1B4XA

Aspartate aminotransferase from e. coli, c191s mutation, with bound maleate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGSCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title The role of residues outside the active site: structural basis for function of C191 mutants of Escherichia coli aspartate aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 119
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1998-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1b4xA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1b4xA01
2GB3A 5F9SA 3HDOA 3NYTA 5G4JA 3FRKA 1FC4A 4XAUA 3T32A 4JE5A 1M0QA 2Q7WA 1GC3A 4M2MA 4ZSYA 1LC8A 1V72A 2FNIA 2VMSA 2JISA 1GEWA 2VMPA 1IJIA 4XJPA 4WYEA 2XBNA 1SZUA 1UU0A 1AHGA 2Z1ZA 1MAPA 3A9ZA 3DODA 2W8VA 3DR4A 4JEWA 4KAMA 2QA3A 5DJ9A 2ZY5A 2CSTA 4ZDPA 1AHFA 3PJ0A 1ASDA 4LNMA 1GC4A 1Y4IA 3M5UA 4CBSA 5D95A 1X2AA 3KKIA 3EI5A 4KYOA 4BA5A 1J32A 4CBRA 2ZC0A 1PFFA 1KL2A 2D5YA 1JS6A 2YCNA 3BCXA 2CFBA 4ZASA 1VJOA 4LNJA 3ELPA 2VLFA 4H51A 2BIEA 5LH9A 2JJGA 2W8JA 2BKWA 3VP6A 1WYVA 1BQDA 3FZ6A 3RCHA 2DKJA 2X5FA 2VI9A 3K28A 1EJIA 1OXPA 3AEMC 2VGSA 3E6GA 4NOGA 4WYDA 1QJ5A 1Z7DA 4ADBA 9AATA 5G4IA 3TCMA 4IY7A 2R2NA 3TFTA 1M32A 2OGEA 3OP7A 3DU4A 2W7MA 2JJHA 3EI9A 5AX8A 2CH2A 2W7HA 2EZ2A 2Z61A 1CQ6A 3CQ6A 4B98A 4EFFA 1OATA 1BW0A 1SFFA 1LW4A 5M4DA 5HXXA 1MLYA 2C0RA 1Z3ZA 2YRRA 4R8DA 4RKDA 2YKVA 5FT6A 2BI1A 4ADDA 5DB5A 2AY1A 2CY8A 2AY4A 3NYSA 3PDXA 2BWOA 2YKXA 1MDXA 2Z9WA 3HT4A 4ISYA 1ARSA 4MQQA 4OBUA 4WBTA 1AKBA 4JEVA 4R5FA 1O61A 1DJ9A 4Y0HA 4RKCA 3GJUA 1CZCA 3W1IA 1WYUB 1ASLA 3MC6C 3ECDA 3PPLA 1S0AA 2R5CA 3FQAA 1KKJA 1S09A 1S06A 3AEMA 4GE7A 4IXZA 5IWQA 1KMKA 1ASAA 3WX9A 2RFVA 2HORA 2PB0A 4UHOA 5I92A 1PMMA 4Y0IA 2VMOA 1YJSA 3HQTA 1AJSA 3FFRA 3B46A 1WYTB 1EG5A 3I4JA 3JTXA 3JWAA 2XH1A 1CQ8A 3E2ZA 1V2DA 3EIBA 3BV0A 3NUBA 4AZKA 4FFCA 4K2IA 1QZ9A 1DKAA 1SZSA 4GEBA 2AEUA 1KKPA 3MADA 3FQ8A 4MKJA 3HMUA 3WCNA 4AH3A 2D65A 1B8GA 3WGCA 1ASFA 3NNKA 4OC9A 4MGRA 1LC5A 2QBTA 1I43A 3II0A 4MKKA 4GSAA 4F5LA 1DJUA 1GEXA 3MC6A 1AAMA 1JF9A 1M7YA 2EZ1A 3UAKA 4XQ2A 2VGVA 1YIYA 3PD6A 4Y0DA 4L0OA 1C7OA 4PFNA 1WKHA 2VMQA 5C6UA 1IBJA 4OBVA 4BMKA 2E7IA 1W23A 1MLZA 2BI5A 1B9HA 3NUIA 1GEYA 2HP2A 4ZWMA 5D5SA 1ZOBA 1H1CA 3G0TA 4WXFA 4A6TA 2ORDA 4W91A 5FT8A 3KE3A 3EIAA 4WB0A 2VMXA 3AOWA 4F5IA 2D66A 1TASA 3AELA 4WYGA 3RBFA 4F5FA 4B9BA 3JW9A 1QIRA 4W5KA 2CJHA 1B4XA 1E5FA 1SF2A 2W7EA 4UQVA 1N8PA 3VK2A 2Z9UA 1CL2A 5HDMA 2GMSA 1AMSA 2VGWA 2EPJA 4EMYA 1G7WA 3OKSA 1W3UA 1GDEA 2BIGA 2GQNA 3PA9A 4W1VA 4XJLA 1DGDA 3BWOA 1DGEA 3JU7A 2BYJA 3UWCA 3ZRPA 3B8XA 3H14A 3GZCA 3CBFA 2HUUA 3PIUA 4XEWA 3D6KA 1IX6A 1C7NA 1MDZA 1AY8A 4ATPA 1MAQA 1B9IA 1LK9A 4F5HA 2O7CA 4IYOA 5TF5A 3GBXA 1M0NA 2BI2A 2FYFA 1AJRA 1AMAA 3GWPA 2EH6A 2OGAA 3RBLA 3ZZKA 2O0RA 1LC7A 1VEFA 4JE5D 2GMUA 2AY6A 3FKDA 2ZP7A 1C4KA 1IAXA 4Q75A 4AOAA 1AAWA 1ASBA 4A72A 1JS3A 3WLXA 4CXQA 5F8VA 1AY4A 4TMRA 4LNLA 3NRAA 4XJMA 1TOJA 3ASAA 4GDYA 1BJNA 2JG2A 1ZC9A 4ZM4A 3F9TA 5E4ZA 4R2NA 3QM2A 1KMJA 3GZDC 3B1EA 3COGA 2YHKA 4J5UA 1PMOA 4RM1A 3RUYA 2YRIA 1BJWA 1X28A 2E7JA 3FCRA 3Q8NA 2CTZA 2Z1YA 2PO3A 2QMAA 3AV7A 3AENB 2OKKA 1ASCA 3BC8A 1WKGA 3EZSA 2BWPA 3I5TA 1PG8A 3WGBA 4PVFA 3VAXA 1C9CA 2Z9XA 2X8UA 1DFOA 3FVSA 3FVUA 4XJOA 5FT5A 2DGMA 1IUGA 4QGRA 4F5GA 4WYCA 4RLGA 2AY2A 1UU2A 4F5MA 3MAFB 2HUIA 1O4SA 3PAAA 2OQXA 5JAYA 3FTBA 2W7LA 1ECXA 1UKJA 1GBNA 4ZSWA 1V2FA 2YKYA 3QHXA 1VP4A 1G4XA 1ZODA 5G0AA 2WK7A 3E2YA 2QLRA 1CJ0A 3QN6A 4LW4A 1M0OA 2CINA 4AO4A 4U1TA 1CS1A 3MEBA 1I29A 3GZDA 3ACZA 1CL1A 3ATHA 1W7MA 2VIBA 3NU7A 1GC0A 4F5KA 2ZJGA 4HVKA 4ZDOA 4WLHA 3E2FA 3CQ4A 1KL1A 3QI6A 5EUEA 2HOXA 4A0FA 1M0PA 2VMUA 1TATA 3BS8A 4MQRA 1IVRA 4HF8A 3LVMA 3K7YA 1QJ3A 2O1BA 4RITA 3LG0A 5EUDA 1E5EA 3R4TA 2CH1A 1OHYA 4IXOA 2W8UA 3F6TA 1BJ4A 2WK9A 1XI9A 4RJYA 3MKJA 1ASNA 1BJOB 4N0WA 3PDBB 3CQ5A 3DXWA 3WKRA 2D63A 1OXOA 4A00A 3W1JA 3UE8A 3E9KA 3WZFA 3AEOA 4CVQA 1GD9A 2W7FA 5M4BA 1AMRA 3NX3A 4MSOA 1G7XA 2W7GA 1ARGA 2D64A 1ASGA 1JG8A 1WYTA 3A8UX 4MQPA 4CXRA 1BS0A 1J04A 2R0TA 2FM1A 4W1XA 4OT8A 4JEYA 4IX8A 1V2EA 1S07A 4A0HA 1AIAA 4PFFA 4I8AA 1N31A 4DQ6A 3JZLA 3DZZA 2W7IA 4DBCA 3MAUA 1AHYA 4OMAA 4E1OA 1I48A 5FT4A 3NYUA 4W1WA 4OTLA 1IX7A 2F8JA 3A9XA 2X3LA 4E77A 2PB2A 4ITGA 4IW7A 3DC1A 1ELQA 3G7QA 1LS3A 2AY3A 1AMQA 2DGKA 4GE9A 2HP1A 4U2HA 5EUNA 1G4VA 1ARIA 2AATA 1T3IA 3DR7A 3ELEA 5EFSA 3BWNC 1ARHA 2ZSLA 4WLJA 2FN6A 1H0CA 1YNUA 1DJEA 4IXSA 2VYCA 3R9AA 3MBBA 1BKGA 2OKJA 3CAIA 3NU8A 3AEPA 1D7UA 4GE4A 2V0YA 4ZLVA 2VIAA 1BT4A 2W8TA 3KGWA 3BN1A 2BHXA 3L44A 2YOBA 3WCOA 3ZRRA 4LW2A 2C81A 3ZZJA 1ELUA 5E5IA 2BIAA 3N0LA 2BWNA 2BI9A 4BQ0A 3EI8A 4FL0A 2C7TA 2ZY3A 2QB2A 2JGTA 3QPGA 3F0HA 1YIZA 1TARA 3W1HA 3HBXA 3LV2A 2VI8A 1RVUA 1AICA 3B1DA 4LC3A 1DTYA 1TPLA 4TV7A 8AATA 4ZWVA 2VLHA 4ADEA 2W7KA 2JJFA 5EIGA 4ZAHA 1WYVB 5DX5A 3RCHB 3BWNA 4A6RA 1OHVA 3FZ8A 2AY9A 2VMTA 4AO9A 3FDBA 5G2PA 2VGTA 4F4EA 2AY8A 2ZUKA 4E3QA 3TFUA 4RAEA 4ADCA 2AEVA 2Z9VA 2NMPA 2D7ZA 3NTJA 1C0NA 4Q76A 3TATA 2EGYA 3A2BA 4JF1A 1TOGA 3ASBA 2W7JA 1OHWA 4N0BA 1GC2A 2AY5A 3B1CA 3EUCA 3L8AA 2Z67A 4Q31A 3VOMA 1TOKA 1RVYA 1D7SA 1AIBA 2VGUA 4A0RA 5G09A 2FQ6A 3N75A 2EO5A 4W8IA 1FG7A 1YAAA 4TN4A 1SZKA 3ISLA 4WYAA 5EQCA 4J8LA 2YCPA 2YCTA 3AOVA 3I16A 3AEJC 3FD0A 3GETA 4OYTA 4JF0A 1ORDA 4K2MA 4WXGA 4DGTA 4A6UA 1W7NA 4F5JA 3G8MA 3HL2A 1XEYA 3HLMA 3JWBA 7AATA 2R5CB 3AENA 1ARTA 3BB8A 4EU1A 2CB1A 3LY1A 4Q6RA 3FZ7A 4WD2A 1EQBA 1LW5A 1RV3A 1YOOA 2AY7A 2DOUA 2W8WA 3FFHA 3N5MA 4OCAA 4E3RA 1YJYA 3FQ7A 3KGXA 4O6ZA 1AJSB 2FNUA 2VMNA 3LVKA 4XK1A 3P6KA 1D7VA 1C7GA 3IF2A 3MAFA 1D7RA 3BCAA 1IAYA 3E2ZB 4M2JA 4ZM3A 2ZY2A 5K8BA 3QBOA 1AX4A 1O62A 4ZDLA 1X0MA 4K2BA 5DJ1A 4M2KA 4BA4A 1B5PA 1ASEA 2DR1A 1QGNA 1P3WA 3LWSA 3FDDA 3VK4A 1WYUA 4EB7A 3E77A 3EI7A 3BCBA 2DKBA 4GRXA 2VMWA 3A9YA 4RJ0A 2E54A 4R5ZA 3ZRQA 4PIWA 1AHEA 4WYFA 3AEJA 3DYDA 2CJDA 2CANA 5G2QA 3RQ1A 3TQXA 4EB5A 3GR9A 4P3MA 4ATQA 1UU1A 4UHNA 3WKSA 1I41A 3LVJA 3PD6B 2VGZA 2R5EA 1N2TA 1MGVA 1X29A 5HHYA 1BQAA 1IX8A 2E7UA 2QB3A 2BYLA 1FG3A 2VMRA 2YKUA 3DRDA 3QGUA 1ASMA 1M6SA 1SVVA 2V1PA 2VMYA 5EIGB 1AKAA 2W7DA 1W7LA 2G6WA 1BJOA 1LKCA 3FVXA 2HZPA 3FSLA 3P1TA 4UOYA 2TPLA 3AATA 2CJGA 3PDBA 3H7FA 1WSTA 2X5DA 2WK8A 5EAVA 4AZJA 1TOIA 1RV4A 1O69A 4WB0B 5E3KA 4ITXA 1TOEA 5J8QA 5BJ4A 1D2FA 1AHXA 1AY5A 4P7YA 4BHDA 4JEZA 1CZEA 2C44A 1B5OA 1GCKA 2ZSMA 1SPAA 2OATA 3K40A 2VMVA 2GSAA 4KXKA 3LVLB 3GSBA 2JJEA 3VK3A 3EI6A 3PGYA 1MDOA 3RI6A 5BJ3A 2D61A 2WKAA 5LHAA 2HUFA 2DGLA 3DXVA 4JEXA 2ZY4A 1QISA 1YJZA 4WXBA 3HVYA 4RIZA 5M49A 2Z20A 1U08A 4IYOB 4UHMA 2HOZA 4WP0A 2D7YA 3IHJA 1QITA 1AKCA 2VMZA 5EAAA 4A0GA 2ZYJA 1M4NA 3WY7A 3EZ1A 2HOYA 3NDNA 4MY5A 5M46A 3USFA 2BI3A 1S08A 1CQ7A
