3PD6B

Crystal structure of mouse mitochondrial aspartate aminotransferase, a newly identified kynurenine aminotransferase-iv
Total Genus 140
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
140
sequence length
401
structure length
400
Chain Sequence
SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYANMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aspartate aminotransferase, mitochondrial
publication title Biochemical and structural characterization of mouse mitochondrial aspartate aminotransferase, a newly identified kynurenine aminotransferase-IV.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 140
structure length 400
sequence length 401
chains with identical sequence D
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3pd6B02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3pd6B01
1MDOA 3BB8A 1SPAA 4MQQA 2ZSMA 1AHEA 1B4XA 1AAMA 1ASCA 1WYTB 3LVMA 2EH6A 4IXSA 1V72A 3A2BA 1PFFA 2D5YA 4GDYA 1C0NA 2V0YA 2W7FA 4AH3A 1CJ0A 1MDXA 5K8BA 1IJIA 1YIYA 3NX3A 4HF8A 2VGZA 1GC3A 3KGWA 4W1VA 4RKCA 1QJ3A 1G7XA 1LC8A 1DKAA 1X28A 2GMSA 4M2KA 5EIGA 3RUYA 4PIWA 3EI9A 5HHYA 4WP0A 3TQXA 2XH1A 4LW4A 2VMRA 2QLRA 2WKAA 1P3WA 2VMNA 4OT8A 2PO3A 4ZASA 3LY1A 2D64A 2F8JA 2DKBA 3GETA 4IX8A 4MKKA 4WYDA 2AY8A 4JEWA 3AEOA 2YRIA 2CINA 1SZSA 1U08A 2W8TA 1ASMA 1X29A 4UQVA 2GMUA 4DQ6A 1RV4A 2W8JA 4QGRA 3AELA 4R2NA 5G4JA 4E3QA 3GZCA 4F5GA 2HUFA 2EO5A 3UAKA 1S08A 2JJEA 1SZKA 3CQ6A 3DZZA 1GD9A 2DGLA 4WXGA 4F5HA 2EPJA 3FZ8A 2WK9A 1ELUA 5EUNA 4CBRA 5LHAA 2VGSA 3E9KA 4RAEA 2ZC0A 2CTZA 3K40A 1PG8A 2DR1A 1TASA 2VMXA 4RIZA 1O61A 2VIAA 3T32A 3ACZA 1BJWA 3L44A 1VP4A 1B5OA 2YCTA 3NU7A 1TOJA 4P3MA 1FG3A 4ISYA 4ADEA 1IVRA 1AKBA 4AO9A 1ECXA 4F5FA 4BA5A 2E7IA 1J32A 1BQAA 1YJSA 1TOIA 2R5CA 3B1EA 5EIGB 2Q7WA 3NRAA 4UHMA 4F4EA 3R4TA 1G4VA 1ASAA 4N0WA 4A00A 3HL2A 3EI8A 4OTLA 2CSTA 1JG8A 4UHOA 1TOKA 1OHWA 5G09A 1WYVB 4M2MA 2FN6A 1BKGA 3AEJC 4KXKA 4AO4A 2CB1A 2CFBA 4JF1A 3WY7A 4CBSA 4EB7A 5EAAA 1CZEA 2HUUA 4WLJA 4R8DA 2Z1ZA 1ZODA 4OCAA 1ARIA 3BC8A 3FFRA 2BYJA 3LWSA 3EUCA 2Z9VA 2YKUA 2D7ZA 2VGVA 3MEBA 3W1HA 1D7UA 2BWPA 1O4SA 2QB2A 3RBFA 2BIEA 2YCPA 1ARHA 2VMTA 2DOUA 1OXOA 2D63A 3PDBA 5EUEA 5F8VA 2ZJGA 3H14A 1WSTA 4LNLA 1M6SA 2ZUKA 5I92A 2VLHA 2AEVA 4N0BA 3BN1A 1N2TA 1QZ9A 1ARGA 3G7QA 3AEJA 2R5CB 4A6TA 4UOYA 4CVQA 4W1XA 3A9ZA 1WKHA 1YIZA 2BIAA 2WK8A 3NDNA 4XJMA 3FQ8A 3BV0A 1YNUA 3ISLA 1CL1A 3EZ1A 9AATA 1J04A 1EG5A 1ASBA 1TARA 3ATHA 4ZLVA 4JE5A 3NYTA 2QB3A 5AX8A 2QMAA 3MADA 4Q31A 2O7CA 2AY9A 4WYAA 2AY7A 3DU4A 5IWQA 1UU2A 2GQNA 1ASLA 2W7KA 4OMAA 3TFUA 3MKJA 3VK4A 5DJ9A 2D7YA 1ASFA 3BCAA 4FFCA 4LW2A 1M7YA 1S06A 2X5DA 1X2AA 4JEYA 3TFTA 3QGUA 1GEXA 2Z61A 4PFFA 3AENB 2W7EA 2VLFA 3LVJA 4XEWA 4ZDOA 3DXVA 4A0FA 2AY4A 2YKYA 1G7WA 2CY8A 4XJLA 3DODA 1GC4A 1RVYA 2CH1A 3COGA 3DC1A 3GWPA 1I41A 3PD6A 4GEBA 3E6GA 1RV3A 1ORDA 2VMZA 3FVXA 2DGKA 1Z7DA 2VGUA 4GSAA 4XJPA 3BWNA 4OC9A 3ZZKA 2CANA 3KGXA 4OBUA 3PDBB 3UWCA 1AHYA 1FG7A 3KKIA 1DJ9A 3PIUA 4MY5A 2YKVA 1AHGA 1AIBA 3CAIA 3A9YA 3GR9A 3NUIA 4Q6RA 4J8LA 4WYEA 4WB0A 1CQ6A 1DGEA 3LV2A 3AEMC 1BJOA 1LW5A 4IY7A 4CXRA 2NMPA 3FDDA 4ATPA 2VMQA 4LNJA 1GC2A 3G8MA 3K7YA 2AEUA 3PJ0A 3FVSA 4GE7A 4NOGA 5C6UA 4JEZA 2PB0A 2O0RA 5HDMA 3AATA 4A0GA 3BCXA 3HT4A 4R5ZA 2HP1A 1M32A 3CBFA 3JWBA 4RJYA 1EQBA 3JW9A 2JG2A 1AICA 4R5FA 3ZRRA 1N8PA 4RKDA 1W7LA 1V2FA 2JJGA 5DB5A 5FT8A 2ZY2A 3JZLA 3WCNA 2ZYJA 4B98A 2BWNA 1X0MA 1BJ4A 2AY1A 1MDZA 3D6KA 2VGTA 3OKSA 3EI6A 1QIRA 4M2JA 2VGWA 4WYFA 4GE4A 1QJ5A 3AEMA 4GE9A 3HDOA 5J8QA 2FYFA 1JS6A 3P1TA 4MQRA 3B46A 2HOYA 1TOEA 3PAAA 4U2HA 1C4KA 2Z9UA 1W3UA 2BI3A 1IX6A 2C0RA 2W7HA 4W5KA 4HVKA 4ZAHA 1OXPA 3GSBA 4WB0B 4Q76A 3N0LA 1T3IA 5D5SA 1BJOB 1KKJA 2QBTA 3GZDC 2FNUA 4F5LA 3B1CA 1UKJA 4LNMA 2Z9WA 1KKPA 3MAFA 1B5PA 2YHKA 1M4NA 1CQ7A 3EZSA 5EFSA 3QN6A 4OBVA 4F5JA 1KL1A 1M0PA 1IAYA 4B9BA 1Y4IA 2XBNA 3FVUA 3I5TA 5G4IA 5BJ4A 4MGRA 1MLZA 2AY5A 4WYCA 5EAVA 4A72A 3HQTA 1YOOA 1ASDA 3MBBA 2GB3A 3WKRA 3JTXA 2OQXA 2W7LA 1H1CA 2HZPA 4PVFA 1AIAA 3UE8A 4A0HA 3RQ1A 5TF5A 2W7GA 3E2ZA 3DXWA 3FD0A 5BJ3A 3E2YA 3QM2A 4WD2A 3WLXA 2Z20A 1AJSA 1W7MA 1XEYA 3EI5A 3AEPA 4IW7A 3GZDA 1GC0A 2YCNA 2W7JA 2AY3A 3FTBA 4JEXA 1GEYA 2CJGA 2C81A 2R5EA 3GJUA 5JAYA 1C7OA 3WKSA 1EJIA 1Z3ZA 2X8UA 3PGYA 1D7VA 2O1BA 2RFVA 1M0QA 3PPLA 2D65A 2VMVA 1AY4A 2BIGA 3BWOA 2TPLA 2QA3A 1I29A 2HP2A 3NUBA 1BJNA 4PFNA 1UU1A 2BWOA 3W1JA 4XJOA 1LW4A 1C7NA 2ZY3A 2BI9A 3MAFB 2W8UA 1M0NA 2W7DA 3BWNC 4Y0HA 4ZM3A 3B1DA 3PA9A 1CL2A 4WBTA 3RI6A 5M4BA 2V1PA 1KMJA 4XQ2A 3NTJA 3TCMA 3DRDA 1LK9A 1FC4A 2Z67A 4AZJA 1B9HA 1DGDA 3WGCA 3M5UA 3WCOA 2VI8A 4IYOA 1WYTA 1GCKA 5M46A 4MQPA 3R9AA 1SFFA 3HMUA 1I48A 4DGTA 1SZUA 3NYSA 3QBOA 3N5MA 3E2ZB 3FCRA 3A9XA 4BMKA 4ZDLA 3WGBA 1AJSB 2FM1A 3ECDA 1C9CA 1UU0A 2R2NA 3HLMA 4W91A 4A6RA 4ZSWA 4EFFA 3FQAA 1ARSA 2VIBA 4F5IA 3VK2A 4ITXA 2Z1YA 4F5MA 5FT4A 2HUIA 1SF2A 4WYGA 4K2MA 4RLGA 2E7JA 4F5KA 5LH9A 4JE5D 3I4JA 1D7SA 4U1TA 3VK3A 2G6WA 3HVYA 1S09A 1MGVA 3LVKA 4ZDPA 1GBNA 2CJDA 1AY8A 2YOBA 2VYCA 3ZRPA 1KL2A 4ZSYA 4ZM4A 2GSAA 4JEVA 3QHXA 1OHYA 3P6KA 4TMRA 2ORDA 3BS8A 1SVVA 4RJ0A 4WXFA 4EMYA 2ZY5A 3MC6C 3ELPA 1B8GA 3GBXA 3ASBA 1BQDA 3VP6A 1AMQA 4TN4A 3F6TA 3E2FA 2OGEA 4CXQA 1DJUA 3LG0A 1GDEA 2R0TA 4ADBA 1H0CA 1AMAA 4IYOB 2C7TA 5FT6A 1ASEA 1XI9A 3EIBA 1S0AA 3RCHA 1OHVA 3FRKA 3FSLA 1TOGA 1C7GA 1ASNA 5DJ1A 3F9TA 1W7NA 2VMYA 1IUGA 2EZ1A 1CS1A 3K28A 1ELQA 2JGTA 2VMUA 3PD6B 3AOVA 5G0AA 3G0TA 4I8AA 2DGMA 2OKKA 2E54A 3A8UX 3MC6A 4A0RA 1BT4A 1WKGA 2W7IA 1IX7A 3E77A 4Y0DA 3KE3A 1MAPA 1BW0A 3F0HA 4BA4A 4Q75A 1LC7A 3PDXA 1AKCA 4ITGA 2D61A 3WZFA 3TATA 2AY6A 1WYVA 1O62A 2BYLA 3QI6A 1MAQA 4XAUA 2Z9XA 3FKDA 4P7YA 4ADDA 3JU7A 2W7MA 2VMWA 4GRXA 1G4XA 4UHNA 5F9SA 4IXOA 2JJHA 1O69A 4MKJA 4IXZA 1BS0A 4J5UA 4RITA 4XK1A 1PMMA 2CH2A 2FQ6A 4BQ0A 4AOAA 3RCHB 2BKWA 4JF0A 1IAXA 4TV7A 1AJRA 3N75A 2VMSA 3NYUA 2YKXA 1VJOA 2BI5A 4A6UA 1WYUA 2VMOA 3CQ4A 2HOXA 3AV7A 1M0OA 3I16A 3WX9A 4W8IA 