYOA 3FZ8A 3N4XA 4RITA 2HOXA 3VK4A 2CINA 1AHEA 1QITA 2CJHA 2BWPA 2VMRA 2EGYA 1TPLA 3FZ6A 5LH9A 3DRDA 4ITGA 1LW4A 2Q7WA 4EMYA 4PFFA 2PB2A 1EJIA 3AOWA 7AATA 1YAAA 3ASAA 2YOBA 3M5UA 2ZY3A 1AKCA 4ATQA 4F5LA 4K2IA 1GEWA 4WYAA 1UU0A 4F5FA 1C7GA 5KTBA 1XI9A 4K2MA 3EZSA 4GE4A 2C7TA 2W8VA 3AEPA 4AZKA 3JTXA 4WLHA 1I29A 4UHOA 1J04A 4WYCA 4EB7A 5FT4A 4XEWA 3DYDA 3RQ1A 4XQ2A 5HHYA 4ADCA 2FYFA 2RFVA 3LVLB 1BQAA 1ECXA 3EI7A 1O4SA 1GC0A 2HOZA 3BS8A 1BW0A 4RIZA 1YIZA 3BWNC 3WKRA 4OMAA 2VMTA 2W7DA 2AY8A 1TARA 2QMAA 3CQ6A 4R8DA 1QZ9A 4W1WA 4F5KA 3H7FA 2G7JA 5C6UA 4OC9A 2VGZA 1AY4A 2JISA 3GETA 2WKAA 1ASAA 1JS6A 2HORA 1MAQA 1ASDA 1V2DA 3RUYA 4LNMA 5I92A 3H14A 1TOKA 3G0TA 2HUIA 1CZEA 1IAXA 1LC5A 4EU1A 2VGUA 2WK9A 3EI8A 3F0HA 4ZDLA 3JWAA 5DB5A 2BIEA 3W1IA 2ZYJA 3WX9A 3ATHA 2CH1A 4HF8A 4F4EA 1AKBA 1B5OA 4ZSWA 2D7ZA 2ZC0A 2FQ6A 1ARIA 2EZ2A 1P3WA 3MBBA 4H51A 3EI5A 5K8BA 1D7UA 1RVYA 1UU2A 1E5EA 2GB3A 2XH1A 3NUBA 4ZM3A 2G6WA 1KKJA 2YCNA 4E77A 5M49A 4F5JA 3BWOA 3K28A 3DXWA 3B1CA 3FVUA 1M32A 2R2NA 1VEFA 1IUGA 4MKKA 4LNJA 1FC4A 3PGYA 1M6SA 1W7LA 1WKGA 2QA3A 5AX8A 4A0RA 2VMVA 1ASEA 4N0WA 1AY8A 2FM1A 4WXFA 2VIBA 1ASFA 2ZY4A 4M2MA 3DXVA 4JEVA 1JS3A 3I4JA 3GR9A 4AH3A 1EG5A 1IX6A 3BV0A 3WGBA 3FZ7A 3R4TA 1D2FA 1AHGA 2YKYA 2E54A 4Y0DA 5LHAA 2W7HA 4E3QA 4W1VA 1LC8A 4UHNA 5G2QA 1QIRA 4RM1A 3AEJA 1YIYA 5BJ3A 5FT6A 4R2NA 3GZDA 4ZAHA 2AEUA 5EAAA 2DKBA 2E7UA 2QSRA 4R5FA 1BQDA 5G09A 2QB2A 1LC7A 2JJEA 1VP4A 4A0HA 4XJMA 4ITXA 5DJ1A 5FT5A 1D7VA 2VLHA 3NDNA 3RCHB 3FKDA 2VMNA 2QB3A 3QHXA 3E6GA 3GZCA 3OP7A 1B8GA 2DR1A 1RV4A 3N4SA 3F6TA 3AENB 2OKJA 1M0OA 3DR7A 2CJDA 2HZPA 1BT4A 4ADBA 2E7JA 2PO3A 1OHVA 3N7NA 2O1BA 3AEOA 4DGTA 3B8XA 3B46A 2KFPA 1MGVA 2Z9XA 3MC6C 1PMMA 2O7CA 4OCAA 3H9XA 2OQXA 4EB5A 5E3KA 4ZSYA 1GC2A 3MKJA 2VI8A 3NU8A 2JJFA 4IYOB 3AATA 2X8UA 3DZZA 3E2ZB 1DFOA 4LNLA 3L8AA 4GE9A 1S08A 1KL2A 4GDYA 1GDEA 1LK9A 3NRAA 5G4IA 1ASBA 4OBUA 2GSAA 1C4KA 1SFFA 1AHFA 1GD9A 1VJOA 3MAFA 2AEVA 1U08A 2BI3A 5G0AA 3NYUA 2BI1A 3T32A 1Z7DA 3MC6A 2CJGA 2DGLA 3QPGA 1ZOBA 1V72A 4K05A 2GMSA 3EI6A 4ADEA 3WCNA 1QJ5A 1H0CA 1AY5A 4OT8A 1PMOA 2JJHA 1ARSA 1S0AA 5EIGB 2ZY2A 1IJIA 2HOYA 3N5MA 3I16A 2NMPA 1ASNA 3FRKA 3FD0A 3PDBB 4M2KA 4Y0HA 4MGRA 1D7RA 1M4NA 1YJZA 3UE8A 1G4VA 3BCXA 2W7EA 3BB8A 3A2BA 4FFCA 3KE3A 4UHMA 4K2BA 4JE5A 2BYLA 2Z20A 2Z1ZA 2C0RA 3UAKA 2VMXA 4U1TA 3VOMA 1GBNA 4LW4A 3ZRPA 4RKDA 4BA5A 4Q76A 3WZFA 3ELEA 2BWOA 4BMKA 2BWNA 1G4XA 1LW5A 2CH2A 4J8LA 1CJ0A 3II0A 4JF1A 1BJ4A 3CQ4A 2YRRA 1SVVA 4ZDPA 2ZSLA 1X29A 3NYTA 4CXQA 1AJSB 3TQXA 4A0FA 1AMSA 1JG8A 3ECDA 1DJUA 2AY2A 4WXGA 3NTJA 1X2AA 3BCAA 1T3IA 2W8JA 4BHDA 2JJGA 2JGTA 1FG3A 2BKWA 4IW7A 3ASBA 1EQBA 1BKGA 5E4ZA 2W7JA 1AKAA 3LVJA 1WYVB 1E5FA 4GEBA 1OXOA 1KMKA 3BC8A 3CAIA 4MQQA 1IBJA 1G7WA 1N8PA 3W1JA 3BN1A 4CVQA 1B4XA 1CL2A 3MADA 5EAVA 3WKSA 2BIAA 3USFA 1AAMA 1GC4A 1N2TA 1YJSA 2VMYA 1WYTB 3KGXA 4WYFA 1BJOA 1DKAA 4AO4A 3OKSA 5G4JA 5HXXA 2VMQA 1TOEA 3AEJC 3IF2A 1TASA 3L44A 5G2PA 5F8VA 3RCHA 1AIBA 1PG8A 3B1DA 3GZDC 2V1PA 2VGSA 1C7NA 2BI5A 1B5PA 1SZUA 2HP2A 3CQ5A 4MSOA 2YKVA 3JW9A 3HVYA 2W7MA 3AENA 1M0PA 3UWCA 2D66A 4IXOA 4OYTA 2OGAA 5HDMA 2DKJA 2D7YA 3TFUA 3GWPA 4W1XA 2X3LA 2ZJGA 3FVSA 4ZLVA 2EYQA 3HT4A 4ADDA 4RLGA 4JEXA 3F9TA 4DQ6A 1RV3A 1M7YA 4ZWMA 4J5UA 4OBVA 3ZZKA 4E3RA 4MQRA 2WK7A 4EFFA 1SPAA 5TF5A 2YKXA 4RJ0A 3GSBA 4CXRA 2CTZA 1MDZA 1O69A 4WXBA 4IYOA 1TOGA 2Z1YA 1AICA 4IXZA 4Y0IA 1DTYA 3E2FA 2D64A 2YHKA 1YJYA 1B9IA 4WYGA 3EI9A 4CBSA 3HQTA 2D5YA 1GEYA 3LV2A 2GQNA 1C0NA 4BA4A 3CBFA 3EIAA 4WD2A 2C81A 4JF0A 1ARGA 4A0GA 1W7NA 3NNKA 3ZZJA 5EQCA 5M4DA 1IVRA 1GCKA 1AMRA 1YNUA 3ISLA 4PFNA 3ACZA 4KXKA 5EUNA 2W7IA 2ZP7A 2VI9A 3PDXA 5EIGA 3FQ7A 3I5TA 2VMZA 3PDBA 4F5HA 3NU7A 1WKHA 2W8WA 4ZWVA 4ZASA 4TV7A 2CFBA 1DGDA 4WYDA 2V0YA 4LC3A 1DGEA 1H1CA 2HUFA 3LG0A 4XJLA 5BJ4A 1I43A 1UU1A 2WK8A 5DX5A 1YOOA 2YRIA 2W7KA 5M4BA 1TATA 3EIBA 3JZLA 3PIUA 1C9CA 3WGCA 1M0QA 2ZSMA 1UKJA 3AEMA 1CQ8A 3FQ8A 3JWBA 4W8IA 3G8MA 2EO5A 1AAWA 3WY7A 4F5GA 3HDOA 4E1OA 3EZ1A 3PD6B 4R5ZA 3E9KA 5D95A 3NUIA 3FVXA 