chains in the Genus database with same CATH superfamily
2GB3A 5F9SA 3HDOA 3NYTA 5G4JA 3FRKA 1FC4A 4XAUA 3T32A 4JE5A 1M0QA 2Q7WA 1GC3A 4M2MA 4ZSYA 1LC8A 1V72A 2FNIA 2VMSA 2JISA 1GEWA 2VMPA 1IJIA 4XJPA 4WYEA 2XBNA 1SZUA 1UU0A 1AHGA 2Z1ZA 1MAPA 3A9ZA 3DODA 2W8VA 3DR4A 4JEWA 4KAMA 2QA3A 5DJ9A 2ZY5A 2CSTA 4ZDPA 1AHFA 3PJ0A 1ASDA 4LNMA 1GC4A 1Y4IA 3M5UA 4CBSA 5D95A 1X2AA 3KKIA 3EI5A 4KYOA 4BA5A 1J32A 4CBRA 2ZC0A 1PFFA 1KL2A 2D5YA 1JS6A 2YCNA 3BCXA 2CFBA 4ZASA 1VJOA 4LNJA 3ELPA 2VLFA 4H51A 2BIEA 5LH9A 2JJGA 2W8JA 2BKWA 3VP6A 1WYVA 1BQDA 3FZ6A 3RCHA 2DKJA 2X5FA 2VI9A 3K28A 1EJIA 1OXPA 3AEMC 2VGSA 3E6GA 4NOGA 4WYDA 1QJ5A 1Z7DA 4ADBA 9AATA 5G4IA 3TCMA 4IY7A 2R2NA 3TFTA 1M32A 2OGEA 3OP7A 3DU4A 2W7MA 2JJHA 3EI9A 5AX8A 2CH2A 2W7HA 2EZ2A 2Z61A 1CQ6A 3CQ6A 4B98A 4EFFA 1OATA 1BW0A 1SFFA 1LW4A 5M4DA 5HXXA 1MLYA 2C0RA 1Z3ZA 2YRRA 4R8DA 4RKDA 2YKVA 5FT6A 2BI1A 4ADDA 5DB5A 2AY1A 2CY8A 2AY4A 3NYSA 3PDXA 2BWOA 2YKXA 1MDXA 2Z9WA 3HT4A 4ISYA 1ARSA 4MQQA 4OBUA 4WBTA 1AKBA 4JEVA 4R5FA 1O61A 1DJ9A 4Y0HA 4RKCA 3GJUA 1CZCA 3W1IA 1WYUB 1ASLA 3MC6C 3ECDA 3PPLA 1S0AA 2R5CA 3FQAA 1KKJA 1S09A 1S06A 3AEMA 4GE7A 4IXZA 5IWQA 1KMKA 1ASAA 3WX9A 2RFVA 2HORA 2PB0A 4UHOA 5I92A 1PMMA 4Y0IA 2VMOA 1YJSA 3HQTA 1AJSA 3FFRA 3B46A 1WYTB 1EG5A 3I4JA 3JTXA 3JWAA 2XH1A 1CQ8A 3E2ZA 1V2DA 3EIBA 3BV0A 3NUBA 4AZKA 4FFCA 4K2IA 1QZ9A 1DKAA 1SZSA 4GEBA 2AEUA 1KKPA 3MADA 3FQ8A 4MKJA 3HMUA 3WCNA 4AH3A 2D65A 1B8GA 3WGCA 1ASFA 3NNKA 4OC9A 4MGRA 1LC5A 2QBTA 1I43A 3II0A 4MKKA 4GSAA 4F5LA 1DJUA 1GEXA 3MC6A 1AAMA 1JF9A 1M7YA 2EZ1A 3UAKA 4XQ2A 2A1VA 2VGVA 1YIYA 3PD6A 4Y0DA 4L0OA 1C7OA 4PFNA 1WKHA 2VMQA 5C6UA 1IBJA 4OBVA 4BMKA 2E7IA 1W23A 1MLZA 2BI5A 1B9HA 3NUIA 1GEYA 2HP2A 4ZWMA 5D5SA 1ZOBA 1H1CA 3G0TA 1KAFA 4WXFA 4A6TA 2ORDA 4W91A 5FT8A 3KE3A 3EIAA 4WB0A 2VMXA 3AOWA 4F5IA 2D66A 1TASA 3AELA 4WYGA 3RBFA 4F5FA 4B9BA 3JW9A 1QIRA 4W5KA 2CJHA 1B4XA 1E5FA 1SF2A 2W7EA 4UQVA 1N8PA 3VK2A 2Z9UA 1CL2A 5HDMA 2GMSA 1AMSA 2VGWA 2EPJA 4EMYA 1G7WA 3OKSA 1W3UA 1GDEA 2BIGA 2GQNA 3PA9A 4W1VA 4XJLA 1DGDA 3BWOA 1DGEA 3JU7A 2BYJA 3UWCA 3ZRPA 3B8XA 3H14A 3GZCA 3CBFA 2HUUA 3PIUA 4XEWA 3D6KA 1IX6A 1C7NA 1MDZA 1AY8A 4ATPA 1MAQA 1B9IA 1LK9A 4F5HA 2O7CA 4IYOA 5TF5A 3GBXA 1M0NA 2BI2A 2FYFA 1AJRA 1AMAA 3GWPA 2EH6A 2OGAA 3N4RA 3RBLA 3ZZKA 2O0RA 1LC7A 1VEFA 4JE5D 2GMUA 2AY6A 3FKDA 2ZP7A 1C4KA 1IAXA 4Q75A 4AOAA 1AAWA 1ASBA 4A72A 1JS3A 3WLXA 4CXQA 5F8VA 1AY4A 4TMRA 4LNLA 3NRAA 2EYQA 4XJMA 1TOJA 3ASAA 4GDYA 1BJNA 2JG2A 1ZC9A 4ZM4A 3F9TA 5E4ZA 4R2NA 3QM2A 1KMJA 3GZDC 3B1EA 3COGA 2YHKA 4J5UA 1PMOA 4RM1A 3RUYA 2YRIA 1BJWA 1X28A 2E7JA 3FCRA 3Q8NA 2CTZA 2Z1YA 2PO3A 2QMAA 3AV7A 3AENB 2OKKA 1ASCA 3BC8A 1WKGA 3EZSA 2BWPA 3I5TA 1PG8A 3WGBA 4PVFA 3VAXA 1C9CA 2Z9XA 2X8UA 1DFOA 3FVSA 3FVUA 4XJOA 5FT5A 2DGMA 1IUGA 4QGRA 4F5GA 4WYCA 4RLGA 2AY2A 1UU2A 4F5MA 3MAFB 2HUIA 1O4SA 3PAAA 2OQXA 5JAYA 3FTBA 2W7LA 1ECXA 1UKJA 1GBNA 4ZSWA 1V2FA 2YKYA 3QHXA 1VP4A 1G4XA 1ZODA 5G0AA 2WK7A 3E2YA 2QLRA 1CJ0A 3QN6A 4LW4A 1M0OA 2CINA 4AO4A 4U1TA 1CS1A 3MEBA 1I29A 3GZDA 3ACZA 1CL1A 3ATHA 1W7MA 2VIBA 3NU7A 1GC0A 4F5KA 2ZJGA 4HVKA 4ZDOA 4WLHA 3E2FA 3CQ4A 1KL1A 3QI6A 5EUEA 2HOXA 4A0FA 1M0PA 2VMUA 1TATA 3BS8A 4MQRA 1IVRA 4HF8A 3LVMA 3K7YA 1QJ3A 2O1BA 4RITA 3LG0A 5EUDA 1E5EA 3R4TA 2CH1A 5KTBA 1OHYA 4IXOA 2W8UA 3F6TA 1BJ4A 2WK9A 1XI9A 4RJYA 3MKJA 1ASNA 1BJOB 4N0WA 3PDBB 3CQ5A 3DXWA 3WKRA 2D63A 1OXOA 4A00A 3W1JA 3UE8A 3E9KA 3WZFA 3AEOA 4CVQA 1GD9A 2W7FA 5M4BA 1AMRA 3NX3A 4MSOA 1G7XA 2W7GA 1ARGA 2D64A 1ASGA 1JG8A 1WYTA 3A8UX 4MQPA 4CXRA 1BS0A 1J04A 2R0TA 2FM1A 4W1XA 4OT8A 4JEYA 4IX8A 2KFPA 4H63Q 1V2EA 1S07A 4A0HA 1AIAA 4PFFA 4I8AA 1N31A 4DQ6A 3JZLA 3DZZA 2W7IA 4DBCA 3MAUA 1AHYA 4OMAA 4E1OA 1I48A 5FT4A 3NYUA 4W1WA 4OTLA 1IX7A 2F8JA 3A9XA 2X3LA 4E77A 2PB2A 4ITGA 4IW7A 3DC1A 1ELQA 3G7QA 1LS3A 2AY3A 1AMQA 2DGKA 4GE9A 2HP1A 4U2HA 5EUNA 1G4VA 1ARIA 2AATA 1T3IA 3DR7A 3ELEA 5EFSA 3BWNC 1ARHA 2ZSLA 4WLJA 2FN6A 1H0CA 1YNUA 1DJEA 4IXSA 2VYCA 3R9AA 3MBBA 1BKGA 2OKJA 3CAIA 3NU8A 3AEPA 1D7UA 4GE4A 2V0YA 4ZLVA 2VIAA 1BT4A 2W8TA 3KGWA 3BN1A 2BHXA 3L44A 2YOBA 3WCOA 3ZRRA 4LW2A 2C81A 3ZZJA 1ELUA 4K05A 5E5IA 2BIAA 3N0LA 2BWNA 2BI9A 4BQ0A 3EI8A 4FL0A 2C7TA 2ZY3A 2QB2A 2JGTA 3QPGA 3F0HA 1YIZA 1TARA 3W1HA 3HBXA 3LV2A 2VI8A 1RVUA 1AICA 3B1DA 4LC3A 1DTYA 1TPLA 4TV7A 8AATA 4ZWVA 2VLHA 4ADEA 2W7KA 2JJFA 5EIGA 4ZAHA 1WYVB 5DX5A 3RCHB 3BWNA 4A6RA 1OHVA 3FZ8A 2AY9A 2VMTA 4AO9A 3FDBA 5G2PA 2VGTA 4F4EA 2AY8A 2ZUKA 4E3QA 3TFUA 4RAEA 4ADCA 3N4XA 2AEVA 2Z9VA 2NMPA 2D7ZA 3NTJA 1C0NA 4Q76A 3TATA 2EGYA 3A2BA 4JF1A 1TOGA 3ASBA 2W7JA 1OHWA 4N0BA 1GC2A 2AY5A 3B1CA 3EUCA 3L8AA 2Z67A 4Q31A 3VOMA 2WB6A 1TOKA 1RVYA 1D7SA 1AIBA 2VGUA 4A0RA 5G09A 2FQ6A 3N75A 2EO5A 4W8IA 1FG7A 1YAAA 4TN4A 1SZKA 3ISLA 4WYAA 5EQCA 4J8LA 2YCPA 2YCTA 3AOVA 3I16A 3AEJC 3FD0A 3GETA 4OYTA 4JF0A 1ORDA 4K2MA 4WXGA 4DGTA 4A6UA 1W7NA 4F5JA 3N7NA 3G8MA 3HL2A 1XEYA 3HLMA 3JWBA 7AATA 2R5CB 3AENA 1ARTA 3BB8A 4EU1A 2CB1A 3LY1A 4Q6RA 3FZ7A 4WD2A 1EQBA 1LW5A 1RV3A 1YOOA 2AY7A 2DOUA 2W8WA 3FFHA 3N5MA 4OCAA 4E3RA 1YJYA 3FQ7A 3KGXA 4O6ZA 1AJSB 2FNUA 2VMNA 3LVKA 4XK1A 3P6KA 1D7VA 