3B8XA 1AHFA 8AATA 2ZSLA 5HXXA 1DJEA 2OATA 1TATA 1QITA 3ELEA 1AHXA 2D66A 1MLYA 1JS3A 1V2DA 2AATA 1N31A 3EI7A 5FT5A 3FFHA 3L8AA 3FZ6A 2CJHA 1B9IA 1ASGA 1TPLA 4BHDA 1YAAA 3QPGA 5E3KA 3Q8NA 2C44A 3OP7A 2DKJA 4FL0A 1AAWA 2VMPA 3FDBA 2W8WA 4DBCA 4EB5A 1E5FA 2YRRA 1LS3A 1AKAA 4RM1A 4E1OA 4K2BA 3NU8A 3FQ7A 1W23A 2HOZA 3USFA 2EGYA 2X5FA 3IF2A 2BHXA 3AENA 1VEFA 1ARTA 1V2EA 3FZ7A 3DYDA 3BCBA 2E7UA 3NNKA 3MAUA 1YJZA 5EUDA 3HBXA 4LC3A 2ZP7A 1DTYA 4WXBA 5M4DA 2X3LA 3JWAA 2OGAA 4ATQA 1DFOA 1IX8A 3RBLA 1IBJA 3W1IA 1WYUB 2JISA 1CQ8A 4ZWVA 1D7RA 3IHJA 4Y0IA 1AMSA 3VOMA 5DX5A 1ZC9A 2W8VA 5D95A 1CZCA 5E4ZA 5G2QA 3LVLB 2HORA 4WLHA 4EU1A 1PMOA 2VI9A 4ZWMA 4OYTA 1E5EA 1I43A 2JJFA 4K2IA 3DR7A 4H51A 4KAMA 2EZ2A 1AY5A 1RVUA 1JF9A 3AOWA 5E5IA 3II0A 1LC5A 1AMRA 1QGNA 5G2PA 1OATA 4L0OA 2AY2A 3DR4A 3ZRQA 4AZKA 2WK7A 3ASAA 3H7FA 3ZZJA 4W1WA 5EQCA 1QISA 2ZY4A 1D2FA 3VAXA 3EIAA 4E3RA 2OKJA 7AATA 4O6ZA 4ADCA 2BI2A 4KYOA 2BI1A 1KMKA 1YJYA 1S07A 2FNIA 1AX4A 1LKCA 4E77A 5M49A 3CQ5A 4MSOA 1GEWA 2PB2A 1ZOBA
chains in the Genus database with same CATH superfamily
1MDOA 3BB8A 1SPAA 2QSRA 4MQQA 2ZSMA 1AHEA 1B4XA 1AAMA 1ASCA 1WYTB 3LVMA 2EH6A 4IXSA 1V72A 3A2BA 1PFFA 2D5YA 4GDYA 1C0NA 2V0YA 2W7FA 4AH3A 1CJ0A 1MDXA 5K8BA 1IJIA 1YIYA 3NX3A 4HF8A 2VGZA 1GC3A 3KGWA 4W1VA 4RKCA 1QJ3A 1G7XA 1LC8A 1DKAA 1X28A 2GMSA 4M2KA 5EIGA 3RUYA 4PIWA 3EI9A 5HHYA 4WP0A 3N4SA 3TQXA 2XH1A 4LW4A 2VMRA 2QLRA 2WKAA 1P3WA 2VMNA 4OT8A 2PO3A 4ZASA 3LY1A 2D64A 2F8JA 2DKBA 3GETA 4IX8A 4MKKA 4WYDA 2AY8A 4JEWA 3AEOA 2YRIA 2CINA 1SZSA 1U08A 3N7NA 2W8TA 1ASMA 1X29A 4UQVA 2GMUA 4DQ6A 1RV4A 2W8JA 4QGRA 3AELA 4R2NA 5G4JA 4E3QA 3GZCA 4F5GA 2HUFA 2EO5A 3UAKA 1S08A 2JJEA 1SZKA 3CQ6A 3DZZA 1GD9A 2DGLA 4WXGA 4F5HA 2EPJA 3FZ8A 2WK9A 3N4RA 1ELUA 5EUNA 4CBRA 5LHAA 2VGSA 3E9KA 4RAEA 2ZC0A 2CTZA 3K40A 1PG8A 2DR1A 1TASA 2VMXA 4RIZA 1O61A 2VIAA 3T32A 3ACZA 1BJWA 3L44A 1VP4A 1B5OA 2YCTA 3NU7A 1TOJA 4P3MA 1FG3A 4ISYA 4ADEA 1IVRA 1AKBA 4AO9A 1ECXA 4F5FA 4BA5A 2E7IA 1J32A 1BQAA 1YJSA 1TOIA 2R5CA 3B1EA 5EIGB 2Q7WA 3NRAA 4UHMA 4F4EA 3R4TA 1G4VA 1ASAA 4N0WA 4A00A 3HL2A 3EI8A 4OTLA 2CSTA 1JG8A 4UHOA 1TOKA 1OHWA 5G09A 1WYVB 4M2MA 2FN6A 1BKGA 3AEJC 4KXKA 4AO4A 2CB1A 2CFBA 4JF1A 3WY7A 4CBSA 4EB7A 5EAAA 1CZEA 2HUUA 4WLJA 4R8DA 2Z1ZA 1ZODA 4OCAA 1ARIA 3BC8A 3FFRA 2BYJA 3LWSA 3EUCA 2Z9VA 2YKUA 2D7ZA 2VGVA 3MEBA 3W1HA 1D7UA 2BWPA 1O4SA 2QB2A 3RBFA 2BIEA 2YCPA 1ARHA 2VMTA 2DOUA 1OXOA 2D63A 3PDBA 5EUEA 5F8VA 2ZJGA 3H14A 1WSTA 4LNLA 1M6SA 2ZUKA 5I92A 2VLHA 2AEVA 4N0BA 3BN1A 1N2TA 1QZ9A 1ARGA 3G7QA 3AEJA 2R5CB 4A6TA 4UOYA 4CVQA 4W1XA 3A9ZA 1WKHA 1YIZA 2BIAA 2WK8A 3NDNA 4XJMA 3FQ8A 3BV0A 1YNUA 3ISLA 1CL1A 3EZ1A 9AATA 1J04A 1EG5A 2EYQA 1ASBA 1TARA 3ATHA 4ZLVA 4JE5A 3NYTA 2QB3A 5AX8A 2QMAA 3MADA 4Q31A 2O7CA 2AY9A 4WYAA 2AY7A 3DU4A 5IWQA 1UU2A 2GQNA 1ASLA 2W7KA 4OMAA 3TFUA 3MKJA 3VK4A 5DJ9A 2D7YA 1ASFA 3BCAA 4FFCA 4LW2A 1M7YA 1S06A 2X5DA 1X2AA 4JEYA 3TFTA 3QGUA 1GEXA 2Z61A 4PFFA 3AENB 2W7EA 2VLFA 3LVJA 4XEWA 4ZDOA 3DXVA 4A0FA 2AY4A 2YKYA 1G7WA 2CY8A 4XJLA 3DODA 1GC4A 1RVYA 2CH1A 3COGA 3DC1A 3GWPA 1I41A 3PD6A 4GEBA 5KTBA 3E6GA 1RV3A 1ORDA 2VMZA 3FVXA 2DGKA 1Z7DA 2VGUA 4GSAA 4XJPA 3BWNA 4OC9A 3ZZKA 2CANA 3KGXA 4OBUA 4K05A 3PDBB 3UWCA 1AHYA 1FG7A 3KKIA 1DJ9A 3PIUA 4MY5A 2YKVA 1AHGA 1AIBA 3CAIA 3A9YA 3GR9A 3NUIA 4Q6RA 4J8LA 4WYEA 4WB0A 1CQ6A 1DGEA 3LV2A 3AEMC 1BJOA 1LW5A 4IY7A 4CXRA 2NMPA 3FDDA 4ATPA 2VMQA 4LNJA 1GC2A 3G8MA 3K7YA 2AEUA 3PJ0A 3FVSA 4GE7A 4NOGA 5C6UA 4JEZA 2PB0A 2O0RA 5HDMA 3AATA 4A0GA 3BCXA 3HT4A 4R5ZA 2HP1A 1M32A 3CBFA 3JWBA 4RJYA 1EQBA 3JW9A 2JG2A 1AICA 4R5FA 3ZRRA 1N8PA 4RKDA 1W7LA 1V2FA 2JJGA 5DB5A 5FT8A 2ZY2A 3JZLA 3WCNA 2ZYJA 4B98A 2BWNA 1X0MA 1BJ4A 2AY1A 1MDZA 3D6KA 2VGTA 3OKSA 3EI6A 1QIRA 4M2JA 2VGWA 4WYFA 4GE4A 1QJ5A 3AEMA 4GE9A 3HDOA 5J8QA 2FYFA 1JS6A 3P1TA 4MQRA 3B46A 2HOYA 1TOEA 3PAAA 4U2HA 1C4KA 2Z9UA 1W3UA 2BI3A 1IX6A 2C0RA 2W7HA 4W5KA 4HVKA 4ZAHA 1OXPA 3GSBA 4WB0B 4Q76A 3N0LA 1T3IA 5D5SA 1BJOB 1KKJA 2QBTA 3GZDC 2FNUA 4F5LA 3B1CA 1UKJA 4LNMA 2Z9WA 1KKPA 3MAFA 1B5PA 2YHKA 1M4NA 1CQ7A 3EZSA 5EFSA 3QN6A 4OBVA 4F5JA 1KL1A 1M0PA 1IAYA 4B9BA 1Y4IA 2XBNA 3FVUA 3I5TA 5G4IA 5BJ4A 4MGRA 1MLZA 2AY5A 4WYCA 5EAVA 4A72A 3HQTA 1YOOA 1ASDA 3MBBA 2GB3A 3WKRA 3JTXA 2OQXA 2W7LA 1H1CA 2HZPA 4PVFA 1AIAA 3UE8A 4A0HA 3RQ1A 5TF5A 2W7GA 3E2ZA 3DXWA 3FD0A 5BJ3A 3E2YA 3QM2A 4WD2A 3WLXA 2Z20A 1AJSA 1W7MA 1XEYA 3EI5A 3AEPA 4IW7A 3GZDA 1GC0A 2YCNA 2W7JA 2AY3A 3FTBA 4JEXA 1GEYA 2CJGA 2C81A 2R5EA 3GJUA 5JAYA 1C7OA 3WKSA 1EJIA 1Z3ZA 2X8UA 3PGYA 1D7VA 2O1BA 2RFVA 1M0QA 3PPLA 2D65A 2VMVA 1AY4A 2BIGA 3BWOA 2TPLA 2QA3A 1I29A 2HP2A 3NUBA 1BJNA 4PFNA 1UU1A 2BWOA 3W1JA 4XJOA 4H63Q 1LW4A 1C7NA 2ZY3A 2BI9A 3MAFB 2W8UA 1M0NA 2W7DA 3BWNC 4Y0HA 4ZM3A 3B1DA 3PA9A 1CL2A 4WBTA 2WB6A 3RI6A 5M4BA 2V1PA 1KMJA 4XQ2A 3NTJA 3TCMA 3DRDA 1LK9A 1FC4A 2Z67A 4AZJA 1B9HA 1DGDA 3WGCA 3M5UA 3WCOA 2VI8A 4IYOA 1WYTA 1GCKA 5M46A 4MQPA 3R9AA 1SFFA 3HMUA 1I48A 4DGTA 1SZUA 3NYSA 3QBOA 3N5MA 3E2ZB 3FCRA 3A9XA 4BMKA 4ZDLA 3WGBA 1AJSB 2FM1A 3ECDA 1C9CA 1UU0A 2R2NA 3HLMA 4W91A 4A6RA 4ZSWA 4EFFA 3FQAA 1ARSA 2VIBA 4F5IA 3VK2A 4ITXA 2Z1YA 4F5MA 5FT4A 2HUIA 1SF2A 4WYGA 4K2MA 4RLGA 2E7JA 4F5KA 5LH9A 4JE5D 3I4JA 1D7SA 4U1TA 3VK3A 2G6WA 3HVYA 1S09A 1MGVA 3LVKA 4ZDPA 1GBNA 2CJDA 1AY8A 2YOBA 2VYCA 3ZRPA 1KL2A 4ZSYA 4ZM4A 2GSAA 4JEVA 3QHXA 1OHYA 3P6KA 4TMRA 2ORDA 3BS8A 1SVVA 4RJ0A 4WXFA 4EMYA 2ZY5A 3MC6C 3ELPA 1B8GA 3GBXA 3ASBA 1BQDA 3VP6A 1AMQA 4TN4A 3F6TA 3E2FA 2OGEA 4CXQA 1DJUA 3LG0A 1GDEA 2R0TA 4ADBA 1H0CA 1AMAA 4IYOB 2C7TA 5FT6A 1ASEA 1XI9A 3EIBA 1S0AA 3RCHA 1OHVA 3FRKA 3FSLA 1TOGA 1C7GA 1ASNA 5DJ1A 3F9TA 1W7NA 2VMYA 1IUGA 2EZ1A 1CS1A 3K28A 1ELQA 2JGTA 2VMUA 3PD6B 3AOVA 5G0AA 3G0TA 4I8AA 2DGMA 2OKKA 2E54A 3A8UX 3MC6A 4A0RA 1BT4A 1WKGA 2W7IA 1IX7A 3E77A 4Y0DA 3KE3A 1MAPA 1BW0A 3F0HA 4BA4A 4Q75A 1LC7A 3PDXA 1AKCA 4ITGA 2D61A 3WZFA 3TATA 2AY6A 1WYVA 1O62A 2BYLA 3QI6A 1MAQA 4XAUA 2Z9XA 3FKDA 