4GRXA 3FQAA 1XEYA 1OHWA 3FDBA 4AOAA 1BJNA 2W8UA 4WYEA 4A00A 4B9BA 4XAUA 1ELUA 2R5CB 5M46A 2W7GA 4TN4A 1O61A 3DODA 1D7SA 3HBXA 3TCMA 2CY8A 4JEWA 1MDXA 2YKUA 2XBNA 2F8JA 3HMUA 3FCRA 3N4RA 4I8AA 2BIGA 1B9HA 2VIAA 3MEBA 3WCOA 2VMUA 1O62A 2DGKA 4W91A 2EH6A 4O6ZA 1Y4IA 4QGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N31 A;  1J32 A;  1WYV A;  5DJ9 A;  2VMP A;  2E7I A;  2Z9U A;  4N0B A;  1ASC A;  3A9Z A;  1OXP A;  3DU4 A;  3N0L A;  4MQP A;  3N75 A;  4WB0 B;  1DJE A;  3W1H A;  2BHX A;  4PVF A;  3QM2 A;  4UQV A;  4ZDO A;  3PPL A;  3KGW A;  1WYT A;  5EFS A;  1QIS A;  2Z67 A;  3NYS A;  1ASL A;  1AIA A;  1OAT A;  3P1T A;  2BI9 A;  4A6U A;  4AO9 A;  2BYJ A;  3K7Y A;  4XJP A;  2FNI A;  1AMA A;  1QGN A;  1V2E A;  5JAY A;  4BQ0 A;  1ZC9 A;  3NX3 A;  1AMQ A;  1ARH A;  1WYU B;  4XK1 A;  3QGU A;  4GSA A;  1TOI A;  4IX8 A;  2VGW A;  1RVU A;  2TPL A;  4MKJ A;  1IX7 A;  1OHY A;  3VAX A;  1DJ9 A;  3AV7 A;  2R0T A;  4OTL A;  4DBC A;  3VP6 A;  4F5I A;  2OKK A;  1Z3Z A;  2X5F A;  2YCP A;  2QLR A;  3Q8N A;  2CST A;  3MAU A;  4JEZ A;  4M2J A;  3RBF A;  2HP1 A;  4U2H A;  4ATP A;  3MAF B;  3PAA A;  1IX8 A;  3VK3 A;  2W7L A;  3FFR A;  1CZC A;  4GE7 A;  5E5I A;  3VK2 A;  1X28 A;  4RJY A;  1BJW A;  4A6T A;  1SF2 A;  2YCT A;  1KMJ A;  1BS0 A;  3K40 A;  1GC3 A;  2Z61 A;  2C44 A;  2OAT A;  2VGT A;  3A9Y A;  4B98 A;  1C7O A;  2FNU A;  4ZM4 A;  1AX4 A;  3ELP A;  1TOJ A;  1CS1 A;  3WLX A;  3LY1 A;  1KKP A;  3BWN A;  4TMR A;  1KL1 A;  3FFH A;  4IXS A;  5J8Q A;  3B1E A;  2O0R A;  3BCB A;  4FL0 A;  3AEL A;  2CB1 A;  5EUE A;  3RBL A;  3G7Q A;  4Q75 A;  4Q6R A;  2W7F A;  2Z9W A;  2VMW A;  3DR4 A;  2AY7 A;  2AY1 A;  2JG2 A;  2OGE A;  2X5D A;  1SZS A;  3COG A;  3P6K A;  4LW2 A;  4A6R A;  3LVK A;  1SZK A;  5D5S A;  3AOV A;  3E2Z A;  1LS3 A;  2VGV A;  1W23 A;  3FSL A;  3FTB A;  3KKI A;  3GJU A;  3A9X A;  3EUC A;  1ASM A;  4RKC A;  2ZY5 A;  4W5K A;  1CQ6 A;  3PD6 A;  1ART A;  9AAT A;  4P7Y A;  2D65 A;  4WBT A;  4PIW A;  2VYC A;  1JF9 A;  3R9A A;  1ELQ A;  1GEX A;  2R5C A;  3AEM C;  2D61 A;  2AY5 A;  4WP0 A;  1CQ7 A;  4XJO A;  2AY6 A;  4Q31 A;  4MY5 A;  1MDO A;  2HUU A;  3LWS A;  2PB0 A;  4F5M A;  1PFF A;  1I41 A;  1W7M A;  2VMS A;  3DC1 A;  4ISY A;  2DGM A;  1BJO B;  1S07 A;  2CAN A;  1X0M A;  3IHJ A;  4JEY A;  4UOY A;  2AY9 A;  2W8T A;  4IY7 A;  1S09 A;  2AY4 A;  3PJ0 A;  1IAY A;  4NOG A;  1MAP A;  3ZRR A;  1ZOD A;  3HLM A;  4KAM A;  3FDD A;  3QBO A;  4P3M A;  1AJR A;  1WST A;  2EPJ A;  2QBT A;  4WB0 A;  3ZRQ A;  4AZJ A;  2ORD A;  1QJ3 A;  2DOU A;  2AY3 A;  4A72 A;  3HL2 A;  1AHX A;  2GMU A;  1G7X A;  1ORD A;  1MLY A;  1V2F A;  3A8U X;  4L0O A;  3D6K A;  4RAE A;  2AAT A;  8AAT A;  3JU7 A;  2R5E A;  3E2Y A;  3RI6 A;  1LKC A;  3TFT A;  2BI2 A;  2EZ1 A;  4JE5 D;  2FN6 A;  4CBR A;  1WYU A;  3E77 A;  3QN6 A;  1AJS A;  1M0N A;  1MLZ A;  2VMO A;  3LVM A;  5EUD A;  4HVK A;  2Z9V A;  3QI6 A;  3PA9 A;  2D63 A;  1AHY A;  1I48 A;  1CL1 A;  5FT8 A;  1FG7 A;  3GBX A;  5IWQ A;  3TAT A;  1W3U A;  1ASG A;  2ZUK A;  4WLJ A;  5F9S A;  2VLF A;  1S06 A;  4KYO A;  3FZ8 A;  4RIT A;  2HOX A;  3VK4 A;  2CIN A;  1AHE A;  1QIT A;  2CJH A;  2BWP A;  2VMR A;  2EGY A;  1TPL A;  3FZ6 A;  5LH9 A;  3DRD A;  4ITG A;  1LW4 A;  2Q7W A;  4EMY A;  4PFF A;  2PB2 A;  1EJI A;  3AOW A;  7AAT A;  1YAA A;  3ASA A;  2YOB A;  3M5U A;  2ZY3 A;  1AKC A;  4ATQ A;  4F5L A;  4K2I A;  1GEW A;  4WYA A;  1UU0 A;  4F5F A;  1C7G A;  1XI9 A;  4K2M A;  3EZS A;  4GE4 A;  2C7T A;  2W8V A;  3AEP A;  4AZK A;  3JTX A;  4WLH A;  1I29 A;  4UHO A;  1J04 A;  4WYC A;  4EB7 A;  5FT4 A;  4XEW A;  3DYD A;  3RQ1 A;  4XQ2 A;  5HHY A;  4ADC A;  2FYF A;  2RFV A;  3LVL B;  1BQA A;  1ECX A;  3EI7 A;  1O4S A;  1GC0 A;  2HOZ A;  3BS8 A;  1BW0 A;  4RIZ A;  1YIZ A;  3BWN C;  3WKR A;  4OMA A;  2VMT A;  2W7D A;  2AY8 A;  1TAR A;  2QMA A;  3CQ6 A;  4R8D A;  1QZ9 A;  4W1W A;  4F5K A;  3H7F A;  5C6U A;  4OC9 A;  2VGZ A;  1AY4 A;  2JIS A;  3GET A;  2WKA A;  1ASA A;  1JS6 A;  2HOR A;  