1C7GA 3IF2A 3MAFA 1D7RA 3BCAA 1IAYA 3E2ZB 4M2JA 4ZM3A 2ZY2A 5K8BA 3QBOA 1AX4A 1O62A 4ZDLA 1X0MA 4K2BA 5DJ1A 4M2KA 4BA4A 2FKIA 3N4SA 1B5PA 1ASEA 2DR1A 1QGNA 1P3WA 3LWSA 3FDDA 3VK4A 1WYUA 4EB7A 3E77A 3EI7A 3BCBA 2DKBA 4GRXA 2VMWA 3A9YA 4RJ0A 2E54A 4R5ZA 3ZRQA 4PIWA 1AHEA 4WYFA 3AEJA 2G7JA 3DYDA 2CJDA 2CANA 5G2QA 3RQ1A 3TQXA 4EB5A 3GR9A 4P3MA 4ATQA 1UU1A 4UHNA 3WKSA 1I41A 3LVJA 3PD6B 2VGZA 3H9XA 2R5EA 1N2TA 1MGVA 1X29A 5HHYA 1BQAA 1IX8A 2E7UA 2QB3A 2BYLA 1FG3A 2VMRA 2YKUA 3DRDA 3QGUA 1ASMA 1M6SA 1SVVA 2V1PA 2VMYA 5EIGB 1AKAA 2W7DA 1W7LA 2G6WA 1BJOA 1LKCA 3FVXA 2HZPA 3FSLA 3P1TA 4UOYA 2TPLA 3AATA 2CJGA 3PDBA 3H7FA 1WSTA 2X5DA 2WK8A 5EAVA 4AZJA 1TOIA 1RV4A 1O69A 4WB0B 5E3KA 4ITXA 1TOEA 2QSRA 5J8QA 5BJ4A 1D2FA 1AHXA 1AY5A 4P7YA 4BHDA 4JEZA 1CZEA 2C44A 1B5OA 1GCKA 2ZSMA 1SPAA 2OATA 3K40A 2VMVA 2GSAA 4KXKA 3LVLB 3GSBA 2JJEA 3VK3A 3EI6A 3PGYA 1MDOA 3RI6A 5BJ3A 2D61A 2WKAA 5LHAA 2HUFA 2DGLA 3DXVA 4JEXA 2ZY4A 1QISA 1YJZA 4WXBA 3HVYA 4RIZA 5M49A 2Z20A 1U08A 4IYOB 4UHMA 2HOZA 4WP0A 2D7YA 3IHJA 1QITA 1AKCA 2VMZA 5EAAA 4A0GA 2ZYJA 1M4NA 3WY7A 3EZ1A 2HOYA 3NDNA 4MY5A 5M46A 3USFA 2BI3A 1S08A 1CQ7A
chains in the Genus database with same CATH topology
2GB3A 5F9SA 3HDOA 3NYTA 5G4JA 3FRKA 1FC4A 4XAUA 3T32A 4JE5A 1M0QA 2Q7WA 1GC3A 4M2MA 4ZSYA 1LC8A 1V72A 2FNIA 2VMSA 2JISA 1GEWA 2VMPA 1IJIA 4XJPA 4WYEA 2XBNA 1SZUA 1UU0A 1AHGA 2Z1ZA 1MAPA 3A9ZA 3DODA 2W8VA 3DR4A 4JEWA 4KAMA 2QA3A 5DJ9A 2ZY5A 2CSTA 4ZDPA 1AHFA 3PJ0A 1ASDA 4LNMA 1GC4A 1Y4IA 3M5UA 4CBSA 5D95A 1X2AA 3KKIA 3EI5A 4KYOA 4BA5A 1J32A 4CBRA 2ZC0A 1PFFA 1KL2A 2D5YA 1JS6A 2YCNA 3BCXA 2CFBA 4ZASA 1VJOA 4LNJA 3ELPA 2VLFA 4H51A 2BIEA 5LH9A 2JJGA 2W8JA 2BKWA 3VP6A 1WYVA 1BQDA 3FZ6A 3RCHA 2DKJA 2X5FA 2VI9A 3K28A 1EJIA 1OXPA 3AEMC 2VGSA 3E6GA 4NOGA 4WYDA 1QJ5A 1Z7DA 4ADBA 9AATA 5G4IA 3TCMA 4IY7A 2R2NA 3TFTA 1M32A 2OGEA 3OP7A 3DU4A 2W7MA 2JJHA 3EI9A 5AX8A 2CH2A 2W7HA 2EZ2A 2Z61A 1CQ6A 3CQ6A 4B98A 4EFFA 1OATA 1BW0A 1SFFA 1LW4A 5M4DA 5HXXA 1MLYA 2C0RA 1Z3ZA 2YRRA 4R8DA 4RKDA 2YKVA 5FT6A 2BI1A 4ADDA 5DB5A 2AY1A 2CY8A 2AY4A 3NYSA 3PDXA 2BWOA 2YKXA 1MDXA 2Z9WA 3HT4A 4ISYA 1ARSA 4MQQA 4OBUA 4WBTA 1AKBA 4JEVA 4R5FA 1O61A 1DJ9A 4Y0HA 4RKCA 3GJUA 1CZCA 3W1IA 1WYUB 1ASLA 3MC6C 3ECDA 3PPLA 1S0AA 2R5CA 3FQAA 1KKJA 1S09A 1S06A 3AEMA 4GE7A 4IXZA 5IWQA 1KMKA 1ASAA 3WX9A 2RFVA 2HORA 2PB0A 4UHOA 5I92A 1PMMA 4Y0IA 2VMOA 1YJSA 3HQTA 1AJSA 3FFRA 3B46A 1WYTB 1EG5A 3I4JA 3JTXA 3JWAA 2XH1A 1CQ8A 3E2ZA 1V2DA 3EIBA 3BV0A 3NUBA 4AZKA 4FFCA 4K2IA 1QZ9A 1DKAA 1SZSA 4GEBA 2AEUA 1KKPA 3MADA 3FQ8A 4MKJA 3HMUA 3WCNA 4AH3A 2D65A 1B8GA 3WGCA 1ASFA 3NNKA 4OC9A 4MGRA 1LC5A 2QBTA 1I43A 3II0A 4MKKA 4GSAA 4F5LA 1DJUA 1GEXA 3MC6A 1AAMA 1JF9A 1M7YA 2EZ1A 3UAKA 4XQ2A 2A1VA 2VGVA 1YIYA 3PD6A 4Y0DA 4L0OA 1C7OA 4PFNA 1WKHA 2VMQA 5C6UA 1IBJA 4OBVA 4BMKA 2E7IA 1W23A 1MLZA 2BI5A 1B9HA 3NUIA 1GEYA 2HP2A 4ZWMA 5D5SA 1ZOBA 1H1CA 3G0TA 4WXFA 4A6TA 2ORDA 4W91A 5FT8A 3KE3A 3EIAA 4WB0A 2VMXA 3AOWA 4F5IA 2D66A 1TASA 3AELA 4WYGA 3RBFA 4F5FA 4B9BA 3JW9A 1QIRA 4W5KA 2CJHA 1B4XA 1E5FA 1SF2A 2W7EA 4UQVA 1N8PA 3VK2A 2Z9UA 1CL2A 5HDMA 2GMSA 1AMSA 2VGWA 2EPJA 4EMYA 1G7WA 3OKSA 1W3UA 1GDEA 2BIGA 2GQNA 3PA9A 4W1VA 4XJLA 1DGDA 3BWOA 1DGEA 3JU7A 2BYJA 3UWCA 3ZRPA 3B8XA 3H14A 3GZCA 3CBFA 2HUUA 3PIUA 4XEWA 3D6KA 1IX6A 1C7NA 1MDZA 1AY8A 4ATPA 1MAQA 1B9IA 1LK9A 4F5HA 2O7CA 4IYOA 5TF5A 3GBXA 1M0NA 2BI2A 2FYFA 1AJRA 1AMAA 3GWPA 2EH6A 2OGAA 3N4RA 3RBLA 3ZZKA 2O0RA 1LC7A 1VEFA 4JE5D 2GMUA 2AY6A 3FKDA 2ZP7A 1C4KA 1IAXA 4Q75A 4AOAA 1AAWA 1ASBA 4A72A 1JS3A 3WLXA 4CXQA 5F8VA 1AY4A 4TMRA 4LNLA 3NRAA 2EYQA 4XJMA 1TOJA 3ASAA 4GDYA 1BJNA 2JG2A 1ZC9A 4ZM4A 3F9TA 5E4ZA 4R2NA 3QM2A 1KMJA 3GZDC 3B1EA 3COGA 2YHKA 4J5UA 1PMOA 4RM1A 3RUYA 2YRIA 1BJWA 1X28A 2E7JA 3FCRA 3Q8NA 2CTZA 2Z1YA 2PO3A 2QMAA 3AV7A 3AENB 2OKKA 1ASCA 3BC8A 1WKGA 3EZSA 2BWPA 3I5TA 1PG8A 3WGBA 4PVFA 3VAXA 1C9CA 2Z9XA 2X8UA 1DFOA 3FVSA 3FVUA 4XJOA 5FT5A 2DGMA 1IUGA 4QGRA 4F5GA 4WYCA 4RLGA 2AY2A 1UU2A 4F5MA 3MAFB 2HUIA 1O4SA 3PAAA 2OQXA 5JAYA 3FTBA 2W7LA 1ECXA 1UKJA 1GBNA 4ZSWA 1V2FA 2YKYA 3QHXA 1VP4A 1G4XA 1ZODA 5G0AA 2WK7A 3E2YA 2QLRA 1CJ0A 3QN6A 4LW4A 1M0OA 2CINA 4AO4A 4U1TA 1CS1A 3MEBA 1I29A 3GZDA 3ACZA 1CL1A 3ATHA 1W7MA 2VIBA 3NU7A 1GC0A 4F5KA 2ZJGA 4HVKA 4ZDOA 4WLHA 3E2FA 3CQ4A 1KL1A 3QI6A 5EUEA 2HOXA 4A0FA 1M0PA 2VMUA 1TATA 3BS8A 4MQRA 1IVRA 4HF8A 3LVMA 3K7YA 1QJ3A 2O1BA 4RITA 3LG0A 5EUDA 1E5EA 3R4TA 2CH1A 5KTBA 1OHYA 4IXOA 2W8UA 3F6TA 1BJ4A 2WK9A 1XI9A 4RJYA 3MKJA 1ASNA 1BJOB 4N0WA 3PDBB 3CQ5A 3DXWA 3WKRA 2D63A 1OXOA 4A00A 3W1JA 3UE8A 3E9KA 3WZFA 3AEOA 4CVQA 1GD9A 2W7FA 5M4BA 1AMRA 3NX3A 4MSOA 1G7XA 2W7GA 1ARGA 2D64A 1ASGA 1JG8A 1WYTA 3A8UX 4MQPA 4CXRA 1BS0A 1J04A 2R0TA 2FM1A 4W1XA 4OT8A 4JEYA 4IX8A 2KFPA 4H63Q 1V2EA 1S07A 4A0HA 1AIAA 4PFFA 4I8AA 1N31A 4DQ6A 3JZLA 3DZZA 2W7IA 4DBCA 3MAUA 1AHYA 4OMAA 4E1OA 1I48A 5FT4A 3NYUA 4W1WA 4OTLA 1IX7A 2F8JA 3A9XA 2X3LA 4E77A 2PB2A 4ITGA 4IW7A 3DC1A 1ELQA 3G7QA 1LS3A 2AY3A 1AMQA 2DGKA 4GE9A 2HP1A 4U2HA 5EUNA 1G4VA 1ARIA 2AATA 1T3IA 3DR7A 3ELEA 5EFSA 3BWNC 1ARHA 2ZSLA 4WLJA 2FN6A 1H0CA 1YNUA 1DJEA 4IXSA 2VYCA 3R9AA 3MBBA 1BKGA 2OKJA 3CAIA 3NU8A 3AEPA 1D7UA 4GE4A 2V0YA 4ZLVA 2VIAA 1BT4A 2W8TA 3KGWA 3BN1A 2BHXA 3L44A 2YOBA 3WCOA 3ZRRA 4LW2A 2C81A 3ZZJA 1ELUA 4K05A 5E5IA 2BIAA 3N0LA 2BWNA 2BI9A 4BQ0A 3EI8A 4FL0A 2C7TA 2ZY3A 2QB2A 2JGTA 3QPGA 3F0HA 1YIZA 1TARA 3W1HA 3HBXA 3LV2A 2VI8A 1RVUA 1AICA 3B1DA 4LC3A 1DTYA 1TPLA 4TV7A 8AATA 4ZWVA 2VLHA 4ADEA 2W7KA 2JJFA 5EIGA 4ZAHA 1WYVB 5DX5A 3RCHB 3BWNA 4A6RA 1OHVA 3FZ8A 2AY9A 2VMTA 4AO9A 3FDBA 5G2PA 2VGTA 4F4EA 2AY8A 2ZUKA 4E3QA 3TFUA 4RAEA 4ADCA 3N4XA 2AEVA 2Z9VA 2NMPA 2D7ZA 3NTJA 1C0NA 4Q76A 3TATA 2EGYA 3A2BA 4JF1A 1TOGA 3ASBA 2W7JA 1OHWA 4N0BA 1GC2A 2AY5A 3B1CA 3EUCA 3L8AA 2Z67A 4Q31A 3VOMA 2WB6A 1TOKA 1RVYA 1D7SA 1AIBA 2VGUA 4A0RA 5G09A 2FQ6A 3N75A 2EO5A 4W8IA 1FG7A 1YAAA 4TN4A 1SZKA 3ISLA 4WYAA 5EQCA 