1B4XA

Aspartate aminotransferase from e. coli, c191s mutation, with bound maleate
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGSCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title The role of residues outside the active site: structural basis for function of C191 mutants of Escherichia coli aspartate aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 119
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1998-12-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1b4xA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1b4xA01
4ZASA 4F5FA 1CL1A 4JF1A 4ADDA 1CZCA 3D6KA 2YCNA 4ZDLA 1MAQA 3EIAA 1TARA 1X28A 1C0NA 3WX9A 1KKPA 1S0AA 2HOYA 2ZY3A 4WLJA 1ARTA 4JF0A 3AENB 1AKBA 4NOGA 3K40A 1AJRA 2YRRA 2BYLA 1I48A 3BCAA 1J32A 1SPAA 2GSAA 1CL2A 5G09A 1IBJA 3FZ8A 5G4JA 3P1TA 4WBTA 2Q7WA 2Z9UA 1AAWA 1FG7A 3TFTA 5F8VA 2DOUA 3GWPA 3WGCA 4A6TA 2CJGA 2PO3A 3A9XA 2VMPA 1O4SA 2R5CA 3A8UX 1WSTA 4A0GA 1B9HA 1ARHA 4GE9A 4W5KA 2O7CA 4AO9A 4F4EA 4PIWA 1AJSB 3ECDA 3F9TA 4U1TA 1MDZA 1ARSA 1M0OA 3DR7A 3IHJA 4M2MA 3JU7A 2X8UA 2VGZA 2E7JA 2NMPA 3LG0A 2VGTA 5D95A 1MDXA 1PMMA 2Z1ZA 3NYSA 4W8IA 3I5TA 3NDNA 4RAEA 3A9YA 3B1CA 3HT4A 1YJSA 4LC3A 3LVLB 1AJSA 1TOEA 1T3IA 1LK9A 2JJFA 2VGSA 3FQ8A 2BI2A 5DX5A 3FQAA 4ADEA 4KXKA 2VMNA 4OYTA 2BKWA 3BWOA 4B98A 4E77A 5J8QA 1ASNA 4B9BA 4LNJA 1RVUA 3I4JA 3T32A 1ASGA 1UU1A 1TOJA 1QISA 2HOZA 2HOXA 4M2JA 5G0AA 2W7GA 4ZM4A 1BJOB 3WLXA 3LVMA 1ORDA 3PJ0A 2CY8A 4A0RA 2BI5A 4P7YA 2W7DA 4TV7A 4OT8A 2FM1A 3K28A 2VGUA 4LNLA 4HVKA 4KAMA 5EUDA 2W8TA 4R2NA 4A6RA 4AO4A 4JEZA 4H51A 1BJOA 3A2BA 2AATA 3B1EA 1M0NA 4WYFA 3UWCA 4UHOA 2W7FA 2FN6A 2ZY4A 4ITGA 3FDBA 4ADBA 2CFBA 4W91A 3HLMA 1GD9A 4UHNA 4XJOA 