1MAQ A;  1ASD A;  1V2D A;  3RUY A;  4LNM A;  5I92 A;  3H14 A;  1TOK A;  3G0T A;  2HUI A;  1CZE A;  1IAX A;  1LC5 A;  4EU1 A;  2VGU A;  2WK9 A;  3EI8 A;  3F0H A;  4ZDL A;  3JWA A;  5DB5 A;  2BIE A;  3W1I A;  2ZYJ A;  3WX9 A;  3ATH A;  2CH1 A;  4HF8 A;  4F4E A;  1AKB A;  1B5O A;  4ZSW A;  2D7Z A;  2ZC0 A;  2FQ6 A;  1ARI A;  2EZ2 A;  1P3W A;  3MBB A;  4H51 A;  3EI5 A;  5K8B A;  1D7U A;  1RVY A;  1UU2 A;  1E5E A;  2GB3 A;  2XH1 A;  3NUB A;  4ZM3 A;  2G6W A;  1KKJ A;  2YCN A;  4E77 A;  5M49 A;  4F5J A;  3BWO A;  3K28 A;  3DXW A;  3B1C A;  3FVU A;  1M32 A;  2R2N A;  1VEF A;  1IUG A;  4MKK A;  4LNJ A;  1FC4 A;  3PGY A;  1M6S A;  1W7L A;  1WKG A;  2QA3 A;  5AX8 A;  4A0R A;  2VMV A;  1ASE A;  4N0W A;  1AY8 A;  2FM1 A;  4WXF A;  2VIB A;  1ASF A;  2ZY4 A;  4M2M A;  3DXV A;  4JEV A;  1JS3 A;  3I4J A;  3GR9 A;  4AH3 A;  1EG5 A;  1IX6 A;  3BV0 A;  3WGB A;  3FZ7 A;  3R4T A;  1D2F A;  1AHG A;  2YKY A;  2E54 A;  4Y0D A;  5LHA A;  2W7H A;  4E3Q A;  4W1V A;  1LC8 A;  4UHN A;  5G2Q A;  1QIR A;  4RM1 A;  3AEJ A;  1YIY A;  5BJ3 A;  5FT6 A;  4R2N A;  3GZD A;  4ZAH A;  2AEU A;  5EAA A;  2DKB A;  2E7U A;  4R5F A;  1BQD A;  5G09 A;  2QB2 A;  1LC7 A;  2JJE A;  1VP4 A;  4A0H A;  4XJM A;  4ITX A;  5DJ1 A;  5FT5 A;  1D7V A;  2VLH A;  3NDN A;  3RCH B;  3FKD A;  2VMN A;  2QB3 A;  3QHX A;  3E6G A;  3GZC A;  3OP7 A;  1B8G A;  2DR1 A;  1RV4 A;  3F6T A;  3AEN B;  2OKJ A;  1M0O A;  3DR7 A;  2CJD A;  2HZP A;  1BT4 A;  4ADB A;  2E7J A;  2PO3 A;  1OHV A;  2O1B A;  3AEO A;  4DGT A;  3B8X A;  3B46 A;  1MGV A;  2Z9X A;  3MC6 C;  1PMM A;  2O7C A;  4OCA A;  2OQX A;  4EB5 A;  5E3K A;  4ZSY A;  1GC2 A;  3MKJ A;  2VI8 A;  3NU8 A;  2JJF A;  4IYO B;  3AAT A;  2X8U A;  3DZZ A;  3E2Z B;  1DFO A;  4LNL A;  3L8A A;  4GE9 A;  1S08 A;  1KL2 A;  4GDY A;  1GDE A;  1LK9 A;  3NRA A;  5G4I A;  1ASB A;  4OBU A;  2GSA A;  1C4K A;  1SFF A;  1AHF A;  1GD9 A;  1VJO A;  3MAF A;  2AEV A;  1U08 A;  2BI3 A;  5G0A A;  3NYU A;  2BI1 A;  3T32 A;  1Z7D A;  3MC6 A;  2CJG A;  2DGL A;  3QPG A;  1ZOB A;  1V72 A;  2GMS A;  3EI6 A;  4ADE A;  3WCN A;  1QJ5 A;  1H0C A;  1AY5 A;  4OT8 A;  1PMO A;  2JJH A;  1ARS A;  1S0A A;  5EIG B;  2ZY2 A;  1IJI A;  2HOY A;  3N5M A;  3I16 A;  2NMP A;  1ASN A;  3FRK A;  3FD0 A;  3PDB B;  4M2K A;  4Y0H A;  4MGR A;  1D7R A;  1M4N A;  1YJZ A;  3UE8 A;  1G4V A;  3BCX A;  2W7E A;  3BB8 A;  3A2B A;  4FFC A;  3KE3 A;  4UHM A;  4K2B A;  4JE5 A;  2BYL A;  2Z20 A;  2Z1Z A;  2C0R A;  3UAK A;  2VMX A;  4U1T A;  3VOM A;  1GBN A;  4LW4 A;  3ZRP A;  4RKD A;  4BA5 A;  4Q76 A;  3WZF A;  3ELE A;  2BWO A;  4BMK A;  2BWN A;  1G4X A;  1LW5 A;  2CH2 A;  4J8L A;  1CJ0 A;  3II0 A;  4JF1 A;  1BJ4 A;  3CQ4 A;  2YRR A;  1SVV A;  4ZDP A;  2ZSL A;  1X29 A;  3NYT A;  4CXQ A;  1AJS B;  3TQX A;  4A0F A;  1AMS A;  1JG8 A;  3ECD A;  1DJU A;  2AY2 A;  4WXG A;  3NTJ A;  1X2A A;  3BCA A;  1T3I A;  2W8J A;  4BHD A;  2JJG A;  2JGT A;  1FG3 A;  2BKW A;  4IW7 A;  3ASB A;  1EQB A;  1BKG A;  5E4Z A;  2W7J A;  1AKA A;  3LVJ A;  1WYV B;  1E5F A;  4GEB A;  1OXO A;  1KMK A;  3BC8 A;  3CAI A;  4MQQ A;  1IBJ A;  1G7W A;  1N8P A;  3W1J A;  3BN1 A;  4CVQ A;  1B4X A;  1CL2 A;  3MAD A;  5EAV A;  3WKS A;  2BIA A;  3USF A;  1AAM A;  1GC4 A;  1N2T A;  1YJS A;  2VMY A;  1WYT B;  3KGX A;  4WYF A;  1BJO A;  1DKA A;  4AO4 A;  3OKS A;  5G4J A;  5HXX A;  2VMQ A;  1TOE A;  3AEJ C;  3IF2 A;  1TAS A;  3L44 A;  5G2P A;  5F8V A;  3RCH A;  1AIB A;  1PG8 A;  3B1D A;  3GZD C;  2V1P A;  2VGS A;  1C7N A;  2BI5 A;  1B5P A;  1SZU A;  2HP2 A;  3CQ5 A;  4MSO A;  2YKV A;  3JW9 A;  3HVY A;  2W7M A;  3AEN A;  1M0P A;  3UWC A;  2D66 A;  4IXO A;  4OYT A;  2OGA A;  5HDM A;  2DKJ A;  2D7Y A;  3TFU A;  3GWP A;  4W1X A;  2X3L A;  2ZJG A;  3FVS A;  4ZLV A;  3HT4 A;  4ADD A;  4RLG A;  4JEX A;  3F9T A;  4DQ6 A;  1RV3 A;  1M7Y A;  4ZWM A;  4J5U A;  4OBV A;  3ZZK A;  4E3R A;  4MQR A;  2WK7 A;  4EFF A;  1SPA A;  5TF5 A;  2YKX A;  4RJ0 A;  3GSB A;  4CXR A;  2CTZ A;  1MDZ A;  1O69 A;  4WXB A;  4IYO