4J8LA 2YCPA 2YCTA 3AOVA 3I16A 3AEJC 3FD0A 3GETA 4OYTA 4JF0A 1ORDA 4K2MA 4WXGA 4DGTA 4A6UA 1W7NA 4F5JA 3N7NA 3G8MA 3HL2A 1XEYA 3HLMA 3JWBA 7AATA 2R5CB 3AENA 1ARTA 3BB8A 4EU1A 2CB1A 3LY1A 4Q6RA 3FZ7A 4WD2A 1EQBA 1LW5A 1RV3A 1YOOA 2AY7A 2DOUA 2W8WA 3FFHA 3N5MA 4OCAA 4E3RA 1YJYA 3FQ7A 3KGXA 4O6ZA 1AJSB 2FNUA 2VMNA 3LVKA 4XK1A 3P6KA 1D7VA 1C7GA 3IF2A 3MAFA 1D7RA 3BCAA 1IAYA 3E2ZB 4M2JA 4ZM3A 2ZY2A 5K8BA 3QBOA 1AX4A 1O62A 4ZDLA 1X0MA 4K2BA 5DJ1A 4M2KA 4BA4A 2FKIA 3N4SA 1B5PA 1ASEA 2DR1A 1QGNA 1P3WA 3LWSA 3FDDA 3VK4A 1WYUA 4EB7A 3E77A 3EI7A 3BCBA 2DKBA 4GRXA 2VMWA 3A9YA 4RJ0A 2E54A 4R5ZA 3ZRQA 4PIWA 1AHEA 4WYFA 3AEJA 2G7JA 3DYDA 2CJDA 2CANA 5G2QA 3RQ1A 3TQXA 4EB5A 3GR9A 4P3MA 4ATQA 1UU1A 4UHNA 3WKSA 1I41A 3LVJA 3PD6B 2VGZA 3H9XA 2R5EA 1N2TA 1MGVA 1X29A 5HHYA 1BQAA 1IX8A 2E7UA 2QB3A 2BYLA 1FG3A 2VMRA 2YKUA 3DRDA 3QGUA 1ASMA 1M6SA 1SVVA 2V1PA 2VMYA 5EIGB 1AKAA 2W7DA 1W7LA 2G6WA 1BJOA 1LKCA 3FVXA 2HZPA 3FSLA 3P1TA 4UOYA 2TPLA 3AATA 2CJGA 3PDBA 3H7FA 1WSTA 2X5DA 2WK8A 5EAVA 4AZJA 1TOIA 1RV4A 1O69A 4WB0B 5E3KA 4ITXA 1TOEA 2QSRA 5J8QA 5BJ4A 1D2FA 1AHXA 1AY5A 4P7YA 4BHDA 4JEZA 1CZEA 2C44A 1B5OA 1GCKA 2ZSMA 1SPAA 2OATA 3K40A 2VMVA 2GSAA 4KXKA 3LVLB 3GSBA 2JJEA 3VK3A 3EI6A 3PGYA 1MDOA 3RI6A 5BJ3A 2D61A 2WKAA 5LHAA 2HUFA 2DGLA 3DXVA 4JEXA 2ZY4A 1QISA 1YJZA 4WXBA 3HVYA 4RIZA 5M49A 2Z20A 1U08A 4IYOB 4UHMA 2HOZA 4WP0A 2D7YA 3IHJA 1QITA 1AKCA 2VMZA 5EAAA 4A0GA 2ZYJA 1M4NA 3WY7A 3EZ1A 2HOYA 3NDNA 4MY5A 5M46A 3USFA 2BI3A 1S08A 1CQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GB3 A;  5F9S A;  3HDO A;  3NYT A;  5G4J A;  3FRK A;  1FC4 A;  4XAU A;  3T32 A;  4JE5 A;  1M0Q A;  2Q7W A;  1GC3 A;  4M2M A;  4ZSY A;  1LC8 A;  1V72 A;  2FNI A;  2VMS A;  2JIS A;  1GEW A;  2VMP A;  1IJI A;  4XJP A;  4WYE A;  2XBN A;  1SZU A;  1UU0 A;  1AHG A;  2Z1Z A;  1MAP A;  3A9Z A;  3DOD A;  2W8V A;  3DR4 A;  4JEW A;  4KAM A;  2QA3 A;  5DJ9 A;  2ZY5 A;  2CST A;  4ZDP A;  1AHF A;  3PJ0 A;  1ASD A;  4LNM A;  1GC4 A;  1Y4I A;  3M5U A;  4CBS A;  5D95 A;  1X2A A;  3KKI A;  3EI5 A;  4KYO A;  4BA5 A;  1J32 A;  4CBR A;  2ZC0 A;  1PFF A;  1KL2 A;  2D5Y A;  1JS6 A;  2YCN A;  3BCX A;  2CFB A;  4ZAS A;  1VJO A;  4LNJ A;  3ELP A;  2VLF A;  4H51 A;  2BIE A;  5LH9 A;  2JJG A;  2W8J A;  2BKW A;  3VP6 A;  1WYV A;  1BQD A;  3FZ6 A;  3RCH A;  2DKJ A;  2X5F A;  2VI9 A;  3K28 A;  1EJI A;  1OXP A;  3AEM C;  2VGS A;  3E6G A;  4NOG A;  4WYD A;  1QJ5 A;  1Z7D A;  4ADB A;  9AAT A;  5G4I A;  3TCM A;  4IY7 A;  2R2N A;  3TFT A;  1M32 A;  2OGE A;  3OP7 A;  3DU4 A;  2W7M A;  2JJH A;  3EI9 A;  5AX8 A;  2CH2 A;  2W7H A;  2EZ2 A;  2Z61 A;  1CQ6 A;  3CQ6 A;  4B98 A;  4EFF A;  1OAT A;  1BW0 A;  1SFF A;  1LW4 A;  5M4D A;  5HXX A;  1MLY A;  2C0R A;  1Z3Z A;  2YRR A;  4R8D A;  4RKD A;  2YKV A;  5FT6 A;  2BI1 A;  4ADD A;  5DB5 A;  2AY1 A;  2CY8 A;  2AY4 A;  3NYS A;  3PDX A;  2BWO A;  2YKX A;  1MDX A;  2Z9W A;  3HT4 A;  4ISY A;  1ARS A;  4MQQ A;  4OBU A;  4WBT A;  1AKB A;  4JEV A;  4R5F A;  1O61 A;  1DJ9 A;  4Y0H A;  4RKC A;  3GJU A;  1CZC A;  3W1I A;  1WYU B;  1ASL A;  3MC6 C;  3ECD A;  3PPL A;  1S0A A;  2R5C A;  3FQA A;  1KKJ A;  1S09 A;  1S06 A;  3AEM A;  4GE7 A;  4IXZ A;  5IWQ A;  1KMK A;  1ASA A;  3WX9 A;  2RFV A;  2HOR A;  2PB0 A;  4UHO A;  5I92 A;  1PMM A;  4Y0I A;  2VMO A;  1YJS A;  3HQT A;  1AJS A;  3FFR A;  3B46 A;  1WYT B;  1EG5 A;  3I4J A;  3JTX A;  3JWA A;  2XH1 A;  1CQ8 A;  3E2Z A;  1V2D A;  3EIB A;  3BV0 A;  3NUB A;  4AZK A;  4FFC A;  4K2I A;  1QZ9 A;  1DKA A;  1SZS A;  4GEB A;  2AEU A;  1KKP A;  3MAD A;  3FQ8 A;  4MKJ A;  3HMU A;  3WCN A;  4AH3 A;  2D65 A;  1B8G A;  3WGC A;  1ASF A;  3NNK A;  4OC9 A;  4MGR A;  1LC5 A;  2QBT A;  1I43 A;  3II0 A;  4MKK A;  4GSA A;  4F5L A;  1DJU A;  1GEX A;  3MC6 A;  1AAM A;  1JF9 A;  1M7Y A;  2EZ1 A;  3UAK A;  4XQ2 A;  2VGV A;  1YIY A;  3PD6 A;  4Y0D A;  4L0O A;  1C7O A;  4PFN A;  1WKH A;  2VMQ A;  5C6U A;  1IBJ A;  4OBV A;  4BMK A;  2E7I A;  1W23 A;  1MLZ A;  2BI5 A;  1B9H A;  3NUI A;  1GEY A;  2HP2 A;  4ZWM A;  5D5S A;  1ZOB A;  1H1C A;  3G0T A;  4WXF A;  4A6T A;  2ORD A;  4W91 A;  5FT8 A;  3KE3 A;  3EIA A;  4WB0 A;  2VMX A;  3AOW A;  4F5I A;  2D66 A;  1TAS A;  3AEL A;  4WYG A;  3RBF A;  4F5F A;  4B9B A;  3JW9 A;  1QIR A;  4W5K A;  2CJH A;  1B4X A;  1E5F A;  1SF2 A;  2W7E A;  4UQV A;  1N8P A;  3VK2 A;  2Z9U A;  1CL2 A;  5HDM A;  2GMS A;  1AMS A;  2VGW A;  2EPJ A;  4EMY A;  1G7W A;  3OKS A;  1W3U A;  1GDE A;  2BIG A;  2GQN A;  3PA9 A;  4W1V A;  4XJL A;  1DGD A;  3BWO A;  1DGE A;  3JU7 A;  2BYJ A;  3UWC A;  3ZRP A;  3B8X A;  3H14 A;  3GZC A;  3CBF A;  2HUU A;  3PIU A;  4XEW A;  3D6K A;  1IX6 A;  1C7N A;  1MDZ A;  1AY8 A;  4ATP A;  1MAQ A;  1B9I A;  1LK9 A;  4F5H A;  2O7C A;  4IYO A;  5TF5 A;  3GBX A;  1M0N A;  2BI2 A;  2FYF A;  1AJR A;  1AMA A;  3GWP A;  2EH6 A;  2OGA A;  3RBL A;  3ZZK A;  2O0R A;  1LC7 A;  1VEF A;  4JE5 D;  2GMU A;  2AY6 A;  3FKD A;  2ZP7 A;  1C4K A;  1IAX A;  4Q75 A;  4AOA A;  1AAW A;  1ASB A;  4A72 A;  1JS3 A;  3WLX A;  4CXQ A;  5F8V A;  1AY4 A;  4TMR A;  4LNL A;  3NRA A;  4XJM A;  1TOJ A;  3ASA A;  4GDY A;  1BJN A;  2JG2 A;  1ZC9 A;  4ZM4 A;  3F9T A;  5E4Z A;  4R2N A;  3QM2 A;  1KMJ A;  3GZD C;  3B1E A;  3COG A;  2YHK A;  4J5U A;  1PMO A;  4RM1 A;  3RUY A;  2YRI A;  1BJW A;  1X28 A;  2E7J A;  3FCR A;  3Q8N A;  2CTZ A;  2Z1Y A;  2PO3 A;  2QMA A;  3AV7 A;  3AEN B;  2OKK A;  1ASC A;  3BC8 A;  1WKG A;  3EZS A;  2BWP A;  3I5T A;  1PG8 A;  3WGB A;  4PVF A;  3VAX A;  1C9C A;  2Z9X A;  2X8U A;  1DFO A;  3FVS A;  3FVU A;  4XJO A;  5FT5 A;  2DGM A;  1IUG A;  4QGR A;  4F5G A;  4WYC A;  4RLG A;  2AY2 A;  1UU2 A;  4F5M A;  3MAF B;  2HUI A;  1O4S A;  3PAA A;  2OQX A;  5JAY A;  3FTB A;  2W7L A;  1ECX A;  1UKJ A;  1GBN A;  4ZSW A;  1V2F A;  2YKY A;  3QHX A;  1VP4 A;  1G4X A;  1ZOD A;  5G0A A;  2WK7 A;  3E2Y A;  2QLR A;  