2VYCA 5G2PA 4R5ZA 2HUUA 2XBNA 4E1OA 4WXFA 5HDMA 2X5FA 2GQNA 2DKJA 4A6UA 1D7SA 4XAUA 1LC8A 2VIBA 2WK9A 4UHMA 1E5FA 3MAFB 4GEBA 4JEYA 1ASAA 2W7HA 3WY7A 3LVKA 1GC4A 3I16A 3LY1A 1YIZA 4A0FA 1B5PA 2BI3A 4ADCA 1OHWA 1H0CA 2E7IA 2VMSA 4WYGA 4UOYA 3FKDA 3NU8A 3LWSA 4Q31A 1KMJA 4MQQA 1MLYA 5G2QA 5M4BA 2Z20A 5LH9A 1LW5A 3AATA 3VK2A 2JJHA 2EPJA 1SZSA 3AEPA 2Z9WA 2VMVA 3G7QA 1CQ8A 1FC4A 1SF2A 3G0TA 3EUCA 2YRIA 5E3KA 4ZSYA 4EU1A 1BJNA 3LVJA 3NNKA 2VI8A 3QI6A 3QHXA 4TMRA 1Y4IA 1Z3ZA 3EIBA 3HQTA 1M0QA 5EAVA 1YJYA 3EI9A 4WXBA 3MADA 5D5SA 3AEJC 2ZYJA 1JS3A 5EFSA 4RJ0A 1XEYA 5I92A 1O62A 3DZZA 1G4XA 1GEYA 1CJ0A 3BWNC 2AEUA 3ISLA 4FFCA 1FG3A 1W7LA 1QJ5A 3PDBB 1I41A 3PD6A 3AEMA 3MEBA 4ZAHA 3FVSA 3RCHB 2ZY5A 5DJ9A 1M0PA 5EUNA 3FDDA 2CH2A 3NUBA 3VK4A 3R9AA 3QN6A 3DRDA 2XH1A 1YJZA 2BWOA 2QMAA 4XJMA 2PB2A 1JS6A 1AIAA 5EAAA 3PDBA 1W3UA 4DBCA 2CSTA 1VEFA 4BQ0A 4MKKA 2R5CB 1WKGA 3RCHA 7AATA 3FVUA 3II0A 3WGBA 1O61A 1WYVB 1M7YA 3TATA 1ASLA 3L44A 3FQ7A 4J8LA 2JISA 3PGYA 3E9KA 2VMZA 1XI9A 1M32A 3MAUA 1AMSA 3AOWA 1O69A 2AEVA 1GEWA 2BIAA 5HHYA 4WXGA 1WYVA 3RI6A 1S07A 2D5YA 4U2HA 3ELEA 4JE5A 2AY5A 3AOVA 2W8WA 3TCMA 3KGWA 1ASEA 2JGTA 1DJEA 4OTLA 1QIRA 2GMUA 1CQ6A 3ATHA 5AX8A 2JG2A 1ASMA 4IXZA 3BC8A 2ZUKA 4JE5D 4LNMA 1KL1A 1UU2A 2R5EA 4R5FA 2BYJA 4ZWVA 5K8BA 4F5MA 1Z7DA 1ZC9A 3DR4A 4MQPA 1VJOA 2W8VA 4EB7A 2GB3A 3QPGA 1LS3A 1BT4A 3HDOA 1PG8A 4Q6RA 4TN4A 4Y0DA 4MSOA 1GDEA 1BQAA 2F8JA 3AEMC 4IXOA 4Q75A 1AMRA 1OHVA 2QB3A 2D61A 3EI5A 4ZSWA 1M6SA 1WKHA 2AY4A 2EZ2A 2OQXA 3AELA 3L8AA 4WP0A 4CXRA 1BJWA 4PFFA 4K2IA 3QBOA 3QM2A 2D65A 3GJUA 4Y0HA 2VMTA 4ZDOA 3ACZA 1B9IA 3WCNA 2YCPA 3USFA 1RVYA 2VMRA 3ZRPA 4IXSA 3AEJA 1S09A 1BW0A 1CQ7A 4XJPA 2VMWA 3HBXA 3ASBA 4GE4A 