4P7YA 4ADDA 3JU7A 2W7MA 2VMWA 4GRXA 1G4XA 4UHNA 5F9SA 4IXOA 2JJHA 1O69A 4MKJA 4IXZA 1BS0A 4J5UA 4RITA 4XK1A 1PMMA 2CH2A 2FQ6A 4BQ0A 4AOAA 3RCHB 2BKWA 4JF0A 1IAXA 4TV7A 1AJRA 3N75A 2VMSA 3NYUA 2YKXA 1VJOA 2BI5A 4A6UA 1WYUA 2VMOA 3CQ4A 2HOXA 3AV7A 1M0OA 3I16A 3WX9A 4W8IA 3B8XA 1AHFA 8AATA 2ZSLA 5HXXA 1DJEA 2OATA 1TATA 3N4XA 1QITA 3ELEA 1AHXA 2D66A 1MLYA 1JS3A 1V2DA 2AATA 1N31A 3EI7A 5FT5A 3FFHA 3L8AA 3FZ6A 2CJHA 1B9IA 1ASGA 1TPLA 4BHDA 1YAAA 3QPGA 5E3KA 3Q8NA 2C44A 3OP7A 2DKJA 4FL0A 1AAWA 2VMPA 3FDBA 2W8WA 4DBCA 4EB5A 1E5FA 2YRRA 1LS3A 1AKAA 4RM1A 4E1OA 4K2BA 3NU8A 3FQ7A 1W23A 2HOZA 3USFA 2EGYA 2X5FA 3IF2A 2BHXA 3AENA 1VEFA 1ARTA 1V2EA 3FZ7A 3H9XA 3DYDA 3BCBA 2A1VA 2E7UA 3NNKA 3MAUA 1YJZA 5EUDA 3HBXA 4LC3A 2ZP7A 1DTYA 4WXBA 5M4DA 2X3LA 3JWAA 2OGAA 4ATQA 1DFOA 1IX8A 3RBLA 1IBJA 3W1IA 1WYUB 2JISA 1CQ8A 4ZWVA 1D7RA 3IHJA 4Y0IA 1AMSA 3VOMA 5DX5A 1ZC9A 2W8VA 5D95A 1CZCA 5E4ZA 5G2QA 3LVLB 2HORA 4WLHA 4EU1A 1PMOA 2VI9A 4ZWMA 4OYTA 1E5EA 1I43A 2JJFA 4K2IA 3DR7A 4H51A 4KAMA 2EZ2A 1AY5A 1RVUA 1JF9A 3AOWA 5E5IA 3II0A 1LC5A 1AMRA 1QGNA 5G2PA 2FKIA 1OATA 1KAFA 4L0OA 2AY2A 3DR4A 3ZRQA 2KFPA 4AZKA 2WK7A 3ASAA 3H7FA 3ZZJA 4W1WA 5EQCA 2G7JA 1QISA 2ZY4A 1D2FA 3VAXA 3EIAA 4E3RA 2OKJA 7AATA 4O6ZA 4ADCA 2BI2A 4KYOA 2BI1A 1KMKA 1YJYA 1S07A 2FNIA 1AX4A 1LKCA 4E77A 5M49A 3CQ5A 4MSOA 1GEWA 2PB2A 1ZOBA
chains in the Genus database with same CATH topology
1MDOA 3BB8A 1SPAA 2QSRA 4MQQA 2ZSMA 1AHEA 1B4XA 1AAMA 1ASCA 1WYTB 3LVMA 2EH6A 4IXSA 1V72A 3A2BA 1PFFA 2D5YA 4GDYA 1C0NA 2V0YA 2W7FA 4AH3A 1CJ0A 1MDXA 5K8BA 1IJIA 1YIYA 3NX3A 4HF8A 2VGZA 1GC3A 3KGWA 4W1VA 4RKCA 1QJ3A 1G7XA 1LC8A 1DKAA 1X28A 2GMSA 4M2KA 5EIGA 3RUYA 4PIWA 3EI9A 5HHYA 4WP0A 3N4SA 3TQXA 2XH1A 4LW4A 2VMRA 2QLRA 2WKAA 1P3WA 2VMNA 4OT8A 2PO3A 4ZASA 3LY1A 2D64A 2F8JA 2DKBA 3GETA 4IX8A 4MKKA 4WYDA 2AY8A 4JEWA 3AEOA 2YRIA 2CINA 1SZSA 1U08A 3N7NA 2W8TA 1ASMA 1X29A 4UQVA 2GMUA 4DQ6A 1RV4A 2W8JA 4QGRA 3AELA 4R2NA 5G4JA 4E3QA 3GZCA 4F5GA 2HUFA 2EO5A 3UAKA 1S08A 2JJEA 1SZKA 3CQ6A 3DZZA 1GD9A 2DGLA 4WXGA 4F5HA 2EPJA 3FZ8A 2WK9A 3N4RA 1ELUA 5EUNA 4CBRA 5LHAA 2VGSA 3E9KA 4RAEA 2ZC0A 2CTZA 3K40A 1PG8A 2DR1A 1TASA 2VMXA 4RIZA 1O61A 2VIAA 3T32A 3ACZA 1BJWA 3L44A 1VP4A 1B5OA 2YCTA 3NU7A 1TOJA 4P3MA 1FG3A 4ISYA 4ADEA 1IVRA 1AKBA 4AO9A 1ECXA 4F5FA 4BA5A 2E7IA 1J32A 1BQAA 1YJSA 1TOIA 2R5CA 3B1EA 5EIGB 2Q7WA 3NRAA 4UHMA 4F4EA 3R4TA 1G4VA 1ASAA 4N0WA 4A00A 3HL2A 3EI8A 4OTLA 2CSTA 1JG8A 4UHOA 1TOKA 1OHWA 5G09A 1WYVB 4M2MA 2FN6A 1BKGA 3AEJC 4KXKA 4AO4A 2CB1A 2CFBA 4JF1A 3WY7A 4CBSA 4EB7A 5EAAA 1CZEA 2HUUA 4WLJA 4R8DA 2Z1ZA 1ZODA 4OCAA 1ARIA 3BC8A 3FFRA 2BYJA 3LWSA 3EUCA 2Z9VA 2YKUA 2D7ZA 2VGVA 3MEBA 3W1HA 1D7UA 2BWPA 1O4SA 2QB2A 3RBFA 2BIEA 2YCPA 1ARHA 2VMTA 2DOUA 1OXOA 2D63A 3PDBA 5EUEA 5F8VA 2ZJGA 3H14A 1WSTA 4LNLA 1M6SA 2ZUKA 5I92A 2VLHA 2AEVA 4N0BA 3BN1A 1N2TA 1QZ9A 1ARGA 3G7QA 3AEJA 2R5CB 4A6TA 4UOYA 4CVQA 4W1XA 3A9ZA 1WKHA 1YIZA 2BIAA 2WK8A 3NDNA 4XJMA 3FQ8A 3BV0A 1YNUA 3ISLA 1CL1A 3EZ1A 9AATA 1J04A 1EG5A 2EYQA 1ASBA 1TARA 3ATHA 4ZLVA 4JE5A 3NYTA 2QB3A 5AX8A 2QMAA 3MADA 4Q31A 2O7CA 2AY9A 4WYAA 2AY7A 3DU4A 5IWQA 1UU2A 2GQNA 1ASLA 2W7KA 4OMAA 3TFUA 3MKJA 3VK4A 5DJ9A 2D7YA 1ASFA 3BCAA 4FFCA 4LW2A 1M7YA 1S06A 2X5DA 1X2AA 4JEYA 3TFTA 3QGUA 1GEXA 2Z61A 4PFFA 3AENB 2W7EA 2VLFA 3LVJA 4XEWA 4ZDOA 3DXVA 4A0FA 2AY4A 2YKYA 1G7WA 2CY8A 4XJLA 3DODA 1GC4A 1RVYA 2CH1A 3COGA 3DC1A 3GWPA 1I41A 3PD6A 4GEBA 5KTBA 3E6GA 1RV3A 1ORDA 2VMZA 3FVXA 2DGKA 1Z7DA 2VGUA 4GSAA 4XJPA 3BWNA 4OC9A 3ZZKA 2CANA 3KGXA 4OBUA 4K05A 3PDBB 3UWCA 1AHYA 1FG7A 3KKIA 1DJ9A 3PIUA 4MY5A 2YKVA 1AHGA 1AIBA 3CAIA 3A9YA 3GR9A 3NUIA 4Q6RA 4J8LA 4WYEA 4WB0A 1CQ6A 1DGEA 3LV2A 3AEMC 1BJOA 1LW5A 4IY7A 4CXRA 2NMPA 3FDDA 4ATPA 2VMQA 4LNJA 1GC2A 3G8MA 3K7YA 2AEUA 3PJ0A 3FVSA 4GE7A 4NOGA 5C6UA 4JEZA 2PB0A 2O0RA 5HDMA 3AATA 4A0GA 3BCXA 3HT4A 4R5ZA 2HP1A 1M32A 3CBFA 3JWBA 4RJYA 1EQBA 3JW9A 2JG2A 1AICA 4R5FA 3ZRRA 1N8PA 4RKDA 1W7LA 1V2FA 2JJGA 5DB5A 5FT8A 2ZY2A 3JZLA 3WCNA 2ZYJA 4B98A 2BWNA 1X0MA 1BJ4A 2AY1A 1MDZA 3D6KA 2VGTA 3OKSA 3EI6A 1QIRA 4M2JA 2VGWA 4WYFA 4GE4A 1QJ5A 3AEMA 4GE9A 3HDOA 5J8QA 2FYFA 1JS6A 3P1TA 4MQRA 3B46A 2HOYA 1TOEA 3PAAA 4U2HA 1C4KA 2Z9UA 1W3UA 2BI3A 1IX6A 2C0RA 2W7HA 4W5KA 4HVKA 4ZAHA 1OXPA 3GSBA 4WB0B 4Q76A 3N0LA 1T3IA 5D5SA 1BJOB 1KKJA 2QBTA 3GZDC 2FNUA 4F5LA 3B1CA 1UKJA 4LNMA 2Z9WA 1KKPA 3MAFA 1B5PA 2YHKA 1M4NA 1CQ7A 3EZSA 5EFSA 3QN6A 4OBVA 4F5JA 1KL1A 1M0PA 1IAYA 4B9BA 1Y4IA 2XBNA 3FVUA 3I5TA 5G4IA 5BJ4A 4MGRA 1MLZA 2AY5A 4WYCA 5EAVA 4A72A 3HQTA 1YOOA 1ASDA 3MBBA 2GB3A 3WKRA 3JTXA 2OQXA 2W7LA 1H1CA 2HZPA 4PVFA 1AIAA 3UE8A 4A0HA 3RQ1A 5TF5A 2W7GA 3E2ZA 3DXWA 3FD0A 5BJ3A 3E2YA 3QM2A 4WD2A 3WLXA 2Z20A 1AJSA 1W7MA 1XEYA 3EI5A 3AEPA 4IW7A 3GZDA 1GC0A 2YCNA 2W7JA 2AY3A 3FTBA 4JEXA 1GEYA 2CJGA 2C81A 2R5EA 3GJUA 5JAYA 1C7OA 3WKSA 1EJIA 1Z3ZA 2X8UA 3PGYA 1D7VA 2O1BA 2RFVA 1M0QA 3PPLA 2D65A 2VMVA 1AY4A 2BIGA 3BWOA 2TPLA 2QA3A 1I29A 2HP2A 3NUBA 1BJNA 4PFNA 1UU1A 2BWOA 3W1JA 4XJOA 4H63Q 1LW4A 1C7NA 2ZY3A 2BI9A 3MAFB 2W8UA 1M0NA 2W7DA 3BWNC 4Y0HA 4ZM3A 3B1DA 3PA9A 1CL2A 4WBTA 2WB6A 3RI6A 5M4BA 2V1PA 1KMJA 4XQ2A 3NTJA 3TCMA 3DRDA 1LK9A 1FC4A 2Z67A 4AZJA 1B9HA 1DGDA 3WGCA 3M5UA 3WCOA 2VI8A 4IYOA 1WYTA 1GCKA 5M46A 4MQPA 3R9AA 1SFFA 3HMUA 1I48A 4DGTA 1SZUA 3NYSA 3QBOA 3N5MA 3E2ZB 3FCRA 3A9XA 4BMKA 4ZDLA 3WGBA 1AJSB 2FM1A 3ECDA 1C9CA 1UU0A 2R2NA 3HLMA 4W91A 4A6RA 4ZSWA 4EFFA 3FQAA 1ARSA 2VIBA 4F5IA 3VK2A 4ITXA 2Z1YA 4F5MA 5FT4A 2HUIA 1SF2A 4WYGA 4K2MA 4RLGA 2E7JA 4F5KA 5LH9A 4JE5D 3I4JA 1D7SA 4U1TA 3VK3A 2G6WA 3HVYA 1S09A 1MGVA 3LVKA 4ZDPA 1GBNA 2CJDA 1AY8A 2YOBA 2VYCA 3ZRPA 1KL2A 4ZSYA 4ZM4A 2GSAA 4JEVA 3QHXA 1OHYA 3P6KA 4TMRA 2ORDA 3BS8A 1SVVA 4RJ0A 4WXFA 4EMYA 2ZY5A 3MC6C 3ELPA 1B8GA 3GBXA 3ASBA 1BQDA 3VP6A 1AMQA 4TN4A 3F6TA 3E2FA 2OGEA 4CXQA 1DJUA 3LG0A 1GDEA 2R0TA 4ADBA 1H0CA 1AMAA 4IYOB 2C7TA 5FT6A 1ASEA 1XI9A 3EIBA 1S0AA 3RCHA 1OHVA 3FRKA 3FSLA 1TOGA 