1CJ0 A;  3QN6 A;  4LW4 A;  1M0O A;  2CIN A;  4AO4 A;  4U1T A;  1CS1 A;  3MEB A;  1I29 A;  3GZD A;  3ACZ A;  1CL1 A;  3ATH A;  1W7M A;  2VIB A;  3NU7 A;  1GC0 A;  4F5K A;  2ZJG A;  4HVK A;  4ZDO A;  4WLH A;  3E2F A;  3CQ4 A;  1KL1 A;  3QI6 A;  5EUE A;  2HOX A;  4A0F A;  1M0P A;  2VMU A;  1TAT A;  3BS8 A;  4MQR A;  1IVR A;  4HF8 A;  3LVM A;  3K7Y A;  1QJ3 A;  2O1B A;  4RIT A;  3LG0 A;  5EUD A;  1E5E A;  3R4T A;  2CH1 A;  1OHY A;  4IXO A;  2W8U A;  3F6T A;  1BJ4 A;  2WK9 A;  1XI9 A;  4RJY A;  3MKJ A;  1ASN A;  1BJO B;  4N0W A;  3PDB B;  3CQ5 A;  3DXW A;  3WKR A;  2D63 A;  1OXO A;  4A00 A;  3W1J A;  3UE8 A;  3E9K A;  3WZF A;  3AEO A;  4CVQ A;  1GD9 A;  2W7F A;  5M4B A;  1AMR A;  3NX3 A;  4MSO A;  1G7X A;  2W7G A;  1ARG A;  2D64 A;  1ASG A;  1JG8 A;  1WYT A;  3A8U X;  4MQP A;  4CXR A;  1BS0 A;  1J04 A;  2R0T A;  2FM1 A;  4W1X A;  4OT8 A;  4JEY A;  4IX8 A;  1V2E A;  1S07 A;  4A0H A;  1AIA A;  4PFF A;  4I8A A;  1N31 A;  4DQ6 A;  3JZL A;  3DZZ A;  2W7I A;  4DBC A;  3MAU A;  1AHY A;  4OMA A;  4E1O A;  1I48 A;  5FT4 A;  3NYU A;  4W1W A;  4OTL A;  1IX7 A;  2F8J A;  3A9X A;  2X3L A;  4E77 A;  2PB2 A;  4ITG A;  4IW7 A;  3DC1 A;  1ELQ A;  3G7Q A;  1LS3 A;  2AY3 A;  1AMQ A;  2DGK A;  4GE9 A;  2HP1 A;  4U2H A;  5EUN A;  1G4V A;  1ARI A;  2AAT A;  1T3I A;  3DR7 A;  3ELE A;  5EFS A;  3BWN C;  1ARH A;  2ZSL A;  4WLJ A;  2FN6 A;  1H0C A;  1YNU A;  1DJE A;  4IXS A;  2VYC A;  3R9A A;  3MBB A;  1BKG A;  2OKJ A;  3CAI A;  3NU8 A;  3AEP A;  1D7U A;  4GE4 A;  2V0Y A;  4ZLV A;  2VIA A;  1BT4 A;  2W8T A;  3KGW A;  3BN1 A;  2BHX A;  3L44 A;  2YOB A;  3WCO A;  3ZRR A;  4LW2 A;  2C81 A;  3ZZJ A;  1ELU A;  5E5I A;  2BIA A;  3N0L A;  2BWN A;  2BI9 A;  4BQ0 A;  3EI8 A;  4FL0 A;  2C7T A;  2ZY3 A;  2QB2 A;  2JGT A;  3QPG A;  3F0H A;  1YIZ A;  1TAR A;  3W1H A;  3HBX A;  3LV2 A;  2VI8 A;  1RVU A;  1AIC A;  3B1D A;  4LC3 A;  1DTY A;  1TPL A;  4TV7 A;  8AAT A;  4ZWV A;  2VLH A;  4ADE A;  2W7K A;  2JJF A;  5EIG A;  4ZAH A;  1WYV B;  5DX5 A;  3RCH B;  3BWN A;  4A6R A;  1OHV A;  3FZ8 A;  2AY9 A;  2VMT A;  4AO9 A;  3FDB A;  5G2P A;  2VGT A;  4F4E A;  2AY8 A;  2ZUK A;  4E3Q A;  3TFU A;  4RAE A;  4ADC A;  2AEV A;  2Z9V A;  2NMP A;  2D7Z A;  3NTJ A;  1C0N A;  4Q76 A;  3TAT A;  2EGY A;  3A2B A;  4JF1 A;  1TOG A;  3ASB A;  2W7J A;  1OHW A;  4N0B A;  1GC2 A;  2AY5 A;  3B1C A;  3EUC A;  3L8A A;  2Z67 A;  4Q31 A;  3VOM A;  1TOK A;  1RVY A;  1D7S A;  1AIB A;  2VGU A;  4A0R A;  5G09 A;  2FQ6 A;  3N75 A;  2EO5 A;  4W8I A;  1FG7 A;  1YAA A;  4TN4 A;  1SZK A;  3ISL A;  4WYA A;  5EQC A;  4J8L A;  2YCP A;  2YCT A;  3AOV A;  3I16 A;  3AEJ C;  3FD0 A;  3GET A;  4OYT A;  4JF0 A;  1ORD A;  4K2M A;  4WXG A;  4DGT A;  4A6U A;  1W7N A;  4F5J A;  3G8M A;  3HL2 A;  1XEY A;  3HLM A;  3JWB A;  7AAT A;  2R5C B;  3AEN A;  1ART A;  3BB8 A;  4EU1 A;  2CB1 A;  3LY1 A;  4Q6R A;  3FZ7 A;  4WD2 A;  1EQB A;  1LW5 A;  1RV3 A;  1YOO A;  2AY7 A;  2DOU A;  2W8W A;  3FFH A;  3N5M A;  4OCA A;  4E3R A;  1YJY A;  3FQ7 A;  3KGX A;  4O6Z A;  1AJS B;  2FNU A;  2VMN A;  3LVK A;  4XK1 A;  3P6K A;  1D7V A;  1C7G A;  3IF2 A;  3MAF A;  1D7R A;  3BCA A;  1IAY A;  3E2Z B;  4M2J A;  4ZM3 A;  2ZY2 A;  5K8B A;  3QBO A;  1AX4 A;  1O62 A;  4ZDL A;  1X0M A;  4K2B A;  5DJ1 A;  4M2K A;  4BA4 A;  1B5P A;  1ASE A;  2DR1 A;  1QGN A;  1P3W A;  3LWS A;  3FDD A;  3VK4 A;  1WYU A;  4EB7 A;  3E77 A;  3EI7 A;  3BCB A;  2DKB A;  4GRX A;  2VMW A;  3A9Y A;  4RJ0 A;  2E54 A;  4R5Z A;  3ZRQ A;  4PIW A;  1AHE A;  4WYF A;  3AEJ A;  3DYD A;  2CJD A;  2CAN A;  5G2Q A;  3RQ1 A;  3TQX A;  4EB5 A;  3GR9 A;  4P3M A;  4ATQ A;  1UU1 A;  4UHN A;  3WKS A;  1I41 A;  3LVJ A;  3PD6 B;  2VGZ A;  2R5E A;  1N2T A;  1MGV A;  1X29 A;  5HHY A;  1BQA A;  1IX8 A;  2E7U A;  2QB3 A;  2BYL A;  1FG3 A;  2VMR A;  2YKU A;  3DRD A;  3QGU A;  1ASM A;  1M6S A;  1SVV A;  2V1P A;  2VMY A;  5EIG B;  1AKA A;  2W7D A;  1W7L A;  2G6W A;  1BJO A;  1LKC A;  3FVX A;  2HZP A;  3FSL A;  3P1T A;  4UOY A;  2TPL A;  3AAT A;  2CJG A;  3PDB A;  3H7F A;  1WST A;  2X5D A;  2WK8 A;  5EAV A;  4AZJ A;  1TOI A;  1RV4 A;  1O69 A;  4WB0 B;  5E3K A;  4ITX A;  1TOE A;  5J8Q A;  5BJ4 A;  1D2F A;  1AHX A;  1AY5 A;  4P7Y A;  4BHD A;  4JEZ A;  1CZE A;  2C44 A;  1B5O A;  1GCK A;  2ZSM A;  1SPA A;  2OAT A;  3K40 A;  2VMV A;  2GSA A;  4KXK A;  3LVL B;  3GSB A;  2JJE A;  3VK3 A;  3EI6 A;  3PGY A;  1MDO A;  3RI6 A;  5BJ3 A;  2D61 A;  2WKA A;  5LHA A;  2HUF A;  2DGL A;  3DXV A;  4JEX A;  2ZY4 A;  1QIS A;  1YJZ A;  4WXB A;  3HVY A;  4RIZ A;  5M49 A;  2Z20 A;  1U08 A;  4IYO B;  4UHM A;  2HOZ A;  4WP0 A;  2D7Y A;  3IHJ A;  1QIT A;  1AKC A;  2VMZ A;  5EAA A;  4A0G A;  2ZYJ A;  1M4N A;  3WY7 A;  3EZ1 A;  2HOY A;  3NDN A;  4MY5 A;  5M46 A;  3USF A;  2BI3 A;  1S08 A;  1CQ7 A; 
#chains in the Genus database with same CATH topology
 2GB3 A;  5F9S A;  3HDO A;  3NYT A;  5G4J A;  3FRK A;  1FC4 A;  4XAU A;  3T32 A;  4JE5 A;  1M0Q A;  2Q7W A;  1GC3 A;  4M2M A;  4ZSY A;  1LC8 A;  1V72 A;  2FNI A;  2VMS A;  2JIS A;  1GEW A;  2VMP A;  1IJI A;  4XJP A;  4WYE A;  2XBN A;  1SZU A;  1UU0 A;  1AHG A;  2Z1Z A;  1MAP A;  3A9Z A;  3DOD A;  2W8V A;  3DR4 A;  4JEW A;  4KAM A;  2QA3 A;  5DJ9 A;  2ZY5 A;  2CST A;  4ZDP A;  1AHF A;  3PJ0 A;  1ASD A;  4LNM A;  1GC4 A;  1Y4I A;  3M5U A;  4CBS A;  5D95 A;  1X2A A;  3KKI A;  3EI5 A;  4KYO A;  4BA5 A;  1J32 A;  4CBR A;  2ZC0 A;  1PFF A;  1KL2 A;  2D5Y A;  1JS6 A;  2YCN A;  3BCX A;  2CFB A;  4ZAS A;  1VJO A;  4LNJ A;  3ELP A;  2VLF A;  4H51 A;  2BIE A;  5LH9 A;  2JJG A;  2W8J A;  2BKW A;  3VP6 A;  1WYV A;  1BQD A;  3FZ6 A;  3RCH A;  2DKJ A;  2X5F A;  2VI9 A;  3K28 A;  1EJI A;  1OXP A;  3AEM C;  2VGS A;  3E6G A;  4NOG A;  4WYD A;  1QJ5 A;  1Z7D A;  4ADB A;  9AAT A;  5G4I A;  3TCM A;  4IY7 A;  2R2N A;  3TFT A;  1M32 A;  2OGE A;  3OP7 A;  3DU4 A;  2W7M A;  2JJH