3NRAA 3BWNA 3GETA 3ZZJA 2CH1A 1IUGA 3UE8A 1W23A 1YNUA 2CJDA 3AEOA 5M4DA 1ZOBA 1S08A 2FNUA 2R2NA 3ZRQA 1AIBA 3JWAA 2YKVA 3FZ6A 1ZODA 1IX7A 2HP2A 2JJEA 1ARIA 4WYEA 5E5IA 2AY2A 5F9SA 2E7UA 4IX8A 1ASBA 1YIYA 3F0HA 2EH6A 1IX8A 2QLRA 4OMAA 2WK7A 4R8DA 2VMQA 1V2EA 2ZSLA 1LW4A 3F6TA 3A9ZA 3AV7A 1KL2A 4AZKA 4CVQA 2HUIA 3B46A 2DKBA 4IYOA 3LV2A 3GZDC 3K7YA 2CANA 3IF2A 1C7NA 4WYDA 2VI9A 3MC6C 4W1WA 4JEXA 2VIAA 5EQCA 2X3LA 3HVYA 1H1CA 3FRKA 1DFOA 1DTYA 1GC3A 3PIUA 2GMSA 2YKYA 3EZSA 5EUEA 3JZLA 2W7MA 3NYUA 4A72A 1GCKA 1DGDA 2DR1A 2CINA 3TFUA 2V1PA 4P3MA 4HF8A 1MGVA 1X0MA 3BCBA 4EFFA 2HP1A 5DJ1A 1QJ3A 1C9CA 3WKRA 1TATA 1IAXA 1X29A 3GZCA 2VMXA 1IVRA 1J04A 1MDOA 1PMOA 2C44A 2EZ1A 2W8UA 3PD6B 3HMUA 4W1XA 3W1HA 4XJLA 4EMYA 2CJHA 3JWBA 3WKSA 3FCRA 1SZUA 2VLHA 1OHYA 3E2FA 2D7ZA 4F5JA 1P3WA 1OXPA 1N31A 1D2FA 1X2AA 2C81A 2QB2A 3PA9A 2VLFA 1UKJA 3NTJA 2YHKA 1AKAA 1ELQA 2BI1A 2HZPA 1U08A 3DC1A 3FFHA 3TQXA 2VMUA 4DQ6A 3H14A 3E2YA 3BB8A 1JF9A 2AY9A 1SFFA 2AY3A 4GSAA 4I8AA 2BI9A 4XQ2A 2WKAA 3RQ1A 1B4XA 4Y0IA 1B8GA 4WB0A 1AHEA 1AY5A 3BS8A 2ZC0A 1LKCA 4ZM3A 4K2BA 3FTBA 3DXWA 4N0BA 1GBNA 1ASFA 3BV0A 4M2KA 1IX6A 2E54A 2FYFA 4QGRA 4F5GA 1AHYA 2FNIA 1WYTA 1C7OA 2CTZA 2Z1YA 4N0WA 3CQ5A 5FT8A 3B1DA 1ARGA 4ZDPA 1AY8A 3NYTA 1AX4A 2PB0A 2OATA 1ASCA 1OXOA 3EZ1A 1V72A 1AAMA 3M5UA 4GRXA 4WYAA 4RKDA 4XEWA 5M46A 3RBLA 2AY8A 2D63A 2X5DA 2D66A 4FL0A 1EG5A 3BN1A 4CBRA 4AOAA 2ZY2A 3VAXA 2C0RA 3VK3A 4E3QA 4AZJA 3ASAA 2OKJA 2W7EA 3FD0A 4ITXA 5BJ4A 3OKSA 1EJIA 1E5EA 3GZDA 1G7XA 8AATA 3RBFA 3KKIA 3WCOA 3NX3A 3MC6A 3JTXA 4JEWA 1GC2A 2R0TA 4BMKA 1AHGA 3ZRRA 4DGTA 4OCAA 1BQDA 3E2ZB 3CQ4A 3CQ6A 1G4VA 3QGUA 2CB1A 2YKUA 3AENA 2YOBA 2ZP7A 2WK8A 2QA3A 4A00A 2BWNA 3FFRA 4WLHA 