A;  1TOG A;  2Z1Y A;  1AIC A;  4IXZ A;  4Y0I A;  1DTY A;  3E2F A;  2D64 A;  2YHK A;  1YJY A;  1B9I A;  4WYG A;  3EI9 A;  4CBS A;  3HQT A;  2D5Y A;  1GEY A;  3LV2 A;  2GQN A;  1C0N A;  4BA4 A;  3CBF A;  3EIA A;  4WD2 A;  2C81 A;  4JF0 A;  1ARG A;  4A0G A;  1W7N A;  3NNK A;  3ZZJ A;  5EQC A;  5M4D A;  1IVR A;  1GCK A;  1AMR A;  1YNU A;  3ISL A;  4PFN A;  3ACZ A;  4KXK A;  5EUN A;  2W7I A;  2ZP7 A;  2VI9 A;  3PDX A;  5EIG A;  3FQ7 A;  3I5T A;  2VMZ A;  3PDB A;  4F5H A;  3NU7 A;  1WKH A;  2W8W A;  4ZWV A;  4ZAS A;  4TV7 A;  2CFB A;  1DGD A;  4WYD A;  2V0Y A;  4LC3 A;  1DGE A;  1H1C A;  2HUF A;  3LG0 A;  4XJL A;  5BJ4 A;  1I43 A;  1UU1 A;  2WK8 A;  5DX5 A;  1YOO A;  2YRI A;  2W7K A;  5M4B A;  1TAT A;  3EIB A;  3JZL A;  3PIU A;  1C9C A;  3WGC A;  1M0Q A;  2ZSM A;  1UKJ A;  3AEM A;  1CQ8 A;  3FQ8 A;  3JWB A;  4W8I A;  3G8M A;  2EO5 A;  1AAW A;  3WY7 A;  4F5G A;  3HDO A;  4E1O A;  3EZ1 A;  3PD6 B;  4R5Z A;  3E9K A;  5D95 A;  3NUI A;  3FVX A;  4GRX A;  3FQA A;  1XEY A;  1OHW A;  3FDB A;  4AOA A;  1BJN A;  2W8U A;  4WYE A;  4A00 A;  4B9B A;  4XAU A;  1ELU A;  2R5C B;  5M46 A;  2W7G A;  4TN4 A;  1O61 A;  3DOD A;  1D7S A;  3HBX A;  3TCM A;  2CY8 A;  4JEW A;  1MDX A;  2YKU A;  2XBN A;  2F8J A;  3HMU A;  3FCR A;  4I8A A;  2BIG A;  1B9H A;  2VIA A;  3MEB A;  3WCO A;  2VMU A;  1O62 A;  2DGK A;  4W91 A;  2EH6 A;  4O6Z A;  1Y4I A;  4QGR A; 
#chains in the Genus database with same CATH topology
 1N31 A;  1J32 A;  1WYV A;  5DJ9 A;  2VMP A;  2E7I A;  2Z9U A;  4N0B A;  1ASC A;  3A9Z A;  1OXP A;  3DU4 A;  3N0L A;  4MQP A;  3N75 A;  4WB0 B;  1DJE A;  3W1H A;  2BHX A;  4PVF A;  3QM2 A;  4UQV A;  4ZDO A;  3PPL A;  3KGW A;  1WYT A;  5EFS A;  1QIS A;  2Z67 A;  3NYS A;  1ASL A;  1AIA A;  1OAT A;  3P1T A;  2BI9 A;  4A6U A;  4AO9 A;  2BYJ A;  3K7Y A;  2FKI A;  4XJP A;  2FNI A;  1AMA A;  1QGN A;  1V2E A;  5JAY A;  4BQ0 A;  1ZC9 A;  3NX3 A;  1AMQ A;  1ARH A;  1WYU B;  4XK1 A;  3QGU A;  4GSA A;  1TOI A;  4IX8 A;  2VGW A;  1RVU A;  2TPL A;  4MKJ A;  1IX7 A;  1OHY A;  3VAX A;  1DJ9 A;  3AV7 A;  2R0T A;  4OTL A;  4DBC A;  3VP6 A;  4F5I A;  2OKK A;  1Z3Z A;  2X5F A;  2YCP A;  2QLR A;  3Q8N A;  2CST A;  3MAU A;  4JEZ A;  4M2J A;  3RBF A;  2HP1 A;  4U2H A;  4ATP A;  3MAF B;  3PAA A;  1IX8 A;  3VK3 A;  2W7L A;  3FFR A;  1CZC A;  4GE7 A;  5E5I A;  3VK2 A;  1X28 A;  4RJY A;  1BJW A;  4A6T A;  1SF2 A;  2YCT A;  1KMJ A;  1BS0 A;  3K40 A;  1GC3 A;  2Z61 A;  2C44 A;  2OAT A;  2VGT A;  3A9Y A;  4B98 A;  1C7O A;  2FNU A;  4ZM4 A;  1AX4 A;  3ELP A;  1TOJ A;  1CS1 A;  3WLX A;  3LY1 A;  1KKP A;  3BWN A;  4TMR A;  1KL1 A;  3FFH A;  4IXS A;  5J8Q A;  3B1E A;  2O0R A;  3BCB A;  4FL0 A;  3AEL A;  2CB1 A;  5EUE A;  3RBL A;  3G7Q A;  4Q75 A;  4Q6R A;  2W7F A;  2Z9W A;  2VMW A;  3DR4 A;  2AY7 A;  2AY1 A;  2JG2 A;  2OGE A;  2X5D A;  1SZS A;  3COG A;  3P6K A;  4LW2 A;  4A6R A;  3LVK A;  1SZK A;  5D5S A;  3AOV A;  3E2Z A;  1LS3 A;  2VGV A;  1W23 A;  3FSL A;  3FTB A;  3KKI A;  2A1V A;  3GJU A;  3A9X A;  3EUC A;  1ASM A;  4RKC A;  2ZY5 A;  4W5K A;  1CQ6 A;  3PD6 A;  1ART A;  9AAT A;  4P7Y A;  2D65 A;  4WBT A;  4PIW A;  2VYC A;  1JF9 A;  3R9A A;  1ELQ A;  1GEX A;  2R5C A;  3AEM C;  2D61 A;  2AY5 A;  4WP0 A;  1CQ7 A;  4XJO A;  2AY6 A;  4Q31 A;  4MY5 A;  1MDO A;  2HUU A;  3LWS A;  2PB0 A;  4F5M A;  1PFF A;  1I41 A;  1W7M A;  2VMS A;  3DC1 A;  4ISY A;  2DGM A;  1BJO B;  1S07 A;  2CAN A;  1X0M A;  3IHJ A;  4JEY A;  4UOY A;  2AY9 A;  2W8T A;  4IY7 A;  1S09 A;  2AY4 A;  3PJ0 A;  1IAY A;  4NOG A;  1MAP A;  3ZRR A;  1ZOD A;  3HLM A;  4KAM A;  3FDD A;  3QBO A;  4P3M A;  1AJR A;  1WST A;  2EPJ A;  2QBT A;  4WB0 A;  3ZRQ A;  4AZJ A;  2ORD A;  1QJ3 A;  2DOU A;  4H63 Q;  2AY3 A;  4A72 A;  3HL2 A;  2WB6 A;  1AHX A;  2GMU A;  1G7X A;  1ORD A;  1MLY A;  1V2F A;  3A8U X;  4L0O A;  3D6K A;  4RAE A;  2AAT A;  8AAT A;  3JU7 A;  2R5E A;  3E2Y A;  3RI6 A;  1LKC A;  3TFT A;  2BI2 A;  2EZ1 A;  4JE5 D;  2FN6 A;  4CBR A;  1WYU A;  3E77 A;  3QN6 A;  