1C7GA 1ASNA 5DJ1A 3F9TA 1W7NA 2VMYA 1IUGA 2EZ1A 1CS1A 3K28A 1ELQA 2JGTA 2VMUA 3PD6B 3AOVA 5G0AA 3G0TA 4I8AA 2DGMA 2OKKA 2E54A 3A8UX 3MC6A 4A0RA 1BT4A 1WKGA 2W7IA 1IX7A 3E77A 4Y0DA 3KE3A 1MAPA 1BW0A 3F0HA 4BA4A 4Q75A 1LC7A 3PDXA 1AKCA 4ITGA 2D61A 3WZFA 3TATA 2AY6A 1WYVA 1O62A 2BYLA 3QI6A 1MAQA 4XAUA 2Z9XA 3FKDA 4P7YA 4ADDA 3JU7A 2W7MA 2VMWA 4GRXA 1G4XA 4UHNA 5F9SA 4IXOA 2JJHA 1O69A 4MKJA 4IXZA 1BS0A 4J5UA 4RITA 4XK1A 1PMMA 2CH2A 2FQ6A 4BQ0A 4AOAA 3RCHB 2BKWA 4JF0A 1IAXA 4TV7A 1AJRA 3N75A 2VMSA 3NYUA 2YKXA 1VJOA 2BI5A 4A6UA 1WYUA 2VMOA 3CQ4A 2HOXA 3AV7A 1M0OA 3I16A 3WX9A 4W8IA 3B8XA 1AHFA 8AATA 2ZSLA 5HXXA 1DJEA 2OATA 1TATA 3N4XA 1QITA 3ELEA 1AHXA 2D66A 1MLYA 1JS3A 1V2DA 2AATA 1N31A 3EI7A 5FT5A 3FFHA 3L8AA 3FZ6A 2CJHA 1B9IA 1ASGA 1TPLA 4BHDA 1YAAA 3QPGA 5E3KA 3Q8NA 2C44A 3OP7A 2DKJA 4FL0A 1AAWA 2VMPA 3FDBA 2W8WA 4DBCA 4EB5A 1E5FA 2YRRA 1LS3A 1AKAA 4RM1A 4E1OA 4K2BA 3NU8A 3FQ7A 1W23A 2HOZA 3USFA 2EGYA 2X5FA 3IF2A 2BHXA 3AENA 1VEFA 1ARTA 1V2EA 3FZ7A 3H9XA 3DYDA 3BCBA 2A1VA 2E7UA 3NNKA 3MAUA 1YJZA 5EUDA 3HBXA 4LC3A 2ZP7A 1DTYA 4WXBA 5M4DA 2X3LA 3JWAA 2OGAA 4ATQA 1DFOA 1IX8A 3RBLA 1IBJA 3W1IA 1WYUB 2JISA 1CQ8A 4ZWVA 1D7RA 3IHJA 4Y0IA 1AMSA 3VOMA 5DX5A 1ZC9A 2W8VA 5D95A 1CZCA 5E4ZA 5G2QA 3LVLB 2HORA 4WLHA 4EU1A 1PMOA 2VI9A 4ZWMA 4OYTA 1E5EA 1I43A 2JJFA 4K2IA 3DR7A 4H51A 4KAMA 2EZ2A 1AY5A 1RVUA 1JF9A 3AOWA 5E5IA 3II0A 1LC5A 1AMRA 1QGNA 5G2PA 2FKIA 1OATA 4L0OA 2AY2A 3DR4A 3ZRQA 2KFPA 4AZKA 2WK7A 3ASAA 3H7FA 3ZZJA 4W1WA 5EQCA 2G7JA 1QISA 2ZY4A 1D2FA 3VAXA 3EIAA 4E3RA 2OKJA 7AATA 4O6ZA 4ADCA 2BI2A 4KYOA 2BI1A 1KMKA 1YJYA 1S07A 2FNIA 1AX4A 1LKCA 4E77A 5M49A 3CQ5A 4MSOA 1GEWA 2PB2A 1ZOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MDO A;  3BB8 A;  1SPA A;  4MQQ A;  2ZSM A;  1AHE A;  1B4X A;  1AAM A;  1ASC A;  1WYT B;  3LVM A;  2EH6 A;  4IXS A;  1V72 A;  3A2B A;  1PFF A;  2D5Y A;  4GDY A;  1C0N A;  2V0Y A;  2W7F A;  4AH3 A;  1CJ0 A;  1MDX A;  5K8B A;  1IJI A;  1YIY A;  3NX3 A;  4HF8 A;  2VGZ A;  1GC3 A;  3KGW A;  4W1V A;  4RKC A;  1QJ3 A;  1G7X A;  1LC8 A;  1DKA A;  1X28 A;  2GMS A;  4M2K A;  5EIG A;  3RUY A;  4PIW A;  3EI9 A;  5HHY A;  4WP0 A;  3TQX A;  2XH1 A;  4LW4 A;  2VMR A;  2QLR A;  2WKA A;  1P3W A;  2VMN A;  4OT8 A;  2PO3 A;  4ZAS A;  3LY1 A;  2D64 A;  2F8J A;  2DKB A;  3GET A;  4IX8 A;  4MKK A;  4WYD A;  2AY8 A;  4JEW A;  3AEO A;  2YRI A;  2CIN A;  1SZS A;  1U08 A;  2W8T A;  1ASM A;  1X29 A;  4UQV A;  2GMU A;  4DQ6 A;  1RV4 A;  2W8J A;  4QGR A;  3AEL A;  4R2N A;  5G4J A;  4E3Q A;  3GZC A;  4F5G A;  2HUF A;  2EO5 A;  3UAK A;  1S08 A;  2JJE A;  1SZK A;  3CQ6 A;  3DZZ A;  1GD9 A;  2DGL A;  4WXG A;  4F5H A;  2EPJ A;  3FZ8 A;  2WK9 A;  1ELU A;  5EUN A;  4CBR A;  5LHA A;  2VGS A;  3E9K A;  4RAE A;  2ZC0 A;  2CTZ A;  3K40 A;  1PG8 A;  2DR1 A;  1TAS A;  2VMX A;  4RIZ A;  1O61 A;  2VIA A;  3T32 A;  3ACZ A;  1BJW A;  3L44 A;  1VP4 A;  1B5O A;  2YCT A;  3NU7 A;  1TOJ A;  4P3M A;  1FG3 A;  4ISY A;  4ADE A;  1IVR A;  1AKB A;  4AO9 A;  1ECX A;  4F5F A;  4BA5 A;  2E7I A;  1J32 A;  1BQA A;  1YJS A;  1TOI A;  2R5C A;  3B1E A;  5EIG B;  2Q7W A;  3NRA A;  4UHM A;  4F4E A;  3R4T A;  1G4V A;  1ASA A;  4N0W A;  4A00 A;  3HL2 A;  3EI8 A;  4OTL A;  2CST A;  1JG8 A;  4UHO A;  1TOK A;  1OHW A;  5G09 A;  1WYV B;  4M2M A;  2FN6 A;  1BKG A;  3AEJ C;  4KXK A;  4AO4 A;  2CB1 A;  2CFB A;  4JF1 A;  3WY7 A;  4CBS A;  4EB7 A;  5EAA A;  1CZE A;  2HUU A;  4WLJ A;  4R8D A;  2Z1Z A;  1ZOD A;  4OCA A;  1ARI A;  3BC8 A;  3FFR A;  2BYJ A;  3LWS A;  3EUC A;  2Z9V A;  2YKU A;  2D7Z A;  2VGV A;  3MEB A;  3W1H A;  1D7U A;  2BWP A;  1O4S A;  2QB2 A;  3RBF A;  2BIE A;  2YCP A;  1ARH A;  2VMT A;  2DOU A;  1OXO A;  2D63 A;  3PDB A;  5EUE A;  5F8V A;  2ZJG A;  3H14 A;  1WST A;  4LNL A;  1M6S A;  2ZUK A;  5I92 A;  2VLH A;  2AEV A;  4N0B A;  3BN1 A;  1N2T A;  1QZ9 A;  1ARG A;  3G7Q A;  3AEJ A;  2R5C B;  4A6T A;  4UOY A;  4CVQ A;  4W1X A;  3A9Z A;  1WKH A;  1YIZ A;  2BIA A;  2WK8 A;  3NDN A;  4XJM A;  3FQ8 A;  3BV0 A;  1YNU A;  3ISL A;  1CL1 A;  3EZ1 A;  9AAT A;  1J04 A;  1EG5 A;  1ASB A;  1TAR A;  3ATH A;  4ZLV A;  4JE5 A;  3NYT A;  2QB3 A;  5AX8 A;  2QMA A;  3MAD A;  4Q31 A;  2O7C A;  2AY9 A;  4WYA A;  2AY7 A;  3DU4 A;  5IWQ A;  1UU2 A;  2GQN A;  1ASL A;  2W7K A;  4OMA A;  3TFU A;  3MKJ A;  3VK4 A;  5DJ9 A;  2D7Y A;  1ASF A;  3BCA A;  4FFC A;  4LW2 A;  1M7Y A;  1S06 A;  2X5D A;  1X2A A;  4JEY A;  3TFT A;  3QGU A;  1GEX A;  2Z61 A;  4PFF A;  3AEN B;  2W7E A;  2VLF A;  3LVJ A;  4XEW A;  4ZDO A;  3DXV A;  4A0F A;  2AY4 A;  2YKY A;  1G7W A;  2CY8 A;  4XJL A;  3DOD A;  1GC4 A;  1RVY A;  2CH1 A;  3COG A;  3DC1 A;  3GWP A;  1I41 A;  3PD6 A;  4GEB A;  3E6G A;  1RV3 A;  1ORD A;  2VMZ A;  3FVX A;  2DGK A;  1Z7D A;  2VGU A;  4GSA A;  4XJP A;  3BWN A;  4OC9 A;  3ZZK A;  2CAN A;  3KGX A;  4OBU A;  3PDB B;  3UWC A;  1AHY A;  1FG7 A;  3KKI A;  1DJ9 A;  3PIU A;  4MY5 A;  2YKV A;  1AHG A;  1AIB A;  3CAI A;  3A9Y A;  3GR9 A;  3NUI A;  4Q6R A;  4J8L A;  4WYE A;  4WB0 A;  1CQ6 A;  1DGE A;  3LV2 A;  3AEM C;  1BJO A;  1LW5 A;  4IY7 A;  4CXR A;  2NMP A;  3FDD A;  4ATP A;  2VMQ A;  4LNJ A;  1GC2 A;  3G8M A;  3K7Y A;  2AEU A;  3PJ0 A;  3FVS A;  4GE7 A;  4NOG A;  5C6U A;  4JEZ A;  2PB0 A;  2O0R A;  5HDM A;  3AAT A;  4A0G A;  3BCX A;  3HT4 A;  4R5Z A;  2HP1 A;  1M32 A;  3CBF A;  3JWB A;  4RJY A;  1EQB A;  3JW9 A;  2JG2 A;  1AIC A;  4R5F A;  3ZRR A;  1N8P A;  4RKD A;  1W7L A;  1V2F A;  2JJG A;  5DB5 A;  5FT8 A;  2ZY2 A;  3JZL A;  3WCN A;  2ZYJ A;  4B98 A;  2BWN A;  1X0M A;  1BJ4 A;  2AY1 A;  1MDZ A;  3D6K A;  2VGT A;  3OKS A;  3EI6 A;  1QIR A;  4M2J A;  2VGW A;  4WYF A;  4GE4 A;  1QJ5 A;  3AEM A;  4GE9 A;  3HDO A;  5J8Q A;  2FYF A;  1JS6 A;  3P1T A;  4MQR A;  3B46 A;  2HOY A;  1TOE A;  3PAA A;  4U2H A;  1C4K A;  2Z9U A;  1W3U A;  2BI3 A;  1IX6 A;  2C0R A;  2W7H A;  4W5K A;  4HVK A;  4ZAH A;  1OXP A;  