5EIGB 1AHFA 2W7IA 3E2ZA 4LW2A 4ZLVA 4K2MA 2AY6A 4MY5A 2YCTA 5FT6A 3COGA 2OGAA 1IJIA 3JW9A 2W7LA 4MQRA 1N8PA 1WYUB 4L0OA 4IY7A 1MLZA 4MKJA 5EIGA 2OKKA 3BCXA 1LC7A 1ELUA 1BJ4A 2BWPA 3EI7A 3GR9A 3GSBA 2FQ6A 3Q8NA 1V2FA 1I43A 2VGWA 1EQBA 4ATQA 1BS0A 2AY1A 2RFVA 5BJ3A 3VP6A 4BA5A 3W1IA 2V0YA 2W8JA 1W7NA 1WYUA 5FT5A 2HUFA 1TPLA 1CS1A 4OC9A 1LC5A 4IYOB 4F5LA 4Q76A 1IAYA 4PFNA 3MBBA 4W1VA 4O6ZA 4GDYA 2EGYA 2JJGA 1C7GA 3DODA 3E6GA 5IWQA 3ELPA 1V2DA 4ISYA 2DGLA 3PAAA 2Z67A 4XK1A 1D7RA 2O0RA 5LHAA 1TOKA 3EI8A 2VMYA 1DJ9A 2DGKA 3OP7A 3KE3A 2Z9VA 4PVFA 4IW7A 1GEXA 5C6UA 3B8XA 4KYOA 1VP4A 3DXVA 1I29A 4LW4A 2ORDA 1G7WA 1TOGA 1AICA 3UAKA 4AH3A 1W7MA 3FVXA 1S06A 3FZ7A 3W1JA 3KGXA 3P6KA 3MKJA 3EI6A 1D7VA 4F5HA 5M49A 4ZWMA 3FSLA 1KMKA 1PFFA 1AY4A 4GE7A 3GBXA 5JAYA 1GC0A 1DJUA 1M4NA 2C7TA 4CXQA 1UU0A 1AKCA 4J5UA 1RV4A 5HXXA 2ZJGA 3R4TA 4JEVA 2AY7A 3N75A 1AHXA 4RKCA 4UQVA 2YKXA 1RV3A 3CAIA 1DKAA 1B5OA 9AATA 1QITA 2VGVA 1C4KA 5DB5A 2BHXA 2D64A 1N2TA 1OATA 1TASA 1QGNA 4F5IA 1DGEA 1TOIA 1SZKA 3N5MA 1KKJA 2D7YA 2QBTA 1JG8A 2Z9XA 3PDXA 4EB5A 3NUIA 4WB0B 3MAFA 4RM1A 2W7KA 3VOMA 2DGMA 4MGRA 4OBVA 2EO5A 4A0HA 1ECXA 1QZ9A 4RITA 3NU7A 2BIGA 1WYTB 4CBSA 3PPLA 1MAPA 1CZEA 3E77A 1BKGA 3G8MA 1AMAA 5TF5A 2O1BA 4E3RA 1YAAA 3ZZKA 1SVVA 2VMOA 4WD2A 2OGEA 4WYCA 3DU4A 2ZSMA 5E4ZA 3RUYA 1ASDA 4ATPA 4BHDA 5FT4A 3DYDA 2HORA 1D7UA 2BIEA 2TPLA 2Z61A 4RIZA 4BA4A 3WZFA 4RJYA 3CBFA 1AMQA 4OBUA 1YOOA 2W7JA 3H7FA 2G6WA 4RLGA 5G4IA 4F5KA 3HL2A 3N0LA
chains in the Genus database with same CATH superfamily