1AJS A;  1M0N A;  1MLZ A;  2VMO A;  3LVM A;  5EUD A;  4HVK A;  2Z9V A;  3QI6 A;  3PA9 A;  2D63 A;  1AHY A;  1I48 A;  1CL1 A;  5FT8 A;  1FG7 A;  3GBX A;  5IWQ A;  3TAT A;  1W3U A;  1ASG A;  2ZUK A;  4WLJ A;  5F9S A;  2VLF A;  1S06 A;  4KYO A;  3FZ8 A;  3N4X A;  4RIT A;  2HOX A;  3VK4 A;  2CIN A;  1AHE A;  1QIT A;  2CJH A;  2BWP A;  2VMR A;  2EGY A;  1TPL A;  3FZ6 A;  5LH9 A;  3DRD A;  4ITG A;  1LW4 A;  2Q7W A;  4EMY A;  4PFF A;  2PB2 A;  1EJI A;  3AOW A;  7AAT A;  1YAA A;  3ASA A;  2YOB A;  3M5U A;  2ZY3 A;  1AKC A;  4ATQ A;  4F5L A;  4K2I A;  1GEW A;  4WYA A;  1UU0 A;  4F5F A;  1C7G A;  5KTB A;  1XI9 A;  4K2M A;  3EZS A;  4GE4 A;  2C7T A;  2W8V A;  3AEP A;  4AZK A;  3JTX A;  4WLH A;  1I29 A;  4UHO A;  1J04 A;  4WYC A;  4EB7 A;  5FT4 A;  4XEW A;  3DYD A;  3RQ1 A;  4XQ2 A;  5HHY A;  4ADC A;  2FYF A;  2RFV A;  3LVL B;  1BQA A;  1ECX A;  3EI7 A;  1O4S A;  1GC0 A;  2HOZ A;  3BS8 A;  1BW0 A;  4RIZ A;  1YIZ A;  3BWN C;  3WKR A;  4OMA A;  2VMT A;  2W7D A;  2AY8 A;  1TAR A;  2QMA A;  3CQ6 A;  4R8D A;  1QZ9 A;  4W1W A;  4F5K A;  3H7F A;  2G7J A;  5C6U A;  4OC9 A;  2VGZ A;  1AY4 A;  2JIS A;  3GET A;  2WKA A;  1ASA A;  1JS6 A;  2HOR A;  1MAQ A;  1ASD A;  1V2D A;  3RUY A;  4LNM A;  5I92 A;  3H14 A;  1TOK A;  3G0T A;  2HUI A;  1CZE A;  1IAX A;  1LC5 A;  4EU1 A;  2VGU A;  2WK9 A;  3EI8 A;  3F0H A;  4ZDL A;  3JWA A;  5DB5 A;  2BIE A;  3W1I A;  2ZYJ A;  3WX9 A;  3ATH A;  2CH1 A;  4HF8 A;  4F4E A;  1AKB A;  1B5O A;  4ZSW A;  2D7Z A;  2ZC0 A;  2FQ6 A;  1ARI A;  2EZ2 A;  1P3W A;  3MBB A;  4H51 A;  3EI5 A;  5K8B A;  1D7U A;  1RVY A;  1UU2 A;  1E5E A;  2GB3 A;  2XH1 A;  3NUB A;  4ZM3 A;  2G6W A;  1KKJ A;  2YCN A;  4E77 A;  5M49 A;  4F5J A;  3BWO A;  3K28 A;  3DXW A;  3B1C A;  3FVU A;  1M32 A;  2R2N A;  1VEF A;  1IUG A;  4MKK A;  4LNJ A;  1FC4 A;  3PGY A;  1M6S A;  1W7L A;  1WKG A;  2QA3 A;  5AX8 A;  4A0R A;  2VMV A;  1ASE A;  4N0W A;  1AY8 A;  2FM1 A;  4WXF A;  2VIB A;  1ASF A;  2ZY4 A;  4M2M A;  3DXV A;  4JEV A;  1JS3 A;  3I4J A;  3GR9 A;  4AH3 A;  1EG5 A;  1IX6 A;  3BV0 A;  3WGB A;  3FZ7 A;  3R4T A;  1D2F A;  1AHG A;  2YKY A;  2E54 A;  4Y0D A;  5LHA A;  2W7H A;  4E3Q A;  4W1V A;  1LC8 A;  4UHN A;  5G2Q A;  1QIR A;  4RM1 A;  3AEJ A;  1YIY A;  5BJ3 A;  5FT6 A;  4R2N A;  3GZD A;  4ZAH A;  2AEU A;  5EAA A;  2DKB A;  2E7U A;  2QSR A;  4R5F A;  1BQD A;  5G09 A;  2QB2 A;  1LC7 A;  2JJE A;  1VP4 A;  4A0H A;  4XJM A;  4ITX A;  5DJ1 A;  5FT5 A;  1D7V A;  2VLH A;  3NDN A;  3RCH B;  3FKD A;  2VMN A;  2QB3 A;  3QHX A;  3E6G A;  3GZC A;  3OP7 A;  1B8G A;  2DR1 A;  1RV4 A;  3N4S A;  3F6T A;  3AEN B;  2OKJ A;  1M0O A;  3DR7 A;  2CJD A;  2HZP A;  1BT4 A;  4ADB A;  2E7J A;  2PO3 A;  1OHV A;  3N7N A;  2O1B A;  3AEO A;  4DGT A;  3B8X A;  3B46 A;  2KFP A;  1MGV A;  2Z9X A;  3MC6 C;  1PMM A;  2O7C A;  4OCA A;  3H9X A;  2OQX A;  4EB5 A;  5E3K A;  4ZSY A;  1GC2 A;  3MKJ A;  2VI8 A;  3NU8 A;  2JJF A;  4IYO B;  3AAT A;  2X8U A;  3DZZ A;  3E2Z B;  1DFO A;  4LNL A;  3L8A A;  4GE9 A;  1S08 A;  1KL2 A;  4GDY A;  1GDE A;  1LK9 A;  3NRA A;  5G4I A;  1ASB A;  4OBU A;  2GSA A;  1C4K A;  1SFF A;  1AHF A;  1GD9 A;  1VJO A;  3MAF A;  2AEV A;  1U08 A;  2BI3 A;  5G0A A;  3NYU A;  2BI1 A;  3T32 A;  1Z7D A;  3MC6 A;  2CJG A;  2DGL A;  3QPG A;  1ZOB A;  1V72 A;  4K05 A;  2GMS A;  3EI6 A;  4ADE A;  3WCN A;  1QJ5 A;  1H0C A;  1AY5 A;  4OT8 A;  1PMO A;  2JJH A;  1ARS A;  1S0A A;  5EIG B;  2ZY2 A;  1IJI A;  2HOY A;  3N5M A;  3I16 A;  2NMP A;  1ASN A;  3FRK A;  3FD0 A;  3PDB B;  4M2K A;  4Y0H A;  4MGR A;  1D7R A;  1M4N A;  1YJZ A;  3UE8 A;  1G4V A;  3BCX A;  2W7E A;  3BB8 A;  3A2B A;  4FFC A;  3KE3 A;  4UHM A;  4K2B A;  4JE5 A;  2BYL A;  2Z20 A;  2Z1Z A;  2C0R A;  3UAK A;  2VMX A;  4U1T A;  3VOM A;  1GBN A;  4LW4 A;  3ZRP A;  4RKD A;  4BA5 A;  4Q76 A;  3WZF A;  3ELE A;  2BWO A;  4BMK A;  2BWN A;  1G4X A;  1LW5 A;  2CH2 A;  4J8L A;  1CJ0 A;  3II0 A;  4JF1 A;  1BJ4 A;  3CQ4 A;  2YRR A;  1SVV A;  4ZDP A;  2ZSL A;  1X29 A;  3NYT A;  