3GSB A;  4WB0 B;  4Q76 A;  3N0L A;  1T3I A;  5D5S A;  1BJO B;  1KKJ A;  2QBT A;  3GZD C;  2FNU A;  4F5L A;  3B1C A;  1UKJ A;  4LNM A;  2Z9W A;  1KKP A;  3MAF A;  1B5P A;  2YHK A;  1M4N A;  1CQ7 A;  3EZS A;  5EFS A;  3QN6 A;  4OBV A;  4F5J A;  1KL1 A;  1M0P A;  1IAY A;  4B9B A;  1Y4I A;  2XBN A;  3FVU A;  3I5T A;  5G4I A;  5BJ4 A;  4MGR A;  1MLZ A;  2AY5 A;  4WYC A;  5EAV A;  4A72 A;  3HQT A;  1YOO A;  1ASD A;  3MBB A;  2GB3 A;  3WKR A;  3JTX A;  2OQX A;  2W7L A;  1H1C A;  2HZP A;  4PVF A;  1AIA A;  3UE8 A;  4A0H A;  3RQ1 A;  5TF5 A;  2W7G A;  3E2Z A;  3DXW A;  3FD0 A;  5BJ3 A;  3E2Y A;  3QM2 A;  4WD2 A;  3WLX A;  2Z20 A;  1AJS A;  1W7M A;  1XEY A;  3EI5 A;  3AEP A;  4IW7 A;  3GZD A;  1GC0 A;  2YCN A;  2W7J A;  2AY3 A;  3FTB A;  4JEX A;  1GEY A;  2CJG A;  2C81 A;  2R5E A;  3GJU A;  5JAY A;  1C7O A;  3WKS A;  1EJI A;  1Z3Z A;  2X8U A;  3PGY A;  1D7V A;  2O1B A;  2RFV A;  1M0Q A;  3PPL A;  2D65 A;  2VMV A;  1AY4 A;  2BIG A;  3BWO A;  2TPL A;  2QA3 A;  1I29 A;  2HP2 A;  3NUB A;  1BJN A;  4PFN A;  1UU1 A;  2BWO A;  3W1J A;  4XJO A;  1LW4 A;  1C7N A;  2ZY3 A;  2BI9 A;  3MAF B;  2W8U A;  1M0N A;  2W7D A;  3BWN C;  4Y0H A;  4ZM3 A;  3B1D A;  3PA9 A;  1CL2 A;  4WBT A;  3RI6 A;  5M4B A;  2V1P A;  1KMJ A;  4XQ2 A;  3NTJ A;  3TCM A;  3DRD A;  1LK9 A;  1FC4 A;  2Z67 A;  4AZJ A;  1B9H A;  1DGD A;  3WGC A;  3M5U A;  3WCO A;  2VI8 A;  4IYO A;  1WYT A;  1GCK A;  5M46 A;  4MQP A;  3R9A A;  1SFF A;  3HMU A;  1I48 A;  4DGT A;  1SZU A;  3NYS A;  3QBO A;  3N5M A;  3E2Z B;  3FCR A;  3A9X A;  4BMK A;  4ZDL A;  3WGB A;  1AJS B;  2FM1 A;  3ECD A;  1C9C A;  1UU0 A;  2R2N A;  3HLM A;  4W91 A;  4A6R A;  4ZSW A;  4EFF A;  3FQA A;  1ARS A;  2VIB A;  4F5I A;  3VK2 A;  4ITX A;  2Z1Y A;  4F5M A;  5FT4 A;  2HUI A;  1SF2 A;  4WYG A;  4K2M A;  4RLG A;  2E7J A;  4F5K A;  5LH9 A;  4JE5 D;  3I4J A;  1D7S A;  4U1T A;  3VK3 A;  2G6W A;  3HVY A;  1S09 A;  1MGV A;  3LVK A;  4ZDP A;  1GBN A;  2CJD A;  1AY8 A;  2YOB A;  2VYC A;  3ZRP A;  1KL2 A;  4ZSY A;  4ZM4 A;  2GSA A;  4JEV A;  3QHX A;  1OHY A;  3P6K A;  4TMR A;  2ORD A;  3BS8 A;  1SVV A;  4RJ0 A;  4WXF A;  4EMY A;  2ZY5 A;  3MC6 C;  3ELP A;  1B8G A;  3GBX A;  3ASB A;  1BQD A;  3VP6 A;  1AMQ A;  4TN4 A;  3F6T A;  3E2F A;  2OGE A;  4CXQ A;  1DJU A;  3LG0 A;  1GDE A;  2R0T A;  4ADB A;  1H0C A;  1AMA A;  4IYO B;  2C7T A;  5FT6 A;  1ASE A;  1XI9 A;  3EIB A;  1S0A A;  3RCH A;  1OHV A;  3FRK A;  3FSL A;  1TOG A;  1C7G A;  1ASN A;  5DJ1 A;  3F9T A;  1W7N A;  2VMY A;  1IUG A;  2EZ1 A;  1CS1 A;  3K28 A;  1ELQ A;  2JGT A;  2VMU A;  3PD6 B;  3AOV A;  5G0A A;  3G0T A;  4I8A A;  2DGM A;  2OKK A;  2E54 A;  3A8U X;  3MC6 A;  4A0R A;  1BT4 A;  1WKG A;  2W7I A;  1IX7 A;  3E77 A;  4Y0D A;  3KE3 A;  1MAP A;  1BW0 A;  3F0H A;  4BA4 A;  4Q75 A;  1LC7 A;  3PDX A;  1AKC A;  4ITG A;  2D61 A;  3WZF A;  3TAT A;  2AY6 A;  1WYV A;  1O62 A;  2BYL A;  3QI6 A;  1MAQ A;  4XAU A;  2Z9X A;  3FKD A;  4P7Y A;  4ADD A;  3JU7 A;  2W7M A;  2VMW A;  4GRX A;  1G4X A;  4UHN A;  5F9S A;  4IXO A;  2JJH A;  1O69 A;  4MKJ A;  4IXZ A;  1BS0 A;  4J5U A;  4RIT A;  4XK1 A;  1PMM A;  2CH2 A;  2FQ6 A;  4BQ0 A;  4AOA A;  3RCH B;  2BKW A;  4JF0 A;  1IAX A;  4TV7 A;  1AJR A;  3N75 A;  2VMS A;  3NYU A;  2YKX A;  1VJO A;  2BI5 A;  4A6U A;  1WYU A;  2VMO A;  3CQ4 A;  2HOX A;  3AV7 A;  1M0O A;  3I16 A;  3WX9 A;  4W8I A;  3B8X A;  1AHF A;  8AAT A;  2ZSL A;  5HXX A;  1DJE A;  2OAT A;  1TAT A;  1QIT A;  3ELE A;  1AHX A;  2D66 A;  1MLY A;  1JS3 A;  1V2D A;  2AAT A;  1N31 A;  3EI7 A;  5FT5 A;  3FFH A;  3L8A A;  3FZ6 A;  2CJH A;  1B9I A;  1ASG A;  1TPL A;  4BHD A;  1YAA A;  3QPG A;  5E3K A;  3Q8N A;  2C44 A;  3OP7 A;  2DKJ A;  4FL0 A;  1AAW A;  2VMP A;  3FDB A;  2W8W A;  4DBC A;  4EB5 A;  1E5F A;  2YRR A;  1LS3 A;  1AKA A;  4RM1 A;  4E1O A;  4K2B A;  3NU8 A;  3FQ7 A;  1W23 A;  2HOZ A;  3USF A;  2EGY A;  2X5F A;  3IF2 A;  2BHX A;  3AEN A;  1VEF A;  1ART A;  1V2E A;  3FZ7 A;  3DYD A;  3BCB A;  2E7U A;  3NNK A;  3MAU A;  1YJZ A;  5EUD A;  3HBX A;  4LC3 A;  2ZP7 A;  1DTY A;  4WXB A;  5M4D A;  2X3L A;  3JWA A;  2OGA A;  4ATQ A;  1DFO A;  1IX8 A;  3RBL A;  1IBJ A;  3W1I A;  1WYU B;  2JIS A;  1CQ8 A;  4ZWV A;  1D7R A;  3IHJ A;  4Y0I A;  1AMS A;  3VOM A;  5DX5 A;  1ZC9 A;  2W8V A;  5D95 A;  1CZC A;  5E4Z A;  5G2Q A;  3LVL B;  2HOR A;  4WLH A;  4EU1 A;  1PMO A;  2VI9 A;  4ZWM A;  4OYT A;  1E5E A;  1I43 A;  2JJF A;  4K2I A;  3DR7 A;  4H51 A;  4KAM A;  2EZ2 A;  1AY5 A;  1RVU A;  1JF9 A;  3AOW A;  5E5I A;  3II0 A;  1LC5 A;  1AMR A;  1QGN A;  5G2P A;  1OAT A;  4L0O A;  2AY2 A;  3DR4 A;  3ZRQ A;  4AZK A;  2WK7 A;  3ASA A;  3H7F A;  3ZZJ A;  4W1W A;  5EQC A;  1QIS A;  2ZY4 A;  1D2F A;  3VAX A;  3EIA A;  4E3R A;  2OKJ A;  7AAT A;  4O6Z A;  4ADC A;  2BI2 A;  4KYO A;  2BI1 A;  1KMK A;  1YJY A;  1S07 A;  2FNI A;  1AX4 A;  1LKC A;  4E77 A;  5M49 A;  3CQ5 A;  4MSO A;  1GEW A;  2PB2 A;  1ZOB A; 
#chains in the Genus database with same CATH topology
 1MDO A;  3BB8 A;  1SPA A;  2QSR A;  4MQQ A;  2ZSM A;  1AHE A;  1B4X A;  1AAM A;  1ASC A;  1WYT B;  3LVM A;  2EH6 A;  4IXS A;  1V72 A;  3A2B A;  1PFF A;  2D5Y A;  4GDY A;  1C0N A;  2V0Y A;  2W7F A;  4AH3 A;  1CJ0 A;  1MDX A;  5K8B A;  1IJI A;  1YIY A;  3NX3 A;  4HF8 A;  2VGZ A;  1GC3 A;  3KGW A;  4W1V A;  4RKC A;  1QJ3 A;  1G7X A;  1LC8 A;  1DKA A;  1X28 A;  2GMS A;  4M2K A;  5EIG A;  3RUY A;  4PIW A;  3EI9 A;  5HHY A;  4WP0 A;  3N4S A;  3TQX A;  2XH1 A;  4LW4 A;  2VMR A;  2QLR A;  2WKA A;  1P3W A;  2VMN A;  4OT8 A;  2PO3 A;  4ZAS A;  3LY1 A;  2D64 A;  2F8J A;  2DKB A;  3GET A;  4IX8 A;  4MKK A;  4WYD A;  2AY8 A;  4JEW A;  3AEO A;  2YRI A;  2CIN A;  1SZS A;  1U08 A;  3N7N A;  2W8T A;  1ASM A;  1X29 A;  4UQV A;  2GMU A;  4DQ6 A;  1RV4 A;  2W8J A;  4QGR A;  3AEL A;  4R2N A;  5G4J A;  4E3Q A;  3GZC A;  4F5G A;  2HUF A;  2EO5 A;  3UAK A;  1S08 A;  2JJE A;  1SZK