4ZASA 4F5FA 1CL1A 4JF1A 4ADDA 1CZCA 3D6KA 2QSRA 2YCNA 4ZDLA 1MAQA 3EIAA 1TARA 1X28A 1C0NA 3WX9A 1KKPA 1S0AA 2HOYA 2ZY3A 4WLJA 1ARTA 4JF0A 3AENB 1AKBA 4NOGA 3K40A 1AJRA 2YRRA 2BYLA 1I48A 3BCAA 1J32A 1SPAA 2GSAA 1CL2A 5G09A 1IBJA 3FZ8A 5G4JA 3P1TA 4WBTA 2Q7WA 2Z9UA 1AAWA 1FG7A 3TFTA 5F8VA 2DOUA 3GWPA 3WGCA 4A6TA 2CJGA 2PO3A 3A9XA 2VMPA 1O4SA 2R5CA 3A8UX 1WSTA 4A0GA 1B9HA 1ARHA 4GE9A 4W5KA 2O7CA 4AO9A 4F4EA 4PIWA 1AJSB 3ECDA 3F9TA 4U1TA 1MDZA 1ARSA 1M0OA 3DR7A 3IHJA 4M2MA 3JU7A 2X8UA 2VGZA 2E7JA 2NMPA 3LG0A 2VGTA 5D95A 1MDXA 1PMMA 2Z1ZA 3NYSA 4W8IA 3I5TA 3NDNA 4RAEA 3A9YA 3B1CA 3HT4A 1YJSA 4LC3A 3LVLB 1AJSA 1TOEA 1T3IA 1LK9A 2JJFA 2VGSA 3FQ8A 2BI2A 5DX5A 3FQAA 4ADEA 4KXKA 2VMNA 4OYTA 2BKWA 3BWOA 4B98A 4E77A 5J8QA 1ASNA 4B9BA 4LNJA 1RVUA 2A1VA 3I4JA 3T32A 1ASGA 1UU1A 1TOJA 1QISA 2HOZA 2HOXA 4M2JA 5G0AA 2W7GA 4ZM4A 1BJOB 3WLXA 3LVMA 1ORDA 3PJ0A 2CY8A 4A0RA 2BI5A 4P7YA 2W7DA 4TV7A 4OT8A 2FM1A 3K28A 2VGUA 4LNLA 4HVKA 4KAMA 5EUDA 2W8TA 4R2NA 4A6RA 4AO4A 4JEZA 4H51A 1BJOA 3A2BA 2AATA 3B1EA 1M0NA 4WYFA 3UWCA 4UHOA 2W7FA 2FN6A 2ZY4A 4ITGA 3FDBA 4ADBA 2CFBA 4W91A 3HLMA 1GD9A 4UHNA 4XJOA 2VYCA 5G2PA 4R5ZA 2HUUA 2XBNA 4E1OA 4WXFA 5HDMA 2X5FA 2GQNA 2DKJA 4A6UA 1D7SA 3N4RA 4XAUA 1LC8A 2VIBA 2WK9A 4UHMA 1E5FA 3MAFB 4GEBA 4JEYA 1ASAA 2W7HA 3WY7A 3LVKA 1GC4A 3I16A 3LY1A 3N4XA 1YIZA 4A0FA 1B5PA 2BI3A 4ADCA 1OHWA 1H0CA 2E7IA 2VMSA 4WYGA 4UOYA 3FKDA 3NU8A 3LWSA 4Q31A 1KMJA 4MQQA 1MLYA 5G2QA 5M4BA 2Z20A 5LH9A 1LW5A 3AATA 3VK2A 2JJHA 2EPJA 1SZSA 3AEPA 2Z9WA 2VMVA 3G7QA 1CQ8A 1FC4A 1SF2A 3G0TA 3EUCA 2YRIA 5E3KA 4ZSYA 4EU1A 1BJNA 3LVJA 3NNKA 2VI8A 3QI6A 3QHXA 4TMRA 1Y4IA 1Z3ZA 3EIBA 3HQTA 1M0QA 5EAVA 1YJYA 3EI9A 4WXBA 3MADA 5D5SA 3AEJC 2ZYJA 1JS3A 5EFSA 4RJ0A 1XEYA 5I92A 1O62A 3DZZA 1G4XA 1GEYA 1CJ0A 3BWNC 2AEUA 3ISLA 4FFCA 1FG3A 1W7LA 1QJ5A 3PDBB 1I41A 3PD6A 3AEMA 3MEBA 4ZAHA 3N4SA 3FVSA 3RCHB 