4CXQ A;  1AJS B;  3TQX A;  4A0F A;  1AMS A;  1JG8 A;  3ECD A;  1DJU A;  2AY2 A;  4WXG A;  3NTJ A;  1X2A A;  3BCA A;  1T3I A;  2W8J A;  4BHD A;  2JJG A;  2JGT A;  1FG3 A;  2BKW A;  4IW7 A;  3ASB A;  1EQB A;  1BKG A;  5E4Z A;  2W7J A;  1AKA A;  3LVJ A;  1WYV B;  1E5F A;  4GEB A;  1OXO A;  1KMK A;  3BC8 A;  3CAI A;  4MQQ A;  1IBJ A;  1G7W A;  1N8P A;  3W1J A;  3BN1 A;  4CVQ A;  1B4X A;  1CL2 A;  3MAD A;  5EAV A;  3WKS A;  2BIA A;  3USF A;  1AAM A;  1GC4 A;  1N2T A;  1YJS A;  2VMY A;  1WYT B;  3KGX A;  4WYF A;  1BJO A;  1DKA A;  4AO4 A;  3OKS A;  5G4J A;  5HXX A;  2VMQ A;  1TOE A;  3AEJ C;  3IF2 A;  1TAS A;  3L44 A;  5G2P A;  5F8V A;  3RCH A;  1AIB A;  1PG8 A;  3B1D A;  3GZD C;  2V1P A;  2VGS A;  1C7N A;  2BI5 A;  1B5P A;  1SZU A;  2HP2 A;  3CQ5 A;  4MSO A;  2YKV A;  3JW9 A;  3HVY A;  2W7M A;  3AEN A;  1M0P A;  3UWC A;  2D66 A;  4IXO A;  4OYT A;  2OGA A;  5HDM A;  2DKJ A;  2D7Y A;  3TFU A;  3GWP A;  4W1X A;  2X3L A;  2ZJG A;  3FVS A;  4ZLV A;  2EYQ A;  3HT4 A;  4ADD A;  4RLG A;  4JEX A;  3F9T A;  4DQ6 A;  1RV3 A;  1M7Y A;  4ZWM A;  4J5U A;  4OBV A;  3ZZK A;  4E3R A;  1KAF A;  4MQR A;  2WK7 A;  4EFF A;  1SPA A;  5TF5 A;  2YKX A;  4RJ0 A;  3GSB A;  4CXR A;  2CTZ A;  1MDZ A;  1O69 A;  4WXB A;  4IYO A;  1TOG A;  2Z1Y A;  1AIC A;  4IXZ A;  4Y0I A;  1DTY A;  3E2F A;  2D64 A;  2YHK A;  1YJY A;  1B9I A;  4WYG A;  3EI9 A;  4CBS A;  3HQT A;  2D5Y A;  1GEY A;  3LV2 A;  2GQN A;  1C0N A;  4BA4 A;  3CBF A;  3EIA A;  4WD2 A;  2C81 A;  4JF0 A;  1ARG A;  4A0G A;  1W7N A;  3NNK A;  3ZZJ A;  5EQC A;  5M4D A;  1IVR A;  1GCK A;  1AMR A;  1YNU A;  3ISL A;  4PFN A;  3ACZ A;  4KXK A;  5EUN A;  2W7I A;  2ZP7 A;  2VI9 A;  3PDX A;  5EIG A;  3FQ7 A;  3I5T A;  2VMZ A;  3PDB A;  4F5H A;  3NU7 A;  1WKH A;  2W8W A;  4ZWV A;  4ZAS A;  4TV7 A;  2CFB A;  1DGD A;  4WYD A;  2V0Y A;  4LC3 A;  1DGE A;  1H1C A;  2HUF A;  3LG0 A;  4XJL A;  5BJ4 A;  1I43 A;  1UU1 A;  2WK8 A;  5DX5 A;  1YOO A;  2YRI A;  2W7K A;  5M4B A;  1TAT A;  3EIB A;  3JZL A;  3PIU A;  1C9C A;  3WGC A;  1M0Q A;  2ZSM A;  1UKJ A;  3AEM A;  1CQ8 A;  3FQ8 A;  3JWB A;  4W8I A;  3G8M A;  2EO5 A;  1AAW A;  3WY7 A;  4F5G A;  3HDO A;  4E1O A;  3EZ1 A;  3PD6 B;  4R5Z A;  3E9K A;  5D95 A;  3NUI A;  3FVX A;  4GRX A;  3FQA A;  1XEY A;  1OHW A;  3FDB A;  4AOA A;  1BJN A;  2W8U A;  4WYE A;  4A00 A;  4B9B A;  4XAU A;  1ELU A;  2R5C B;  5M46 A;  2W7G A;  4TN4 A;  1O61 A;  3DOD A;  1D7S A;  3HBX A;  3TCM A;  2CY8 A;  4JEW A;  1MDX A;  2YKU A;  2XBN A;  2F8J A;  3HMU A;  3FCR A;  3N4R A;  4I8A A;  2BIG A;  1B9H A;  2VIA A;  3MEB A;  3WCO A;  2VMU A;  1O62 A;  2DGK A;  4W91 A;  2EH6 A;  4O6Z A;  1Y4I A;  4QGR A; 
#chains in the Genus database with same CATH homology
 1N31 A;  1J32 A;  1WYV A;  5DJ9 A;  2VMP A;  2E7I A;  2Z9U A;  4N0B A;  1ASC A;  3A9Z A;  1OXP A;  3DU4 A;  3N0L A;  4MQP A;  3N75 A;  4WB0 B;  1DJE A;  3W1H A;  2BHX A;  4PVF A;  3QM2 A;  4UQV A;  4ZDO A;  3PPL A;  3KGW A;  1WYT A;  5EFS A;  1QIS A;  2Z67 A;  3NYS A;  1ASL A;  1AIA A;  1OAT A;  3P1T A;  2BI9 A;  4A6U A;  4AO9 A;  2BYJ A;  3K7Y A;  2FKI A;  4XJP A;  2FNI A;  1AMA A;  1QGN A;  1V2E A;  5JAY A;  4BQ0 A;  1ZC9 A;  3NX3 A;  1AMQ A;  1ARH A;  1WYU B;  4XK1 A;  3QGU A;  4GSA A;  1TOI A;  4IX8 A;  2VGW A;  1RVU A;  2TPL A;  4MKJ A;  1IX7 A;  1OHY A;  3VAX A;  1DJ9 A;  3AV7 A;  2R0T A;  4OTL A;  4DBC A;  3VP6 A;  4F5I A;  2OKK A;  1Z3Z A;  2X5F A;  2YCP A;  2QLR A;  3Q8N A;  2CST A;  3MAU A;  4JEZ A;  4M2J A;  3RBF A;  2HP1 A;  4U2H A;  4ATP A;  3MAF B;  3PAA A;  1IX8 A;  3VK3 A;  2W7L A;  3FFR A;  1CZC A;  4GE7 A;  5E5I A;  3VK2 A;  1X28 A;  4RJY A;  1BJW A;  4A6T A;  1SF2 A;  2YCT A;  1KMJ A;  1BS0 A;  3K40 A;  1GC3 A;  2Z61 A;  2C44 A;  2OAT A;  2VGT A;  3A9Y A;  4B98 A;  1C7O A;  2FNU A;  4ZM4 A;  1AX4 A;  3ELP A;  1TOJ A;  1CS1 A;  3WLX A;  3LY1 A;  1KKP A;  3BWN A;  4TMR A;  1KL1 A;  3FFH A;  4IXS A;  5J8Q A;  3B1E A;  2O0R A;  3BCB A;  4FL0 A;  3AEL A;  2CB1 A;  5EUE A;  3RBL