A;  3EI9 A;  5AX8 A;  2CH2 A;  2W7H A;  2EZ2 A;  2Z61 A;  1CQ6 A;  3CQ6 A;  4B98 A;  4EFF A;  1OAT A;  1BW0 A;  1SFF A;  1LW4 A;  5M4D A;  5HXX A;  1MLY A;  2C0R A;  1Z3Z A;  2YRR A;  4R8D A;  4RKD A;  2YKV A;  5FT6 A;  2BI1 A;  4ADD A;  5DB5 A;  2AY1 A;  2CY8 A;  2AY4 A;  3NYS A;  3PDX A;  2BWO A;  2YKX A;  1MDX A;  2Z9W A;  3HT4 A;  4ISY A;  1ARS A;  4MQQ A;  4OBU A;  4WBT A;  1AKB A;  4JEV A;  4R5F A;  1O61 A;  1DJ9 A;  4Y0H A;  4RKC A;  3GJU A;  1CZC A;  3W1I A;  1WYU B;  1ASL A;  3MC6 C;  3ECD A;  3PPL A;  1S0A A;  2R5C A;  3FQA A;  1KKJ A;  1S09 A;  1S06 A;  3AEM A;  4GE7 A;  4IXZ A;  5IWQ A;  1KMK A;  1ASA A;  3WX9 A;  2RFV A;  2HOR A;  2PB0 A;  4UHO A;  5I92 A;  1PMM A;  4Y0I A;  2VMO A;  1YJS A;  3HQT A;  1AJS A;  3FFR A;  3B46 A;  1WYT B;  1EG5 A;  3I4J A;  3JTX A;  3JWA A;  2XH1 A;  1CQ8 A;  3E2Z A;  1V2D A;  3EIB A;  3BV0 A;  3NUB A;  4AZK A;  4FFC A;  4K2I A;  1QZ9 A;  1DKA A;  1SZS A;  4GEB A;  2AEU A;  1KKP A;  3MAD A;  3FQ8 A;  4MKJ A;  3HMU A;  3WCN A;  4AH3 A;  2D65 A;  1B8G A;  3WGC A;  1ASF A;  3NNK A;  4OC9 A;  4MGR A;  1LC5 A;  2QBT A;  1I43 A;  3II0 A;  4MKK A;  4GSA A;  4F5L A;  1DJU A;  1GEX A;  3MC6 A;  1AAM A;  1JF9 A;  1M7Y A;  2EZ1 A;  3UAK A;  4XQ2 A;  2A1V A;  2VGV A;  1YIY A;  3PD6 A;  4Y0D A;  4L0O A;  1C7O A;  4PFN A;  1WKH A;  2VMQ A;  5C6U A;  1IBJ A;  4OBV A;  4BMK A;  2E7I A;  1W23 A;  1MLZ A;  2BI5 A;  1B9H A;  3NUI A;  1GEY A;  2HP2 A;  4ZWM A;  5D5S A;  1ZOB A;  1H1C A;  3G0T A;  1KAF A;  4WXF A;  4A6T A;  2ORD A;  4W91 A;  5FT8 A;  3KE3 A;  3EIA A;  4WB0 A;  2VMX A;  3AOW A;  4F5I A;  2D66 A;  1TAS A;  3AEL A;  4WYG A;  3RBF A;  4F5F A;  4B9B A;  3JW9 A;  1QIR A;  4W5K A;  2CJH A;  1B4X A;  1E5F A;  1SF2 A;  2W7E A;  4UQV A;  1N8P A;  3VK2 A;  2Z9U A;  1CL2 A;  5HDM A;  2GMS A;  1AMS A;  2VGW A;  2EPJ A;  4EMY A;  1G7W A;  3OKS A;  1W3U A;  1GDE A;  2BIG A;  2GQN A;  3PA9 A;  4W1V A;  4XJL A;  1DGD A;  3BWO A;  1DGE A;  3JU7 A;  2BYJ A;  3UWC A;  3ZRP A;  3B8X A;  3H14 A;  3GZC A;  3CBF A;  2HUU A;  3PIU A;  4XEW A;  3D6K A;  1IX6 A;  1C7N A;  1MDZ A;  1AY8 A;  4ATP A;  1MAQ A;  1B9I A;  1LK9 A;  4F5H A;  2O7C A;  4IYO A;  5TF5 A;  3GBX A;  1M0N A;  2BI2 A;  2FYF A;  1AJR A;  1AMA A;  3GWP A;  2EH6 A;  2OGA A;  3N4R A;  3RBL A;  3ZZK A;  2O0R A;  1LC7 A;  1VEF A;  4JE5 D;  2GMU A;  2AY6 A;  3FKD A;  2ZP7 A;  1C4K A;  1IAX A;  4Q75 A;  4AOA A;  1AAW A;  1ASB A;  4A72 A;  1JS3 A;  3WLX A;  4CXQ A;  5F8V A;  1AY4 A;  4TMR A;  4LNL A;  3NRA A;  2EYQ A;  4XJM A;  1TOJ A;  3ASA A;  4GDY A;  1BJN A;  2JG2 A;  1ZC9 A;  4ZM4 A;  3F9T A;  5E4Z A;  4R2N A;  3QM2 A;  1KMJ A;  3GZD C;  3B1E A;  3COG A;  2YHK A;  4J5U A;  1PMO A;  4RM1 A;  3RUY A;  2YRI A;  1BJW A;  1X28 A;  2E7J A;  3FCR A;  3Q8N A;  2CTZ A;  2Z1Y A;  2PO3 A;  2QMA A;  3AV7 A;  3AEN B;  2OKK A;  1ASC A;  3BC8 A;  1WKG A;  3EZS A;  2BWP A;  3I5T A;  1PG8 A;  3WGB A;  4PVF A;  3VAX A;  1C9C A;  2Z9X A;  2X8U A;  1DFO A;  3FVS A;  3FVU A;  4XJO A;  5FT5 A;  2DGM A;  1IUG A;  4QGR A;  4F5G A;  4WYC A;  4RLG A;  2AY2 A;  1UU2 A;  4F5M A;  3MAF B;  2HUI A;  1O4S A;  3PAA A;  2OQX A;  5JAY A;  3FTB A;  2W7L A;  1ECX A;  1UKJ A;  1GBN A;  4ZSW A;  1V2F A;  2YKY A;  3QHX A;  1VP4 A;  1G4X A;  1ZOD A;  5G0A A;  2WK7 A;  3E2Y A;  2QLR A;  1CJ0 A;  3QN6 A;  4LW4 A;  1M0O A;  2CIN A;  4AO4 A;  4U1T A;  1CS1 A;  3MEB A;  1I29 A;  3GZD A;  3ACZ A;  1CL1 A;  3ATH A;  1W7M A;  2VIB A;  3NU7 A;  1GC0 A;  4F5K A;  2ZJG A;  4HVK A;  4ZDO A;  4WLH A;  3E2F A;  3CQ4 A;  1KL1 A;  3QI6 A;  5EUE A;  2HOX A;  4A0F A;  1M0P A;  2VMU A;  1TAT A;  3BS8 A;  4MQR A;  1IVR A;  4HF8 A;  3LVM A;  3K7Y A;  1QJ3 A;  2O1B A;  4RIT A;  3LG0 A;  5EUD A;  1E5E A;  3R4T A;  2CH1 A;  5KTB A;  1OHY A;  4IXO A;  2W8U A;  3F6T A;  1BJ4 A;  2WK9 A;  1XI9 A;  4RJY A;  3MKJ A;  1ASN A;  1BJO B;  4N0W A;  3PDB B;  3CQ5 A;  3DXW A;  3WKR A;  2D63 A;  1OXO A;  4A00 A;  3W1J A;  3UE8 A;  3E9K A;  3WZF A;  3AEO A;  4CVQ A;  1GD9 A;  2W7F A;  5M4B A;  1AMR A;  3NX3 A;  4MSO A;  1G7X A;  2W7G A;  1ARG A;  2D64 A;  1ASG A;  1JG8 A;  1WYT A;  3A8U X;  4MQP A;  4CXR A;  1BS0 A;  1J04 A;  2R0T A;  2FM1 A;  4W1X A;  4OT8 A;  4JEY A;  4IX8 A;  2KFP A;  4H63 Q;  1V2E A;  1S07 A;  4A0H A;  1AIA A;  4PFF A;  4I8A A;  1N31 A;  4DQ6 A;  3JZL A;  3DZZ A;  2W7I A;  4DBC A;  3MAU A;  1AHY A;  4OMA A;  4E1O A;  1I48 A;  5FT4 A;  3NYU A;  4W1W A;  4OTL A;  1IX7 A;  2F8J A;  3A9X A;  2X3L A;  4E77 A;  2PB2 A;  4ITG A;  4IW7 A;  3DC1 A;  1ELQ A;  3G7Q A;  1LS3 A;  2AY3 A;  1AMQ A;  2DGK A;  4GE9 A;  2HP1 A;  4U2H A;  5EUN A;  1G4V A;  1ARI A;  2AAT A;  1T3I A;  3DR7 A;  3ELE A;  5EFS A;  3BWN C;  1ARH A;  2ZSL A;  4WLJ A;  2FN6 A;  1H0C A;  1YNU A;  1DJE A;  4IXS A;  2VYC A;  3R9A A;  3MBB A;  1BKG A;  2OKJ A;  3CAI A;  3NU8 A;  3AEP A;  1D7U A;  4GE4 A;  2V0Y A;  4ZLV A;  2VIA A;  1BT4 A;  2W8T A;  3KGW A;  3BN1 A;  2BHX A;  3L44 A;  2YOB A;  3WCO A;  3ZRR A;  4LW2 A;  2C81 A;  3ZZJ A;  1ELU A;  4K05 A;  5E5I A;  2BIA A;  3N0L A;  2BWN A;  2BI9 A;  4BQ0 A;  3EI8 A;  4FL0 A;  2C7T A;  2ZY3 A;  2QB2 A;  2JGT A;  3QPG A;  3F0H A;  1YIZ A;  1TAR A;  3W1H A;  3HBX A;  3LV2 A;  2VI8 A;  1RVU A;  1AIC A;  3B1D A;  4LC3 A;  1DTY A;  1TPL A;  4TV7 A;  8AAT A;  4ZWV A;  2VLH A;  4ADE A;  2W7K A;  2JJF A;  5EIG A;  4ZAH A;  1WYV B;  5DX5 A;  3RCH B;  3BWN A;  4A6R A;  1OHV A;  3FZ8 A;  2AY9 A;  2VMT A;  4AO9 A;  3FDB A;  5G2P A;  2VGT A;  4F4E A;  2AY8 A;  2ZUK A;  4E3Q A;  3TFU A;  4RAE A;  4ADC A;  3N4X A;  2AEV A;  2Z9V A;  2NMP A;  2D7Z A;  3NTJ A;  1C0N A;  4Q76 A;  3TAT A;  2EGY A;  3A2B A;  4JF1 A;  1TOG A;  3ASB A;  2W7J A;  1OHW A;  4N0B A;  1GC2 A;  2AY5 A;  3B1C A;  3EUC A;  3L8A A;  2Z67 A;  4Q31 A;  3VOM A;  2WB6 A;  1TOK A;  1RVY A;  1D7S A;  1AIB A;  2VGU A;  