2ZY5A 5DJ9A 1M0PA 5EUNA 3FDDA 2CH2A 3NUBA 3VK4A 2WB6A 3R9AA 3QN6A 3DRDA 2XH1A 1YJZA 2BWOA 2QMAA 4XJMA 2PB2A 1JS6A 1AIAA 5EAAA 3PDBA 1W3UA 4DBCA 2CSTA 1VEFA 4BQ0A 4MKKA 2R5CB 1WKGA 3RCHA 7AATA 3FVUA 3II0A 3WGBA 1O61A 1WYVB 1M7YA 3TATA 1ASLA 3L44A 3FQ7A 4J8LA 2JISA 3PGYA 3E9KA 2VMZA 1XI9A 1M32A 3MAUA 1AMSA 3AOWA 1O69A 2AEVA 1GEWA 2BIAA 5HHYA 4WXGA 1WYVA 3RI6A 1S07A 2D5YA 4U2HA 3ELEA 4JE5A 2AY5A 3N7NA 3AOVA 2W8WA 3TCMA 3KGWA 1ASEA 2JGTA 1DJEA 4OTLA 1QIRA 2GMUA 1CQ6A 3ATHA 5AX8A 2JG2A 1ASMA 4IXZA 3BC8A 2ZUKA 4JE5D 4LNMA 1KL1A 1UU2A 2R5EA 4R5FA 2BYJA 4ZWVA 5K8BA 4F5MA 1Z7DA 1ZC9A 3DR4A 4MQPA 1VJOA 2W8VA 4EB7A 2GB3A 3QPGA 1LS3A 1BT4A 3HDOA 1PG8A 4Q6RA 4TN4A 4Y0DA 4MSOA 1GDEA 1BQAA 2F8JA 3AEMC 4IXOA 4Q75A 1AMRA 1OHVA 2QB3A 2D61A 3EI5A 4ZSWA 1M6SA 1WKHA 2AY4A 2EZ2A 2OQXA 3AELA 3L8AA 4WP0A 2FKIA 4CXRA 1BJWA 4PFFA 4K2IA 3QBOA 3QM2A 2D65A 3GJUA 4Y0HA 2VMTA 4ZDOA 3ACZA 1B9IA 3WCNA 2YCPA 3USFA 1RVYA 2VMRA 3ZRPA 4IXSA 3AEJA 5KTBA 1S09A 1BW0A 1CQ7A 4XJPA 2VMWA 3HBXA 3ASBA 4GE4A 3NRAA 3BWNA 3GETA 3ZZJA 2CH1A 1IUGA 3UE8A 1W23A 1YNUA 2CJDA 3AEOA 5M4DA 1ZOBA 1S08A 2FNUA 2R2NA 3ZRQA 1AIBA 3JWAA 2YKVA 3FZ6A 1ZODA 1IX7A 2HP2A 2JJEA 1ARIA 4WYEA 5E5IA 2AY2A 5F9SA 2E7UA 4IX8A 1ASBA 1YIYA 3F0HA 2EH6A 1IX8A 2QLRA 4OMAA 2WK7A 4R8DA 2VMQA 1V2EA 2ZSLA 1LW4A 3F6TA 3A9ZA 3AV7A 1KL2A 4AZKA 4CVQA 2HUIA 3B46A 2DKBA 4IYOA 3LV2A 3GZDC 3K7YA 2CANA 3IF2A 1C7NA 4WYDA 2VI9A 3MC6C 4W1WA 4JEXA 2VIAA 5EQCA 2X3LA 3HVYA 1H1CA 3FRKA 1DFOA 1DTYA 1GC3A 3PIUA 2GMSA 2YKYA 3EZSA 5EUEA 3JZLA 2W7MA 3NYUA 4A72A 1GCKA 1DGDA 2DR1A 2CINA 3TFUA 1KAFA 2V1PA 4P3MA 4HF8A 1MGVA 1X0MA 3BCBA 4EFFA 2HP1A 5DJ1A 1QJ3A 1C9CA 3WKRA 1TATA 1IAXA 1X29A 3GZCA 2VMXA 1IVRA 1J04A 1MDOA 1PMOA 