A;  3G7Q A;  4Q75 A;  4Q6R A;  2W7F A;  2Z9W A;  2VMW A;  3DR4 A;  2AY7 A;  2AY1 A;  2JG2 A;  2OGE A;  2X5D A;  1SZS A;  3COG A;  3P6K A;  4LW2 A;  4A6R A;  3LVK A;  1SZK A;  5D5S A;  3AOV A;  3E2Z A;  1LS3 A;  2VGV A;  1W23 A;  3FSL A;  3FTB A;  3KKI A;  2A1V A;  3GJU A;  3A9X A;  3EUC A;  1ASM A;  4RKC A;  2ZY5 A;  4W5K A;  1CQ6 A;  3PD6 A;  1ART A;  9AAT A;  4P7Y A;  2D65 A;  4WBT A;  4PIW A;  2VYC A;  1JF9 A;  3R9A A;  1ELQ A;  1GEX A;  2R5C A;  3AEM C;  2D61 A;  2AY5 A;  4WP0 A;  1CQ7 A;  4XJO A;  2AY6 A;  4Q31 A;  4MY5 A;  1MDO A;  2HUU A;  3LWS A;  2PB0 A;  4F5M A;  1PFF A;  1I41 A;  1W7M A;  2VMS A;  3DC1 A;  4ISY A;  2DGM A;  1BJO B;  1S07 A;  2CAN A;  1X0M A;  3IHJ A;  4JEY A;  4UOY A;  2AY9 A;  2W8T A;  4IY7 A;  1S09 A;  2AY4 A;  3PJ0 A;  1IAY A;  4NOG A;  1MAP A;  3ZRR A;  1ZOD A;  3HLM A;  4KAM A;  3FDD A;  3QBO A;  4P3M A;  1AJR A;  1WST A;  2EPJ A;  2QBT A;  4WB0 A;  3ZRQ A;  4AZJ A;  2ORD A;  1QJ3 A;  2DOU A;  4H63 Q;  2AY3 A;  4A72 A;  3HL2 A;  2WB6 A;  1AHX A;  2GMU A;  1G7X A;  1ORD A;  1MLY A;  1V2F A;  3A8U X;  4L0O A;  3D6K A;  4RAE A;  2AAT A;  8AAT A;  3JU7 A;  2R5E A;  3E2Y A;  3RI6 A;  1LKC A;  3TFT A;  2BI2 A;  2EZ1 A;  4JE5 D;  2FN6 A;  4CBR A;  1WYU A;  3E77 A;  3QN6 A;  1AJS A;  1M0N A;  1MLZ A;  2VMO A;  3LVM A;  5EUD A;  4HVK A;  2Z9V A;  3QI6 A;  3PA9 A;  2D63 A;  1AHY A;  1I48 A;  1CL1 A;  5FT8 A;  1FG7 A;  3GBX A;  5IWQ A;  3TAT A;  1W3U A;  1ASG A;  2ZUK A;  4WLJ A;  5F9S A;  2VLF A;  1S06 A;  4KYO A;  3FZ8 A;  3N4X A;  4RIT A;  2HOX A;  3VK4 A;  2CIN A;  1AHE A;  1QIT A;  2CJH A;  2BWP A;  2VMR A;  2EGY A;  1TPL A;  3FZ6 A;  5LH9 A;  3DRD A;  4ITG A;  1LW4 A;  2Q7W A;  4EMY A;  4PFF A;  2PB2 A;  1EJI A;  3AOW A;  7AAT A;  1YAA A;  3ASA A;  2YOB A;  3M5U A;  2ZY3 A;  1AKC A;  4ATQ A;  4F5L A;  4K2I A;  1GEW A;  4WYA A;  1UU0 A;  4F5F A;  1C7G A;  5KTB A;  1XI9 A;  4K2M A;  3EZS A;  4GE4 A;  2C7T A;  2W8V A;  3AEP A;  4AZK A;  3JTX A;  4WLH A;  1I29 A;  4UHO A;  1J04 A;  4WYC A;  4EB7 A;  5FT4 A;  4XEW A;  3DYD A;  3RQ1 A;  4XQ2 A;  5HHY A;  4ADC A;  2FYF A;  2RFV A;  3LVL B;  1BQA A;  1ECX A;  3EI7 A;  1O4S A;  1GC0 A;  2HOZ A;  3BS8 A;  1BW0 A;  4RIZ A;  1YIZ A;  3BWN C;  3WKR A;  4OMA A;  2VMT A;  2W7D A;  2AY8 A;  1TAR A;  2QMA A;  3CQ6 A;  4R8D A;  1QZ9 A;  4W1W A;  4F5K A;  3H7F A;  2G7J A;  5C6U A;  4OC9 A;  2VGZ A;  1AY4 A;  2JIS A;  3GET A;  2WKA A;  1ASA A;  1JS6 A;  2HOR A;  1MAQ A;  1ASD A;  1V2D A;  3RUY A;  4LNM A;  5I92 A;  3H14 A;  1TOK A;  3G0T A;  2HUI A;  1CZE A;  1IAX A;  1LC5 A;  4EU1 A;  2VGU A;  2WK9 A;  3EI8 A;  3F0H A;  4ZDL A;  3JWA A;  5DB5 A;  2BIE A;  3W1I A;  2ZYJ A;  3WX9 A;  3ATH A;  2CH1 A;  4HF8 A;  4F4E A;  1AKB A;  1B5O A;  4ZSW A;  2D7Z A;  2ZC0 A;  2FQ6 A;  1ARI A;  2EZ2 A;  1P3W A;  3MBB A;  4H51 A;  3EI5 A;  5K8B A;  1D7U A;  1RVY A;  1UU2 A;  1E5E A;  2GB3 A;  2XH1 A;  3NUB A;  4ZM3 A;  2G6W A;  1KKJ A;  2YCN A;  4E77 A;  5M49 A;  4F5J A;  3BWO A;  3K28 A;  3DXW A;  3B1C A;  3FVU A;  1M32 A;  2R2N A;  1VEF A;  1IUG A;  4MKK A;  4LNJ A;  1FC4 A;  3PGY A;  1M6S A;  1W7L A;  1WKG A;  2QA3 A;  5AX8 A;  4A0R A;  2VMV A;  1ASE A;  4N0W A;  1AY8 A;  2FM1 A;  4WXF A;  2VIB A;  1ASF A;  2ZY4 A;  4M2M A;  3DXV A;  4JEV A;  1JS3 A;  3I4J A;  3GR9 A;  4AH3 A;  1EG5 A;  1IX6 A;  3BV0 A;  3WGB A;  3FZ7 A;  3R4T A;  1D2F A;  1AHG A;  2YKY A;  2E54 A;  4Y0D A;  5LHA A;  2W7H A;  4E3Q A;  4W1V A;  1LC8 A;  4UHN A;  5G2Q A;  1QIR A;  4RM1 A;  3AEJ A;  1YIY A;  5BJ3 A;  5FT6 A;  4R2N A;  3GZD A;  4ZAH A;  2AEU A;  5EAA A;  2DKB A;  2E7U A;  2QSR A;  4R5F A;  1BQD A;  5G09 A;  2QB2 A;  1LC7 A;  2JJE A;  1VP4 A;  4A0H A;  4XJM A;  4ITX A;  5DJ1 A;  5FT5 A;  1D7V A;  2VLH A;  3NDN A;  3RCH B;  3FKD A;  2VMN A;  2QB3 A;  3QHX A;  3E6G A;  3GZC A;  3OP7 A;  1B8G A;  2DR1 A;  1RV4 A;  3N4S A;  3F6T A;  3AEN B;  2OKJ A;  1M0O A;  3DR7 A;  2CJD A;  2HZP A;  1BT4 A;  4ADB A;  2E7J A;  2PO3 A;  1OHV A;  3N7N A;  