4A0R A;  5G09 A;  2FQ6 A;  3N75 A;  2EO5 A;  4W8I A;  1FG7 A;  1YAA A;  4TN4 A;  1SZK A;  3ISL A;  4WYA A;  5EQC A;  4J8L A;  2YCP A;  2YCT A;  3AOV A;  3I16 A;  3AEJ C;  3FD0 A;  3GET A;  4OYT A;  4JF0 A;  1ORD A;  4K2M A;  4WXG A;  4DGT A;  4A6U A;  1W7N A;  4F5J A;  3N7N A;  3G8M A;  3HL2 A;  1XEY A;  3HLM A;  3JWB A;  7AAT A;  2R5C B;  3AEN A;  1ART A;  3BB8 A;  4EU1 A;  2CB1 A;  3LY1 A;  4Q6R A;  3FZ7 A;  4WD2 A;  1EQB A;  1LW5 A;  1RV3 A;  1YOO A;  2AY7 A;  2DOU A;  2W8W A;  3FFH A;  3N5M A;  4OCA A;  4E3R A;  1YJY A;  3FQ7 A;  3KGX A;  4O6Z A;  1AJS B;  2FNU A;  2VMN A;  3LVK A;  4XK1 A;  3P6K A;  1D7V A;  1C7G A;  3IF2 A;  3MAF A;  1D7R A;  3BCA A;  1IAY A;  3E2Z B;  4M2J A;  4ZM3 A;  2ZY2 A;  5K8B A;  3QBO A;  1AX4 A;  1O62 A;  4ZDL A;  1X0M A;  4K2B A;  5DJ1 A;  4M2K A;  4BA4 A;  2FKI A;  3N4S A;  1B5P A;  1ASE A;  2DR1 A;  1QGN A;  1P3W A;  3LWS A;  3FDD A;  3VK4 A;  1WYU A;  4EB7 A;  3E77 A;  3EI7 A;  3BCB A;  2DKB A;  4GRX A;  2VMW A;  3A9Y A;  4RJ0 A;  2E54 A;  4R5Z A;  3ZRQ A;  4PIW A;  1AHE A;  4WYF A;  3AEJ A;  2G7J A;  3DYD A;  2CJD A;  2CAN A;  5G2Q A;  3RQ1 A;  3TQX A;  4EB5 A;  3GR9 A;  4P3M A;  4ATQ A;  1UU1 A;  4UHN A;  3WKS A;  1I41 A;  3LVJ A;  3PD6 B;  2VGZ A;  3H9X A;  2R5E A;  1N2T A;  1MGV A;  1X29 A;  5HHY A;  1BQA A;  1IX8 A;  2E7U A;  2QB3 A;  2BYL A;  1FG3 A;  2VMR A;  2YKU A;  3DRD A;  3QGU A;  1ASM A;  1M6S A;  1SVV A;  2V1P A;  2VMY A;  5EIG B;  1AKA A;  2W7D A;  1W7L A;  2G6W A;  1BJO A;  1LKC A;  3FVX A;  2HZP A;  3FSL A;  3P1T A;  4UOY A;  2TPL A;  3AAT A;  2CJG A;  3PDB A;  3H7F A;  1WST A;  2X5D A;  2WK8 A;  5EAV A;  4AZJ A;  1TOI A;  1RV4 A;  1O69 A;  4WB0 B;  5E3K A;  4ITX A;  1TOE A;  2QSR A;  5J8Q A;  5BJ4 A;  1D2F A;  1AHX A;  1AY5 A;  4P7Y A;  4BHD A;  4JEZ A;  1CZE A;  2C44 A;  1B5O A;  1GCK A;  2ZSM A;  1SPA A;  2OAT A;  3K40 A;  2VMV A;  2GSA A;  4KXK A;  3LVL B;  3GSB A;  2JJE A;  3VK3 A;  3EI6 A;  3PGY A;  1MDO A;  3RI6 A;  5BJ3 A;  2D61 A;  2WKA A;  5LHA A;  2HUF A;  2DGL A;  3DXV A;  4JEX A;  2ZY4 A;  1QIS A;  1YJZ A;  4WXB A;  3HVY A;  4RIZ A;  5M49 A;  2Z20 A;  1U08 A;  4IYO B;  4UHM A;  2HOZ A;  4WP0 A;  2D7Y A;  3IHJ A;  1QIT A;  1AKC A;  2VMZ A;  5EAA A;  4A0G A;  2ZYJ A;  1M4N A;  3WY7 A;  3EZ1 A;  2HOY A;  3NDN A;  4MY5 A;  5M46 A;  3USF A;  2BI3 A;  1S08 A;  1CQ7 A; 
#chains in the Genus database with same CATH homology
 2GB3 A;  5F9S A;  3HDO A;  3NYT A;  5G4J A;  3FRK A;  1FC4 A;  4XAU A;  3T32 A;  4JE5 A;  1M0Q A;  2Q7W A;  1GC3 A;  4M2M A;  4ZSY A;  1LC8 A;  1V72 A;  2FNI A;  2VMS A;  2JIS A;  1GEW A;  2VMP A;  1IJI A;  4XJP A;  4WYE A;  2XBN A;  1SZU A;  1UU0 A;  1AHG A;  2Z1Z A;  1MAP A;  3A9Z A;  3DOD A;  2W8V A;  3DR4 A;  4JEW A;  4KAM A;  2QA3 A;  5DJ9 A;  2ZY5 A;  2CST A;  4ZDP A;  1AHF A;  3PJ0 A;  1ASD A;  4LNM A;  1GC4 A;  1Y4I A;  3M5U A;  4CBS A;  5D95 A;  1X2A A;  3KKI A;  3EI5 A;  4KYO A;  4BA5 A;  1J32 A;  4CBR A;  2ZC0 A;  1PFF A;  1KL2 A;  2D5Y A;  1JS6 A;  2YCN A;  3BCX A;  2CFB A;  4ZAS A;  1VJO A;  4LNJ A;  3ELP A;  2VLF A;  4H51 A;  2BIE A;  5LH9 A;  2JJG A;  2W8J A;  2BKW A;  3VP6 A;  1WYV A;  1BQD A;  3FZ6 A;  3RCH A;  2DKJ A;  2X5F A;  2VI9 A;  3K28 A;  1EJI A;  1OXP A;  3AEM C;  2VGS A;  3E6G A;  4NOG A;  4WYD A;  1QJ5 A;  1Z7D A;  4ADB A;  9AAT A;  5G4I A;  3TCM A;  4IY7 A;  2R2N A;  3TFT A;  1M32 A;  2OGE A;  3OP7 A;  3DU4 A;  2W7M A;  2JJH A;  3EI9 A;  5AX8 A;  2CH2 A;  2W7H A;  2EZ2 A;  2Z61 A;  1CQ6 A;  3CQ6 A;  4B98 A;  4EFF A;  1OAT A;  1BW0 A;  1SFF A;  1LW4 A;  5M4D A;  5HXX A;  1MLY A;  2C0R A;  1Z3Z A;  2YRR A;  4R8D A;  4RKD A;  2YKV A;  5FT6 A;  2BI1 A;  4ADD A;  5DB5 A;  2AY1 A;  2CY8 A;  2AY4 A;  3NYS A;  3PDX A;  2BWO A;  2YKX A;  1MDX A;  2Z9W A;  3HT4 A;  4ISY A;  1ARS A;  4MQQ A;  4OBU A;  4WBT A;  1AKB A;  4JEV A;  4R5F A;  1O61 A;  1DJ9 A;  4Y0H A;  4RKC A;  3GJU A;  1CZC A;  3W1I A;  1WYU B;  1ASL A;  3MC6 C;  3ECD A;  3PPL A;  1S0A A;  2R5C A;  3FQA A;  1KKJ A;  1S09 A;  1S06 A;  3AEM A;  4GE7 A;  4IXZ A;  5IWQ A;  1KMK A;  1ASA A;  3WX9 A;  2RFV A;  2HOR A;  2PB0 A;  4UHO A;  5I92 A;  1PMM A;  4Y0I A;  2VMO A;  1YJS A;  3HQT A;  1AJS A;  3FFR A;  3B46 A;  1WYT B;  1EG5 A;  3I4J A;  3JTX A;  3JWA A;  2XH1 A;  1CQ8 A;  3E2Z A;  1V2D A;  3EIB A;  3BV0 A;  3NUB A;  4AZK A;  4FFC A;  4K2I A;  1QZ9 A;  1DKA A;  1SZS A;  4GEB A;  2AEU A;  1KKP A;  3MAD A;  3FQ8 A;  4MKJ A;  3HMU A;  3WCN A;  4AH3 A;  2D65 A;  1B8G A;  3WGC A;  1ASF A;  3NNK A;  4OC9 A;  4MGR A;  1LC5 A;  2QBT A;  1I43 A;  3II0 A;  4MKK A;  4GSA A;  4F5L A;  1DJU A;  1GEX A;  3MC6 A;  1AAM A;  1JF9 A;  1M7Y A;  2EZ1 A;  3UAK A;  4XQ2 A;  2A1V A;  2VGV A;  1YIY A;  3PD6 A;  4Y0D A;  4L0O A;  1C7O A;  4PFN A;  1WKH A;  2VMQ A;  5C6U A;  1IBJ A;  4OBV A;  4BMK A;  2E7I A;  1W23 A;  1MLZ A;  2BI5 A;  1B9H A;  3NUI A;  1GEY A;  2HP2 A;  4ZWM A;  5D5S A;  1ZOB A;  1H1C A;  3G0T A;  4WXF A;  4A6T A;  2ORD A;  4W91 A;  5FT8 A;  3KE3 A;  3EIA A;  4WB0 A;  2VMX A;  3AOW A;  4F5I A;  2D66 A;  1TAS A;  3AEL A;  4WYG A;  3RBF A;  4F5F A;  4B9B A;  3JW9 A;  1QIR A;  4W5K A;  2CJH A;  1B4X A;  1E5F A;  1SF2 A;  2W7E A;  4UQV A;  1N8P A;  3VK2 A;  2Z9U A;  1CL2 A;  5HDM A;  2GMS A;  1AMS A;  2VGW A;  2EPJ A;  4EMY A;  1G7W A;  3OKS A;  1W3U A;  1GDE A;  2BIG A;  2GQN A;  3PA9 A;  4W1V A;  4XJL A;  1DGD A;  3BWO A;  1DGE A;  3JU7 A;  2BYJ A;  3UWC A;  3ZRP A;  3B8X A;  3H14 A;  3GZC A;  3CBF A;  2HUU A;  3PIU A;  4XEW A;  3D6K A;  1IX6 A;  1C7N A;  1MDZ A;  1AY8 A;  4ATP A;  1MAQ A;  1B9I A;  1LK9 A;  4F5H A;  2O7C A;  4IYO A;  5TF5 A;  3GBX A;  1M0N A;  2BI2 A;  2FYF A;  1AJR A;  1AMA A;  3GWP A;  2EH6 A;  2OGA A;  3N4R A;  3RBL A;  3ZZK A;  2O0R A;  1LC7 A;  1VEF A;  4JE5 D;  2GMU A;  2AY6 A;  3FKD A;  2ZP7 A;  1C4K A;  1IAX A;  4Q75 A;  