2C44A 2EZ1A 2W8UA 3PD6B 3HMUA 4W1XA 3W1HA 4XJLA 4EMYA 2CJHA 3JWBA 3WKSA 3FCRA 1SZUA 2VLHA 1OHYA 3E2FA 2D7ZA 4F5JA 1P3WA 1OXPA 1N31A 1D2FA 1X2AA 2C81A 2QB2A 3PA9A 2VLFA 1UKJA 3NTJA 2YHKA 1AKAA 1ELQA 2BI1A 2HZPA 1U08A 3DC1A 3FFHA 3TQXA 2VMUA 4DQ6A 3H14A 3E2YA 3BB8A 1JF9A 2AY9A 1SFFA 2AY3A 4GSAA 4I8AA 2BI9A 4XQ2A 2WKAA 3RQ1A 1B4XA 4Y0IA 1B8GA 4WB0A 1AHEA 1AY5A 3BS8A 3H9XA 2ZC0A 1LKCA 4ZM3A 4K2BA 3FTBA 3DXWA 4N0BA 1GBNA 1ASFA 3BV0A 4M2KA 1IX6A 2E54A 2FYFA 4QGRA 4F5GA 1AHYA 2FNIA 1WYTA 1C7OA 2CTZA 2Z1YA 4N0WA 3CQ5A 5FT8A 3B1DA 1ARGA 4ZDPA 1AY8A 3NYTA 1AX4A 2PB0A 2OATA 2EYQA 1ASCA 1OXOA 3EZ1A 1V72A 1AAMA 3M5UA 4GRXA 4WYAA 4RKDA 4XEWA 5M46A 3RBLA 2AY8A 2D63A 2X5DA 2D66A 4FL0A 1EG5A 3BN1A 4CBRA 4AOAA 2ZY2A 3VAXA 2C0RA 3VK3A 4E3QA 4AZJA 3ASAA 2OKJA 2W7EA 3FD0A 4ITXA 5BJ4A 3OKSA 1EJIA 1E5EA 3GZDA 1G7XA 8AATA 3RBFA 3KKIA 3WCOA 3NX3A 3MC6A 3JTXA 4JEWA 1GC2A 2R0TA 4BMKA 1AHGA 3ZRRA 4DGTA 4OCAA 1BQDA 3E2ZB 3CQ4A 3CQ6A 1G4VA 3QGUA 2CB1A 2YKUA 3AENA 2YOBA 2ZP7A 2WK8A 2QA3A 4A00A 2BWNA 3FFRA 4WLHA 5EIGB 1AHFA 2W7IA 3E2ZA 4LW2A 4ZLVA 4K2MA 2AY6A 4MY5A 2YCTA 5FT6A 3COGA 2OGAA 1IJIA 3JW9A 2W7LA 4MQRA 1N8PA 1WYUB 4L0OA 4IY7A 1MLZA 4MKJA 5EIGA 2OKKA 3BCXA 1LC7A 1ELUA 1BJ4A 2BWPA 3EI7A 3GR9A 3GSBA 2FQ6A 3Q8NA 1V2FA 1I43A 2VGWA 1EQBA 4ATQA 1BS0A 2AY1A 2RFVA 5BJ3A 3VP6A 4BA5A 3W1IA 2V0YA 2W8JA 1W7NA 1WYUA 5FT5A 2HUFA 1TPLA 1CS1A 4OC9A 1LC5A 4IYOB 4F5LA 4Q76A 1IAYA 4PFNA 3MBBA 4W1VA 4O6ZA 4GDYA 2EGYA 2JJGA 1C7GA 3DODA 3E6GA 5IWQA 3ELPA 1V2DA 4ISYA 2DGLA 3PAAA 2Z67A 4XK1A 1D7RA 2O0RA 5LHAA 1TOKA 3EI8A 2VMYA 1DJ9A 2DGKA 3OP7A 3KE3A 2Z9VA 4PVFA 4IW7A 1GEXA 5C6UA 3B8XA 4KYOA 2KFPA 1VP4A 3DXVA 1I29A 4LW4A 2ORDA 1G7WA 1TOGA 1AICA 3UAKA 4AH3A 