2O1B A;  3AEO A;  4DGT A;  3B8X A;  3B46 A;  2KFP A;  1MGV A;  2Z9X A;  3MC6 C;  1PMM A;  2O7C A;  4OCA A;  3H9X A;  2OQX A;  4EB5 A;  5E3K A;  4ZSY A;  1GC2 A;  3MKJ A;  2VI8 A;  3NU8 A;  2JJF A;  4IYO B;  3AAT A;  2X8U A;  3DZZ A;  3E2Z B;  1DFO A;  4LNL A;  3L8A A;  4GE9 A;  1S08 A;  1KL2 A;  4GDY A;  1GDE A;  1LK9 A;  3NRA A;  5G4I A;  1ASB A;  4OBU A;  2GSA A;  1C4K A;  1SFF A;  1AHF A;  1GD9 A;  1VJO A;  3MAF A;  2AEV A;  1U08 A;  2BI3 A;  5G0A A;  3NYU A;  2BI1 A;  3T32 A;  1Z7D A;  3MC6 A;  2CJG A;  2DGL A;  3QPG A;  1ZOB A;  1V72 A;  4K05 A;  2GMS A;  3EI6 A;  4ADE A;  3WCN A;  1QJ5 A;  1H0C A;  1AY5 A;  4OT8 A;  1PMO A;  2JJH A;  1ARS A;  1S0A A;  5EIG B;  2ZY2 A;  1IJI A;  2HOY A;  3N5M A;  3I16 A;  2NMP A;  1ASN A;  3FRK A;  3FD0 A;  3PDB B;  4M2K A;  4Y0H A;  4MGR A;  1D7R A;  1M4N A;  1YJZ A;  3UE8 A;  1G4V A;  3BCX A;  2W7E A;  3BB8 A;  3A2B A;  4FFC A;  3KE3 A;  4UHM A;  4K2B A;  4JE5 A;  2BYL A;  2Z20 A;  2Z1Z A;  2C0R A;  3UAK A;  2VMX A;  4U1T A;  3VOM A;  1GBN A;  4LW4 A;  3ZRP A;  4RKD A;  4BA5 A;  4Q76 A;  3WZF A;  3ELE A;  2BWO A;  4BMK A;  2BWN A;  1G4X A;  1LW5 A;  2CH2 A;  4J8L A;  1CJ0 A;  3II0 A;  4JF1 A;  1BJ4 A;  3CQ4 A;  2YRR A;  1SVV A;  4ZDP A;  2ZSL A;  1X29 A;  3NYT A;  4CXQ A;  1AJS B;  3TQX A;  4A0F A;  1AMS A;  1JG8 A;  3ECD A;  1DJU A;  2AY2 A;  4WXG A;  3NTJ A;  1X2A A;  3BCA A;  1T3I A;  2W8J A;  4BHD A;  2JJG A;  2JGT A;  1FG3 A;  2BKW A;  4IW7 A;  3ASB A;  1EQB A;  1BKG A;  5E4Z A;  2W7J A;  1AKA A;  3LVJ A;  1WYV B;  1E5F A;  4GEB A;  1OXO A;  1KMK A;  3BC8 A;  3CAI A;  4MQQ A;  1IBJ A;  1G7W A;  1N8P A;  3W1J A;  3BN1 A;  4CVQ A;  1B4X A;  1CL2 A;  3MAD A;  5EAV A;  3WKS A;  2BIA A;  3USF A;  1AAM A;  1GC4 A;  1N2T A;  1YJS A;  2VMY A;  1WYT B;  3KGX A;  4WYF A;  1BJO A;  1DKA A;  4AO4 A;  3OKS A;  5G4J A;  5HXX A;  2VMQ A;  1TOE A;  3AEJ C;  3IF2 A;  1TAS A;  3L44 A;  5G2P A;  5F8V A;  3RCH A;  1AIB A;  1PG8 A;  3B1D A;  3GZD C;  2V1P A;  2VGS A;  1C7N A;  2BI5 A;  1B5P A;  1SZU A;  2HP2 A;  3CQ5 A;  4MSO A;  2YKV A;  3JW9 A;  3HVY A;  2W7M A;  3AEN A;  1M0P A;  3UWC A;  2D66 A;  4IXO A;  4OYT A;  2OGA A;  5HDM A;  2DKJ A;  2D7Y A;  3TFU A;  3GWP A;  4W1X A;  2X3L A;  2ZJG A;  3FVS A;  4ZLV A;  2EYQ A;  3HT4 A;  4ADD A;  4RLG A;  4JEX A;  3F9T A;  4DQ6 A;  1RV3 A;  1M7Y A;  4ZWM A;  4J5U A;  4OBV A;  3ZZK A;  4E3R A;  4MQR A;  2WK7 A;  4EFF A;  1SPA A;  5TF5 A;  2YKX A;  4RJ0 A;  3GSB A;  4CXR A;  2CTZ A;  1MDZ A;  1O69 A;  4WXB A;  4IYO A;  1TOG A;  2Z1Y A;  1AIC A;  4IXZ A;  4Y0I A;  1DTY A;  3E2F A;  2D64 A;  2YHK A;  1YJY A;  1B9I A;  4WYG A;  3EI9 A;  4CBS A;  3HQT A;  2D5Y A;  1GEY A;  3LV2 A;  2GQN A;  1C0N A;  4BA4 A;  3CBF A;  3EIA A;  4WD2 A;  2C81 A;  4JF0 A;  1ARG A;  4A0G A;  1W7N A;  3NNK A;  3ZZJ A;  5EQC A;  5M4D A;  1IVR A;  1GCK A;  1AMR A;  1YNU A;  3ISL A;  4PFN A;  3ACZ A;  4KXK A;  5EUN A;  2W7I A;  2ZP7 A;  2VI9 A;  3PDX A;  5EIG A;  3FQ7 A;  3I5T A;  2VMZ A;  3PDB A;  4F5H A;  3NU7 A;  1WKH A;  2W8W A;  4ZWV A;  4ZAS A;  4TV7 A;  2CFB A;  1DGD A;  4WYD A;  2V0Y A;  4LC3 A;  1DGE A;  1H1C A;  2HUF A;  3LG0 A;  4XJL A;  5BJ4 A;  1I43 A;  1UU1 A;  2WK8 A;  5DX5 A;  1YOO A;  2YRI A;  2W7K A;  5M4B A;  1TAT A;  3EIB A;  3JZL A;  3PIU A;  1C9C A;  3WGC A;  1M0Q A;  2ZSM A;  1UKJ A;  3AEM A;  1CQ8 A;  3FQ8 A;  3JWB A;  4W8I A;  3G8M A;  2EO5 A;  1AAW A;  3WY7 A;  4F5G A;  3HDO A;  4E1O A;  3EZ1 A;  3PD6 B;  4R5Z A;  3E9K A;  5D95 A;  3NUI A;  3FVX A;  4GRX A;  3FQA A;  1XEY A;  1OHW A;  3FDB A;  4AOA A;  1BJN A;  2W8U A;  4WYE A;  4A00 A;  4B9B A;  4XAU A;  1ELU A;  2R5C B;  5M46 A;  2W7G A;  4TN4 A;  1O61 A;  3DOD A;  1D7S A;  3HBX A;  3TCM A;  2CY8 A;  4JEW A;  1MDX A;  2YKU A;  2XBN A;  2F8J A;  3HMU A;  3FCR A;  3N4R A;  4I8A A;  2BIG A;  1B9H A;  2VIA A;  3MEB A;  3WCO A;  2VMU A;  1O62 A;  2DGK A;  4W91 A;  2EH6 A;  4O6Z A;  1Y4I A;  4QGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...