4AOA A;  1AAW A;  1ASB A;  4A72 A;  1JS3 A;  3WLX A;  4CXQ A;  5F8V A;  1AY4 A;  4TMR A;  4LNL A;  3NRA A;  2EYQ A;  4XJM A;  1TOJ A;  3ASA A;  4GDY A;  1BJN A;  2JG2 A;  1ZC9 A;  4ZM4 A;  3F9T A;  5E4Z A;  4R2N A;  3QM2 A;  1KMJ A;  3GZD C;  3B1E A;  3COG A;  2YHK A;  4J5U A;  1PMO A;  4RM1 A;  3RUY A;  2YRI A;  1BJW A;  1X28 A;  2E7J A;  3FCR A;  3Q8N A;  2CTZ A;  2Z1Y A;  2PO3 A;  2QMA A;  3AV7 A;  3AEN B;  2OKK A;  1ASC A;  3BC8 A;  1WKG A;  3EZS A;  2BWP A;  3I5T A;  1PG8 A;  3WGB A;  4PVF A;  3VAX A;  1C9C A;  2Z9X A;  2X8U A;  1DFO A;  3FVS A;  3FVU A;  4XJO A;  5FT5 A;  2DGM A;  1IUG A;  4QGR A;  4F5G A;  4WYC A;  4RLG A;  2AY2 A;  1UU2 A;  4F5M A;  3MAF B;  2HUI A;  1O4S A;  3PAA A;  2OQX A;  5JAY A;  3FTB A;  2W7L A;  1ECX A;  1UKJ A;  1GBN A;  4ZSW A;  1V2F A;  2YKY A;  3QHX A;  1VP4 A;  1G4X A;  1ZOD A;  5G0A A;  2WK7 A;  3E2Y A;  2QLR A;  1CJ0 A;  3QN6 A;  4LW4 A;  1M0O A;  2CIN A;  4AO4 A;  4U1T A;  1CS1 A;  3MEB A;  1I29 A;  3GZD A;  3ACZ A;  1CL1 A;  3ATH A;  1W7M A;  2VIB A;  3NU7 A;  1GC0 A;  4F5K A;  2ZJG A;  4HVK A;  4ZDO A;  4WLH A;  3E2F A;  3CQ4 A;  1KL1 A;  3QI6 A;  5EUE A;  2HOX A;  4A0F A;  1M0P A;  2VMU A;  1TAT A;  3BS8 A;  4MQR A;  1IVR A;  4HF8 A;  3LVM A;  3K7Y A;  1QJ3 A;  2O1B A;  4RIT A;  3LG0 A;  5EUD A;  1E5E A;  3R4T A;  2CH1 A;  5KTB A;  1OHY A;  4IXO A;  2W8U A;  3F6T A;  1BJ4 A;  2WK9 A;  1XI9 A;  4RJY A;  3MKJ A;  1ASN A;  1BJO B;  4N0W A;  3PDB B;  3CQ5 A;  3DXW A;  3WKR A;  2D63 A;  1OXO A;  4A00 A;  3W1J A;  3UE8 A;  3E9K A;  3WZF A;  3AEO A;  4CVQ A;  1GD9 A;  2W7F A;  5M4B A;  1AMR A;  3NX3 A;  4MSO A;  1G7X A;  2W7G A;  1ARG A;  2D64 A;  1ASG A;  1JG8 A;  1WYT A;  3A8U X;  4MQP A;  4CXR A;  1BS0 A;  1J04 A;  2R0T A;  2FM1 A;  4W1X A;  4OT8 A;  4JEY A;  4IX8 A;  2KFP A;  4H63 Q;  1V2E A;  1S07 A;  4A0H A;  1AIA A;  4PFF A;  4I8A A;  1N31 A;  4DQ6 A;  3JZL A;  3DZZ A;  2W7I A;  4DBC A;  3MAU A;  1AHY A;  4OMA A;  4E1O A;  1I48 A;  5FT4 A;  3NYU A;  4W1W A;  4OTL A;  1IX7 A;  2F8J A;  3A9X A;  2X3L A;  4E77 A;  2PB2 A;  4ITG A;  4IW7 A;  3DC1 A;  1ELQ A;  3G7Q A;  1LS3 A;  2AY3 A;  1AMQ A;  2DGK A;  4GE9 A;  2HP1 A;  4U2H A;  5EUN A;  1G4V A;  1ARI A;  2AAT A;  1T3I A;  3DR7 A;  3ELE A;  5EFS A;  3BWN C;  1ARH A;  2ZSL A;  4WLJ A;  2FN6 A;  1H0C A;  1YNU A;  1DJE A;  4IXS A;  2VYC A;  3R9A A;  3MBB A;  1BKG A;  2OKJ A;  3CAI A;  3NU8 A;  3AEP A;  1D7U A;  4GE4 A;  2V0Y A;  4ZLV A;  2VIA A;  1BT4 A;  2W8T A;  3KGW A;  3BN1 A;  2BHX A;  3L44 A;  2YOB A;  3WCO A;  3ZRR A;  4LW2 A;  2C81 A;  3ZZJ A;  1ELU A;  4K05 A;  5E5I A;  2BIA A;  3N0L A;  2BWN A;  2BI9 A;  4BQ0 A;  3EI8 A;  4FL0 A;  2C7T A;  2ZY3 A;  2QB2 A;  2JGT A;  3QPG A;  3F0H A;  1YIZ A;  1TAR A;  3W1H A;  3HBX A;  3LV2 A;  2VI8 A;  1RVU A;  1AIC A;  3B1D A;  4LC3 A;  1DTY A;  1TPL A;  4TV7 A;  8AAT A;  4ZWV A;  2VLH A;  4ADE A;  2W7K A;  2JJF A;  5EIG A;  4ZAH A;  1WYV B;  5DX5 A;  3RCH B;  3BWN A;  4A6R A;  1OHV A;  3FZ8 A;  2AY9 A;  2VMT A;  4AO9 A;  3FDB A;  5G2P A;  2VGT A;  4F4E A;  2AY8 A;  2ZUK A;  4E3Q A;  3TFU A;  4RAE A;  4ADC A;  3N4X A;  2AEV A;  2Z9V A;  2NMP A;  2D7Z A;  3NTJ A;  1C0N A;  4Q76 A;  3TAT A;  2EGY A;  3A2B A;  4JF1 A;  1TOG A;  3ASB A;  2W7J A;  1OHW A;  4N0B A;  1GC2 A;  2AY5 A;  3B1C A;  3EUC A;  3L8A A;  2Z67 A;  4Q31 A;  3VOM A;  2WB6 A;  1TOK A;  1RVY A;  1D7S A;  1AIB A;  2VGU A;  4A0R A;  5G09 A;  2FQ6 A;  3N75 A;  2EO5 A;  4W8I A;  1FG7 A;  1YAA A;  4TN4 A;  1SZK A;  3ISL A;  4WYA A;  5EQC A;  4J8L A;  2YCP A;  2YCT A;  3AOV A;  3I16 A;  3AEJ C;  3FD0 A;  3GET A;  4OYT A;  4JF0 A;  1ORD A;  4K2M A;  4WXG A;  4DGT A;  4A6U A;  1W7N A;  4F5J A;  3N7N A;  3G8M A;  3HL2 A;  1XEY A;  3HLM A;  3JWB A;  7AAT A;  2R5C B;  3AEN A;  1ART A;  3BB8 A;  4EU1 A;  2CB1 A;  3LY1 A;  4Q6R A;  3FZ7 A;  4WD2 A;  1EQB A;  1LW5 A;  1RV3 A;  1YOO A;  2AY7 A;  2DOU A;  2W8W A;  3FFH A;  3N5M A;  4OCA A;  4E3R A;  1YJY A;  3FQ7 A;  3KGX A;  4O6Z A;  1AJS B;  2FNU A;  2VMN A;  3LVK A;  4XK1 A;  3P6K A;  1D7V A;  1C7G A;  3IF2 A;  3MAF A;  1D7R A;  3BCA A;  1IAY A;  3E2Z B;  4M2J A;  4ZM3 A;  2ZY2 A;  5K8B A;  3QBO A;  1AX4 A;  1O62 A;  4ZDL A;  1X0M A;  4K2B A;  5DJ1 A;  4M2K A;  4BA4 A;  2FKI A;  3N4S A;  1B5P A;  1ASE A;  2DR1 A;  1QGN A;  1P3W A;  3LWS A;  3FDD A;  3VK4 A;  1WYU A;  4EB7 A;  3E77 A;  3EI7 A;  3BCB A;  2DKB A;  4GRX A;  2VMW A;  3A9Y A;  4RJ0 A;  2E54 A;  4R5Z A;  3ZRQ A;  4PIW A;  1AHE A;  4WYF A;  3AEJ A;  2G7J A;  3DYD A;  2CJD A;  2CAN A;  5G2Q A;  3RQ1 A;  3TQX A;  4EB5 A;  3GR9 A;  4P3M A;  4ATQ A;  1UU1 A;  4UHN A;  3WKS A;  1I41 A;  3LVJ A;  3PD6 B;  2VGZ A;  3H9X A;  2R5E A;  1N2T A;  1MGV A;  1X29 A;  5HHY A;  1BQA A;  1IX8 A;  2E7U A;  2QB3 A;  2BYL A;  1FG3 A;  2VMR A;  2YKU A;  3DRD A;  3QGU A;  1ASM A;  1M6S A;  1SVV A;  2V1P A;  2VMY A;  5EIG B;  1AKA A;  2W7D A;  1W7L A;  2G6W A;  1BJO A;  1LKC A;  3FVX A;  2HZP A;  3FSL A;  3P1T A;  4UOY A;  2TPL A;  3AAT A;  2CJG A;  3PDB A;  3H7F A;  1WST A;  2X5D A;  2WK8 A;  5EAV A;  4AZJ A;  1TOI A;  1RV4 A;  1O69 A;  4WB0 B;  5E3K A;  4ITX A;  1TOE A;  2QSR A;  5J8Q A;  5BJ4 A;  1D2F A;  1AHX A;  1AY5 A;  4P7Y A;  4BHD A;  4JEZ A;  1CZE A;  2C44 A;  1B5O A;  1GCK A;  2ZSM A;  1SPA A;  2OAT A;  3K40 A;  2VMV A;  2GSA A;  4KXK A;  3LVL B;  3GSB A;  2JJE A;  3VK3 A;  3EI6 A;  3PGY A;  1MDO A;  3RI6 A;  5BJ3 A;  2D61 A;  2WKA A;  5LHA A;  2HUF A;  2DGL A;  3DXV A;  4JEX A;  2ZY4 A;  1QIS A;  1YJZ A;  4WXB A;  3HVY A;  4RIZ A;  5M49 A;  2Z20 A;  1U08 A;  4IYO B;  4UHM A;  2HOZ A;  4WP0 A;  2D7Y A;  3IHJ A;  1QIT A;  1AKC A;  2VMZ A;  5EAA A;  4A0G A;  2ZYJ A;  1M4N A;  3WY7 A;  3EZ1 A;  2HOY A;  3NDN A;  4MY5 A;  5M46 A;  3USF A;  2BI3 A;  1S08 A;  1CQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...