A;  3CQ6 A;  3DZZ A;  1GD9 A;  2DGL A;  4WXG A;  4F5H A;  2EPJ A;  3FZ8 A;  2WK9 A;  3N4R A;  1ELU A;  5EUN A;  4CBR A;  5LHA A;  2VGS A;  3E9K A;  4RAE A;  2ZC0 A;  2CTZ A;  3K40 A;  1PG8 A;  2DR1 A;  1TAS A;  2VMX A;  4RIZ A;  1O61 A;  2VIA A;  3T32 A;  3ACZ A;  1BJW A;  3L44 A;  1VP4 A;  1B5O A;  2YCT A;  3NU7 A;  1TOJ A;  4P3M A;  1FG3 A;  4ISY A;  4ADE A;  1IVR A;  1AKB A;  4AO9 A;  1ECX A;  4F5F A;  4BA5 A;  2E7I A;  1J32 A;  1BQA A;  1YJS A;  1TOI A;  2R5C A;  3B1E A;  5EIG B;  2Q7W A;  3NRA A;  4UHM A;  4F4E A;  3R4T A;  1G4V A;  1ASA A;  4N0W A;  4A00 A;  3HL2 A;  3EI8 A;  4OTL A;  2CST A;  1JG8 A;  4UHO A;  1TOK A;  1OHW A;  5G09 A;  1WYV B;  4M2M A;  2FN6 A;  1BKG A;  3AEJ C;  4KXK A;  4AO4 A;  2CB1 A;  2CFB A;  4JF1 A;  3WY7 A;  4CBS A;  4EB7 A;  5EAA A;  1CZE A;  2HUU A;  4WLJ A;  4R8D A;  2Z1Z A;  1ZOD A;  4OCA A;  1ARI A;  3BC8 A;  3FFR A;  2BYJ A;  3LWS A;  3EUC A;  2Z9V A;  2YKU A;  2D7Z A;  2VGV A;  3MEB A;  3W1H A;  1D7U A;  2BWP A;  1O4S A;  2QB2 A;  3RBF A;  2BIE A;  2YCP A;  1ARH A;  2VMT A;  2DOU A;  1OXO A;  2D63 A;  3PDB A;  5EUE A;  5F8V A;  2ZJG A;  3H14 A;  1WST A;  4LNL A;  1M6S A;  2ZUK A;  5I92 A;  2VLH A;  2AEV A;  4N0B A;  3BN1 A;  1N2T A;  1QZ9 A;  1ARG A;  3G7Q A;  3AEJ A;  2R5C B;  4A6T A;  4UOY A;  4CVQ A;  4W1X A;  3A9Z A;  1WKH A;  1YIZ A;  2BIA A;  2WK8 A;  3NDN A;  4XJM A;  3FQ8 A;  3BV0 A;  1YNU A;  3ISL A;  1CL1 A;  3EZ1 A;  9AAT A;  1J04 A;  1EG5 A;  2EYQ A;  1ASB A;  1TAR A;  3ATH A;  4ZLV A;  4JE5 A;  3NYT A;  2QB3 A;  5AX8 A;  2QMA A;  3MAD A;  4Q31 A;  2O7C A;  2AY9 A;  4WYA A;  2AY7 A;  3DU4 A;  5IWQ A;  1UU2 A;  2GQN A;  1ASL A;  2W7K A;  4OMA A;  3TFU A;  3MKJ A;  3VK4 A;  5DJ9 A;  2D7Y A;  1ASF A;  3BCA A;  4FFC A;  4LW2 A;  1M7Y A;  1S06 A;  2X5D A;  1X2A A;  4JEY A;  3TFT A;  3QGU A;  1GEX A;  2Z61 A;  4PFF A;  3AEN B;  2W7E A;  2VLF A;  3LVJ A;  4XEW A;  4ZDO A;  3DXV A;  4A0F A;  2AY4 A;  2YKY A;  1G7W A;  2CY8 A;  4XJL A;  3DOD A;  1GC4 A;  1RVY A;  2CH1 A;  3COG A;  3DC1 A;  3GWP A;  1I41 A;  3PD6 A;  4GEB A;  5KTB A;  3E6G A;  1RV3 A;  1ORD A;  2VMZ A;  3FVX A;  2DGK A;  1Z7D A;  2VGU A;  4GSA A;  4XJP A;  3BWN A;  4OC9 A;  3ZZK A;  2CAN A;  3KGX A;  4OBU A;  4K05 A;  3PDB B;  3UWC A;  1AHY A;  1FG7 A;  3KKI A;  1DJ9 A;  3PIU A;  4MY5 A;  2YKV A;  1AHG A;  1AIB A;  3CAI A;  3A9Y A;  3GR9 A;  3NUI A;  4Q6R A;  4J8L A;  4WYE A;  4WB0 A;  1CQ6 A;  1DGE A;  3LV2 A;  3AEM C;  1BJO A;  1LW5 A;  4IY7 A;  4CXR A;  2NMP A;  3FDD A;  4ATP A;  2VMQ A;  4LNJ A;  1GC2 A;  3G8M A;  3K7Y A;  2AEU A;  3PJ0 A;  3FVS A;  4GE7 A;  4NOG A;  5C6U A;  4JEZ A;  2PB0 A;  2O0R A;  5HDM A;  3AAT A;  4A0G A;  3BCX A;  3HT4 A;  4R5Z A;  2HP1 A;  1M32 A;  3CBF A;  3JWB A;  4RJY A;  1EQB A;  3JW9 A;  2JG2 A;  1AIC A;  4R5F A;  3ZRR A;  1N8P A;  4RKD A;  1W7L A;  1V2F A;  2JJG A;  5DB5 A;  5FT8 A;  2ZY2 A;  3JZL A;  3WCN A;  2ZYJ A;  4B98 A;  2BWN A;  1X0M A;  1BJ4 A;  2AY1 A;  1MDZ A;  3D6K A;  2VGT A;  3OKS A;  3EI6 A;  1QIR A;  4M2J A;  2VGW A;  4WYF A;  4GE4 A;  1QJ5 A;  3AEM A;  4GE9 A;  3HDO A;  5J8Q A;  2FYF A;  1JS6 A;  3P1T A;  4MQR A;  3B46 A;  2HOY A;  1TOE A;  3PAA A;  4U2H A;  1C4K A;  2Z9U A;  1W3U A;  2BI3 A;  1IX6 A;  2C0R A;  2W7H A;  4W5K A;  4HVK A;  4ZAH A;  1OXP A;  3GSB A;  4WB0 B;  4Q76 A;  3N0L A;  1T3I A;  5D5S A;  1BJO B;  1KKJ A;  2QBT A;  3GZD C;  2FNU A;  4F5L A;  3B1C A;  1UKJ A;  4LNM A;  2Z9W A;  1KKP A;  3MAF A;  1B5P A;  2YHK A;  1M4N A;  1CQ7 A;  3EZS A;  5EFS A;  3QN6 A;  4OBV A;  4F5J A;  1KL1 A;  1M0P A;  1IAY A;  4B9B A;  1Y4I A;  2XBN A;  3FVU A;  3I5T A;  5G4I A;  5BJ4 A;  4MGR A;  1MLZ A;  2AY5 A;  4WYC A;  5EAV A;  4A72 A;  3HQT A;  1YOO A;  1ASD A;  3MBB A;  2GB3 A;  3WKR A;  3JTX A;  2OQX A;  2W7L A;  1H1C A;  2HZP A;  4PVF A;  1AIA A;  3UE8 A;  4A0H A;  3RQ1 A;  5TF5 A;  2W7G A;  3E2Z A;  3DXW A;  3FD0 A;  5BJ3 A;  3E2Y A;  3QM2 A;  4WD2 A;  3WLX A;  2Z20 A;  1AJS A;  1W7M A;  1XEY A;  3EI5 A;  3AEP A;  4IW7 A;  3GZD A;  1GC0 A;  2YCN A;  2W7J A;  2AY3 A;  3FTB A;  4JEX A;  1GEY A;  2CJG A;  2C81 A;  2R5E A;  3GJU A;  5JAY A;  1C7O A;  3WKS A;  1EJI A;  1Z3Z A;  2X8U A;  3PGY A;  1D7V A;  2O1B A;  2RFV A;  1M0Q A;  3PPL A;  2D65 A;  2VMV A;  1AY4 A;  2BIG A;  3BWO A;  2TPL A;  2QA3 A;  1I29 A;  2HP2 A;  3NUB A;  1BJN A;  4PFN A;  1UU1 A;  2BWO A;  3W1J A;  4XJO A;  4H63 Q;  1LW4 A;  1C7N A;  2ZY3 A;  2BI9 A;  3MAF B;  2W8U A;  1M0N A;  2W7D A;  3BWN C;  4Y0H A;  4ZM3 A;  3B1D A;  3PA9 A;  1CL2 A;  4WBT A;  2WB6 A;  3RI6 A;  5M4B A;  2V1P A;  1KMJ A;  4XQ2 A;  3NTJ A;  3TCM A;  3DRD A;  1LK9 A;  1FC4 A;  2Z67 A;  4AZJ A;  1B9H A;  1DGD A;  3WGC A;  3M5U A;  3WCO A;  2VI8 A;  4IYO A;  1WYT A;  1GCK A;  5M46 A;  4MQP A;  3R9A A;  1SFF A;  3HMU A;  1I48 A;  4DGT A;  1SZU A;  3NYS A;  3QBO A;  3N5M A;  3E2Z B;  3FCR A;  3A9X A;  4BMK A;  4ZDL A;  3WGB A;  1AJS B;  2FM1 A;  3ECD A;  1C9C A;  1UU0 A;  2R2N A;  3HLM A;  4W91 A;  4A6R A;  4ZSW A;  4EFF A;  3FQA A;  1ARS A;  2VIB A;  4F5I A;  3VK2 A;  4ITX A;  2Z1Y A;  4F5M A;  5FT4 A;  2HUI A;  1SF2 A;  4WYG A;  4K2M A;  4RLG A;  2E7J A;  4F5K A;  5LH9 A;  4JE5 D;  3I4J A;  1D7S A;  4U1T A;  3VK3 A;  2G6W A;  3HVY A;  1S09 A;  1MGV A;  3LVK A;  4ZDP A;  1GBN A;  2CJD A;  1AY8 A;  2YOB A;  2VYC A;  3ZRP A;  1KL2 A;  4ZSY A;  4ZM4 A;  2GSA A;  4JEV A;  3QHX A;  1OHY A;  3P6K A;  4TMR A;  2ORD A;  3BS8 A;  1SVV A;  4RJ0 A;  4WXF A;  4EMY A;  2ZY5 A;  3MC6 C;  3ELP A;  1B8G A;  3GBX A;  3ASB A;  1BQD A;  3VP6 A;  1AMQ A;  4TN4 A;  3F6T A;  3E2F A;  2OGE A;  4CXQ A;  1DJU A;  3LG0 A;  1GDE A;  2R0T A;  4ADB A;  1H0C A;  1AMA A;  4IYO B;  2C7T A;  5FT6 A;  1ASE A;  1XI9 A;  3EIB A;  1S0A A;  3RCH A;  1OHV A;  3FRK A;  3FSL A;  1TOG A;  1C7G A;  1ASN A;  5DJ1 A;  3F9T A;  1W7N A;  2VMY A;  1IUG A;  2EZ1 A;  1CS1 A;  3K28 A;  1ELQ A;  2JGT A;  2VMU A;  3PD6 B;  3AOV A;  5G0A A;  3G0T A;  4I8A A;  2DGM A;  2OKK A;  2E54 A;  3A8U X;  3MC6 A;  4A0R A;  1BT4 A;  1WKG A;  2W7I A;  1IX7 A;  3E77 A;  4Y0D A;  3KE3 A;  1MAP A;  1BW0 A;  3F0H A;  4BA4 A;  4Q75 A;  1LC7 A;  3PDX A;  1AKC A;  4ITG A;  2D61 A;  3WZF A;  3TAT A;  2AY6 A;  1WYV A;  1O62 A;  2BYL A;  3QI6 A;  1MAQ A;  4XAU A;  2Z9X A;  3FKD A;  4P7Y A;  4ADD A;  3JU7 A;  2W7M A;  2VMW A;  4GRX A;  1G4X A;  4UHN A;  5F9S A;  4IXO A;  2JJH A;  1O69 A;  4MKJ A;  4IXZ A;  1BS0 A;  4J5U A;  4RIT A;  4XK1 A;  1PMM A;  2CH2 A;  2FQ6 A;  4BQ0 A;  4AOA A;  3RCH B;  2BKW A;  4JF0 A;  1IAX A;  4TV7 A;  1AJR A;  3N75 A;  2VMS A;  3NYU A;  2YKX A;  1VJO A;  2BI5 A;  4A6U A;  1WYU A;  2VMO A;  3CQ4 A;  2HOX A;  3AV7 A;  1M0O A;  3I16 A;  3WX9 A;  4W8I A;  3B8X A;  1AHF A;  8AAT A;  2ZSL A;  5HXX A;  1DJE A;  2OAT A;  1TAT A;  3N4X A;  1QIT A;  3ELE A;  1AHX A;  2D66 A;  1MLY A;  1JS3 A;  1V2D A;  2AAT A;  1N31 A;  3EI7 A;  5FT5 A;  3FFH A;  3L8A A;  3FZ6 A;  2CJH A;  1B9I A;  1ASG A;  1TPL A;  4BHD A;  1YAA A;  3QPG A;  5E3K A;  3Q8N A;  2C44 A;  3OP7 A;  2DKJ A;  4FL0 A;  1AAW A;  2VMP A;  3FDB A;  2W8W A;  4DBC A;  4EB5 A;  1E5F A;  2YRR A;  1LS3 A;  1AKA A;  4RM1 A;  4E1O A;  4K2B A;  3NU8 A;  3FQ7 A;  1W23 A;  2HOZ A;  3USF A;  2EGY A;  2X5F A;  3IF2 A;  2BHX A;  3AEN A;  1VEF A;  1ART A;  1V2E A;  3FZ7 A;  3H9X A;  3DYD A;  3BCB A;  2A1V A;  2E7U A;  3NNK A;  3MAU A;  1YJZ A;  5EUD A;  3HBX A;  4LC3 A;  2ZP7 A;  1DTY A;  4WXB A;  5M4D A;  2X3L A;  3JWA A;  2OGA A;  4ATQ A;  1DFO A;  1IX8 A;  3RBL A;  1IBJ A;  3W1I A;  1WYU B;  2JIS A;  1CQ8 A;  4ZWV A;  1D7R A;  3IHJ A;  4Y0I A;  1AMS A;  3VOM A;  5DX5 A;  1ZC9 A;  2W8V A;  5D95 A;  1CZC A;  5E4Z A;  5G2Q A;  3LVL B;  2HOR A;  4WLH A;  4EU1 A;  1PMO A;  2VI9 A;  4ZWM A;  4OYT A;  1E5E A;  1I43 A;  2JJF A;  4K2I A;  3DR7 A;  4H51 A;  4KAM A;  2EZ2 A;  1AY5 A;  1RVU A;  1JF9 A;  3AOW A;  5E5I A;  3II0 A;  1LC5 A;  1AMR A;  1QGN A;  5G2P A;  2FKI A;  1OAT A;  1KAF A;  4L0O A;  2AY2 A;  3DR4 A;  3ZRQ A;  2KFP A;  4AZK A;  2WK7 A;  3ASA A;  3H7F A;  3ZZJ A;  4W1W A;  5EQC A;  2G7J A;  1QIS A;  2ZY4 A;  1D2F A;  3VAX A;  3EIA A;  4E3R A;  2OKJ A;  7AAT A;  4O6Z A;  4ADC A;  2BI2 A;  4KYO A;  2BI1 A;  1KMK A;  1YJY A;  1S07 A;  2FNI A;  1AX4 A;  1LKC A;  4E77 A;  5M49 A;  3CQ5 A;  4MSO A;  1GEW A;  2PB2 A;  1ZOB A; 
#chains in the Genus database with same CATH homology
 1MDO A;  3BB8 A;  1SPA A;  2QSR A;  4MQQ A;  2ZSM A;  1AHE A;  1B4X A;  1AAM A;  1ASC A;  1WYT B;  3LVM A;  2EH6 A;  4IXS A;  1V72 A;  3A2B A;  1PFF A;  2D5Y A;  4GDY A;  1C0N A;  2V0Y A;  2W7F A;  4AH3 A;  1CJ0 A;  1MDX A;  5K8B A;  1IJI A;  1YIY A;  3NX3 A;  4HF8 A;  2VGZ A;  1GC3 A;  3KGW A;  4W1V A;  4RKC A;  1QJ3 A;  1G7X A;  1LC8 A;  1DKA A;  1X28 A;  2GMS A;  4M2K A;  5EIG A;  3RUY A;  4PIW A;  3EI9 A;  5HHY A;  4WP0 A;  3N4S A;  3TQX A;  2XH1 A;  4LW4 A;  2VMR A;  2QLR A;  2WKA A;  1P3W A;  2VMN A;  4OT8 A;  2PO3 A;  4ZAS A;  3LY1 A;  2D64 A;  2F8J A;  2DKB A;  3GET A;  4IX8 A;  4MKK A;  4WYD A;  2AY8 A;  4JEW A;  3AEO A;  2YRI A;  2CIN A;  1SZS A;  1U08 A;  3N7N A;  2W8T A;  1ASM A;  1X29 A;  4UQV A;  2GMU A;  4DQ6 A;  1RV4 A;  2W8J A;  4QGR A;  3AEL A;  4R2N A;  5G4J A;  4E3Q A;  3GZC A;  4F5G A;  2HUF A;  2EO5 A;  3UAK A;  1S08 A;  2JJE A;  1SZK A;  3CQ6 A;  3DZZ A;  1GD9 A;  2DGL A;  4WXG A;  4F5H A;  2EPJ A;  3FZ8 A;  2WK9 A;  3N4R A;  1ELU A;  5EUN A;  4CBR A;  5LHA A;  2VGS A;  3E9K A;  4RAE A;  2ZC0 A;  2CTZ A;  3K40 A;  1PG8 A;  2DR1 A;  1TAS A;  2VMX A;  4RIZ A;  1O61 A;  2VIA A;  3T32 A;  3ACZ A;  1BJW A;  3L44 A;  1VP4 A;  1B5O A;  2YCT A;  3NU7 A;  1TOJ A;  4P3M A;  1FG3 A;  4ISY A;  4ADE A;  1IVR A;  1AKB A;  4AO9 A;  1ECX A;  4F5F A;  4BA5 A;  2E7I A;  1J32 A;  1BQA A;  1YJS A;  1TOI A;  2R5C A;  3B1E A;  5EIG B;  2Q7W A;  3NRA A;  4UHM A;  4F4E A;  3R4T A;  1G4V A;  1ASA A;  4N0W A;  4A00 A;  3HL2 A;  3EI8 A;  4OTL A;  2CST A;  1JG8 A;  4UHO A;  1TOK A;  1OHW A;  5G09 A;  1WYV B;  4M2M A;  2FN6 A;  1BKG A;  3AEJ C;  4KXK A;  4AO4 A;  2CB1 A;  2CFB A;  4JF1 A;  3WY7 A;  4CBS A;  4EB7 A;  5EAA A;  1CZE A;  2HUU A;  4WLJ A;  4R8D A;  2Z1Z A;  1ZOD A;  4OCA A;  1ARI A;  3BC8 A;  3FFR A;  2BYJ A;  3LWS A;  3EUC A;  2Z9V A;  2YKU A;  2D7Z A;  2VGV A;  3MEB A;  3W1H A;  1D7U A;  2BWP A;  1O4S A;  2QB2 A;  3RBF A;  2BIE A;  2YCP A;  1ARH A;  2VMT A;  2DOU A;  1OXO A;  2D63 A;  3PDB A;  5EUE A;  5F8V A;  2ZJG A;  3H14 A;  1WST A;  4LNL A;  1M6S A;  2ZUK A;  5I92 A;  2VLH A;  2AEV A;  4N0B A;  3BN1 A;  1N2T A;  1QZ9 A;  1ARG A;  3G7Q A;  3AEJ A;  2R5C B;  4A6T A;  4UOY A;  4CVQ A;  4W1X A;  3A9Z A;  1WKH A;  1YIZ A;  2BIA A;  2WK8 A;  3NDN A;  4XJM A;  3FQ8 A;  3BV0 A;  1YNU A;  3ISL A;  1CL1 A;  3EZ1 A;  9AAT A;  1J04 A;  1EG5 A;  2EYQ A;  1ASB A;  1TAR A;  3ATH A;  4ZLV A;  4JE5 A;  3NYT A;  2QB3 A;  5AX8 A;  2QMA A;  3MAD A;  4Q31 A;  2O7C A;  2AY9 A;  4WYA A;  2AY7 A;  3DU4 A;  5IWQ A;  1UU2 A;  2GQN A;  1ASL A;  2W7K A;  4OMA A;  3TFU A;  3MKJ A;  3VK4 A;  5DJ9 A;  2D7Y A;  1ASF A;  3BCA A;  4FFC A;  4LW2 A;  1M7Y A;  1S06 A;  2X5D A;  1X2A A;  4JEY A;  3TFT A;  3QGU A;  1GEX A;  2Z61 A;  4PFF A;  3AEN B;  2W7E A;  2VLF A;  3LVJ A;  4XEW A;  4ZDO A;  3DXV A;  4A0F A;  2AY4 A;  2YKY A;  1G7W A;  2CY8 A;  4XJL A;  3DOD A;  1GC4 A;  1RVY A;  2CH1 A;  3COG A;  3DC1 A;  3GWP A;  1I41 A;  3PD6 A;  4GEB A;  5KTB A;  3E6G A;  1RV3 A;  1ORD A;  2VMZ A;  3FVX A;  2DGK A;  1Z7D A;  2VGU A;  4GSA A;  4XJP A;  3BWN A;  4OC9 A;  3ZZK A;  2CAN A;  3KGX A;  4OBU A;  4K05 A;  3PDB B;  3UWC A;  1AHY A;  1FG7 A;  3KKI A;  1DJ9 A;  3PIU A;  4MY5 A;  2YKV A;  1AHG A;  1AIB A;  3CAI A;  3A9Y A;  3GR9 A;  3NUI A;  4Q6R A;  4J8L A;  4WYE A;  4WB0 A;  1CQ6 A;  1DGE A;  3LV2 A;  3AEM C;  1BJO A;  1LW5 A;  4IY7 A;  4CXR A;  2NMP A;  3FDD A;  4ATP A;  2VMQ A;  4LNJ A;  1GC2 A;  3G8M A;  3K7Y A;  2AEU A;  3PJ0 A;  3FVS A;  4GE7 A;  4NOG A;  5C6U A;  4JEZ A;  2PB0 A;  2O0R A;  5HDM A;  3AAT A;  4A0G A;  3BCX A;  3HT4 A;  4R5Z A;  2HP1 A;  1M32 A;  3CBF A;  3JWB A;  4RJY A;  1EQB A;  3JW9 A;  2JG2 A;  1AIC A;  4R5F A;  3ZRR A;  1N8P A;  4RKD A;  1W7L A;  1V2F A;  2JJG A;  5DB5 A;  5FT8 A;  2ZY2 A;  3JZL A;  3WCN A;  2ZYJ A;  4B98 A;  2BWN A;  1X0M A;  1BJ4 A;  2AY1 A;  1MDZ A;  3D6K A;  2VGT A;  3OKS A;  3EI6 A;  1QIR A;  4M2J A;  2VGW A;  4WYF A;  4GE4 A;  1QJ5 A;  3AEM A;  4GE9 A;  3HDO A;  5J8Q A;  2FYF A;  1JS6 A;  3P1T A;  4MQR A;  3B46 A;  2HOY A;  1TOE A;  3PAA A;  4U2H A;  1C4K A;  2Z9U A;  1W3U A;  2BI3 A;  1IX6 A;  2C0R A;  2W7H A;  4W5K A;  4HVK A;  4ZAH A;  1OXP A;  3GSB A;  4WB0 B;  4Q76 A;  3N0L A;  1T3I A;  5D5S A;  1BJO B;  1KKJ A;  2QBT A;  3GZD C;  2FNU A;  4F5L A;  3B1C A;  1UKJ A;  4LNM A;  2Z9W A;  1KKP A;  3MAF A;  1B5P A;  2YHK A;  1M4N A;  1CQ7 A;  3EZS A;  5EFS A;  3QN6 A;  4OBV A;  4F5J A;  1KL1 A;  1M0P A;  1IAY A;  4B9B A;  1Y4I A;  2XBN A;  3FVU A;  3I5T A;  5G4I A;  5BJ4 A;  4MGR A;  1MLZ A;  2AY5 A;  4WYC A;  5EAV A;  4A72 A;  3HQT A;  1YOO A;  1ASD A;  3MBB A;  2GB3 A;  3WKR A;  3JTX A;  2OQX A;  2W7L A;  1H1C A;  2HZP A;  4PVF A;  1AIA A;  3UE8 A;  4A0H A;  3RQ1 A;  5TF5 A;  2W7G A;  3E2Z A;  3DXW A;  3FD0 A;  5BJ3 A;  3E2Y A;  3QM2 A;  4WD2 A;  3WLX A;  2Z20 A;  1AJS A;  1W7M A;  1XEY A;  3EI5 A;  3AEP A;  4IW7 A;  3GZD A;  1GC0 A;  2YCN A;  2W7J A;  2AY3 A;  3FTB A;  4JEX A;  1GEY A;  2CJG A;  2C81 A;  2R5E A;  3GJU A;  5JAY A;  1C7O A;  3WKS A;  1EJI A;  1Z3Z A;  2X8U A;  3PGY A;  1D7V A;  2O1B A;  2RFV A;  1M0Q A;  3PPL A;  2D65 A;  2VMV A;  1AY4 A;  2BIG A;  3BWO A;  2TPL A;  2QA3 A;  1I29 A;  2HP2 A;  3NUB A;  1BJN A;  4PFN A;  1UU1 A;  2BWO A;  3W1J A;  4XJO A;  4H63 Q;  1LW4 A;  1C7N A;  2ZY3 A;  2BI9 A;  3MAF B;  2W8U A;  1M0N A;  2W7D A;  3BWN C;  4Y0H A;  4ZM3 A;  3B1D A;  3PA9 A;  1CL2 A;  4WBT A;  2WB6 A;  3RI6 A;  5M4B A;  2V1P A;  1KMJ A;  4XQ2 A;  3NTJ A;  3TCM A;  3DRD A;  1LK9 A;  1FC4 A;  2Z67 A;  4AZJ A;  1B9H A;  1DGD A;  3WGC A;  3M5U A;  3WCO A;  2VI8 A;  4IYO A;  1WYT A;  1GCK A;  5M46 A;  4MQP A;  3R9A A;  1SFF A;  3HMU A;  1I48 A;  4DGT A;  1SZU A;  3NYS A;  3QBO A;  3N5M A;  3E2Z B;  3FCR A;  3A9X A;  4BMK A;  4ZDL A;  3WGB A;  1AJS B;  2FM1 A;  3ECD A;  1C9C A;  1UU0 A;  2R2N A;  3HLM A;  4W91 A;  4A6R A;  4ZSW A;  4EFF A;  3FQA A;  1ARS A;  2VIB A;  4F5I A;  3VK2 A;  4ITX A;  2Z1Y A;  4F5M A;  5FT4 A;  2HUI A;  1SF2 A;  4WYG A;  4K2M A;  4RLG A;  2E7J A;  4F5K A;  5LH9 A;  4JE5 D;  3I4J A;  1D7S A;  4U1T A;  3VK3 A;  2G6W A;  3HVY A;  1S09 A;  1MGV A;  3LVK A;  4ZDP A;  1GBN A;  2CJD A;  1AY8 A;  2YOB A;  2VYC A;  3ZRP A;  1KL2 A;  4ZSY A;  4ZM4 A;  2GSA A;  4JEV A;  3QHX A;  1OHY A;  3P6K A;  4TMR A;  2ORD A;  3BS8 A;  1SVV A;  4RJ0 A;  4WXF A;  4EMY A;  2ZY5 A;  3MC6 C;  3ELP A;  1B8G A;  3GBX A;  3ASB A;  1BQD A;  3VP6 A;  1AMQ A;  4TN4 A;  3F6T A;  3E2F A;  2OGE A;  4CXQ A;  1DJU A;  3LG0 A;  1GDE A;  2R0T A;  4ADB A;  1H0C A;  1AMA A;  4IYO B;  2C7T A;  5FT6 A;  1ASE A;  1XI9 A;  3EIB A;  1S0A A;  3RCH A;  1OHV A;  3FRK A;  3FSL A;  1TOG A;  1C7G A;  1ASN A;  5DJ1 A;  3F9T A;  1W7N A;  2VMY A;  1IUG A;  2EZ1 A;  1CS1 A;  3K28 A;  1ELQ A;  2JGT A;  2VMU A;  3PD6 B;  3AOV A;  5G0A A;  3G0T A;  4I8A A;  2DGM A;  2OKK A;  2E54 A;  3A8U X;  3MC6 A;  4A0R A;  1BT4 A;  1WKG A;  2W7I A;  1IX7 A;  3E77 A;  4Y0D A;  3KE3 A;  1MAP A;  1BW0 A;  3F0H A;  4BA4 A;  4Q75 A;  1LC7 A;  3PDX A;  1AKC A;  4ITG A;  2D61 A;  3WZF A;  3TAT A;  2AY6 A;  1WYV A;  1O62 A;  2BYL A;  3QI6 A;  1MAQ A;  4XAU A;  2Z9X A;  3FKD A;  4P7Y A;  4ADD A;  3JU7 A;  2W7M A;  2VMW A;  4GRX A;  1G4X A;  4UHN A;  5F9S A;  4IXO A;  2JJH A;  1O69 A;  4MKJ A;  4IXZ A;  1BS0 A;  4J5U A;  4RIT A;  4XK1 A;  1PMM A;  2CH2 A;  2FQ6 A;  4BQ0 A;  4AOA A;  3RCH B;  2BKW A;  4JF0 A;  1IAX A;  4TV7 A;  1AJR A;  3N75 A;  2VMS A;  3NYU A;  2YKX A;  1VJO A;  2BI5 A;  4A6U A;  1WYU A;  2VMO A;  3CQ4 A;  2HOX A;  3AV7 A;  1M0O A;  3I16 A;  3WX9 A;  4W8I A;  3B8X A;  1AHF A;  8AAT A;  2ZSL A;  5HXX A;  1DJE A;  2OAT A;  1TAT A;  3N4X A;  1QIT A;  3ELE A;  1AHX A;  2D66 A;  1MLY A;  1JS3 A;  1V2D A;  2AAT A;  1N31 A;  3EI7 A;  5FT5 A;  3FFH A;  3L8A A;  3FZ6 A;  2CJH A;  1B9I A;  1ASG A;  1TPL A;  4BHD A;  1YAA A;  3QPG A;  5E3K A;  3Q8N A;  2C44 A;  3OP7 A;  2DKJ A;  4FL0 A;  1AAW A;  2VMP A;  3FDB A;  2W8W A;  4DBC A;  4EB5 A;  1E5F A;  2YRR A;  1LS3 A;  1AKA A;  4RM1 A;  4E1O A;  4K2B A;  3NU8 A;  3FQ7 A;  1W23 A;  2HOZ A;  3USF A;  2EGY A;  2X5F A;  3IF2 A;  2BHX A;  3AEN A;  1VEF A;  1ART A;  1V2E A;  3FZ7 A;  3H9X A;  3DYD A;  3BCB A;  2A1V A;  2E7U A;  3NNK A;  3MAU A;  1YJZ A;  5EUD A;  3HBX A;  4LC3 A;  2ZP7 A;  1DTY A;  4WXB A;  5M4D A;  2X3L A;  3JWA A;  2OGA A;  4ATQ A;  1DFO A;  1IX8 A;  3RBL A;  1IBJ A;  3W1I A;  1WYU B;  2JIS A;  1CQ8 A;  4ZWV A;  1D7R A;  3IHJ A;  4Y0I A;  1AMS A;  3VOM A;  5DX5 A;  1ZC9 A;  2W8V A;  5D95 A;  1CZC A;  5E4Z A;  5G2Q A;  3LVL B;  2HOR A;  4WLH A;  4EU1 A;  1PMO A;  2VI9 A;  4ZWM A;  4OYT A;  1E5E A;  1I43 A;  2JJF A;  4K2I A;  3DR7 A;  4H51 A;  4KAM A;  2EZ2 A;  1AY5 A;  1RVU A;  1JF9 A;  3AOW A;  5E5I A;  3II0 A;  1LC5 A;  1AMR A;  1QGN A;  5G2P A;  2FKI A;  1OAT A;  4L0O A;  2AY2 A;  3DR4 A;  3ZRQ A;  2KFP A;  4AZK A;  2WK7 A;  3ASA A;  3H7F A;  3ZZJ A;  4W1W A;  5EQC A;  2G7J A;  1QIS A;  2ZY4 A;  1D2F A;  3VAX A;  3EIA A;  4E3R A;  2OKJ A;  7AAT A;  4O6Z A;  4ADC A;  2BI2 A;  4KYO A;  2BI1 A;  1KMK A;  1YJY A;  1S07 A;  2FNI A;  1AX4 A;  1LKC A;  4E77 A;  5M49 A;  3CQ5 A;  4MSO A;  1GEW A;  2PB2 A;  1ZOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...