1W7MA 3FVXA 1S06A 3FZ7A 3W1JA 3KGXA 3P6KA 3MKJA 3EI6A 1D7VA 4F5HA 5M49A 4ZWMA 3FSLA 1KMKA 1PFFA 1AY4A 4GE7A 3GBXA 5JAYA 1GC0A 1DJUA 1M4NA 4K05A 2C7TA 4CXQA 1UU0A 1AKCA 4J5UA 1RV4A 5HXXA 2ZJGA 3R4TA 4JEVA 2AY7A 3N75A 1AHXA 4RKCA 4UQVA 2YKXA 2G7JA 1RV3A 3CAIA 1DKAA 1B5OA 9AATA 1QITA 2VGVA 1C4KA 5DB5A 2BHXA 2D64A 1N2TA 1OATA 1TASA 1QGNA 4F5IA 1DGEA 1TOIA 1SZKA 3N5MA 1KKJA 2D7YA 2QBTA 1JG8A 2Z9XA 3PDXA 4EB5A 3NUIA 4WB0B 3MAFA 4RM1A 2W7KA 3VOMA 2DGMA 4MGRA 4OBVA 2EO5A 4A0HA 1ECXA 1QZ9A 4RITA 3NU7A 2BIGA 1WYTB 4CBSA 3PPLA 1MAPA 1CZEA 3E77A 1BKGA 3G8MA 1AMAA 5TF5A 2O1BA 4E3RA 1YAAA 3ZZKA 1SVVA 2VMOA 4WD2A 2OGEA 4WYCA 3DU4A 2ZSMA 5E4ZA 3RUYA 1ASDA 4ATPA 4BHDA 5FT4A 3DYDA 2HORA 1D7UA 2BIEA 2TPLA 2Z61A 4RIZA 4BA4A 3WZFA 4RJYA 4H63Q 3CBFA 1AMQA 4OBUA 1YOOA 2W7JA 3H7FA 2G6WA 4RLGA 5G4IA 4F5KA 3HL2A 3N0LA
chains in the Genus database with same CATH topology
4ZASA 4F5FA 1CL1A 4JF1A 4ADDA 1CZCA 3D6KA 2QSRA 2YCNA 4ZDLA 1MAQA 3EIAA 1TARA 1X28A 1C0NA 3WX9A 1KKPA 1S0AA 2HOYA 2ZY3A 4WLJA 1ARTA 4JF0A 3AENB 1AKBA 4NOGA 3K40A 1AJRA 2YRRA 2BYLA 1I48A 3BCAA 1J32A 1SPAA 2GSAA 1CL2A 5G09A 1IBJA 3FZ8A 5G4JA 3P1TA 4WBTA 2Q7WA 2Z9UA 1AAWA 1FG7A 3TFTA 5F8VA 2DOUA 3GWPA 3WGCA 4A6TA 2CJGA 2PO3A 3A9XA 2VMPA 1O4SA 2R5CA 3A8UX 1WSTA 4A0GA 1B9HA 1ARHA 4GE9A 4W5KA 2O7CA 4AO9A 4F4EA 4PIWA 1AJSB 3ECDA 3F9TA 4U1TA 1MDZA 1ARSA 1M0OA 3DR7A 3IHJA 4M2MA 3JU7A 2X8UA 2VGZA 2E7JA 2NMPA 3LG0A 2VGTA 5D95A 1MDXA 1PMMA 2Z1ZA 3NYSA 4W8IA 3I5TA 3NDNA 4RAEA 3A9YA 3B1CA 3HT4A 1YJSA 4LC3A 3LVLB 1AJSA 1TOEA 1T3IA 1LK9A 2JJFA 2VGSA 3FQ8A 2BI2A 5DX5A 3FQAA 4ADEA 4KXKA 2VMNA 4OYTA 2BKWA 3BWOA 4B98A 4E77A 5J8QA 1ASNA 4B9BA 4LNJA 1RVUA 2A1VA 3I4JA 3T32A 1ASGA 1UU1A 1TOJA 1QISA 2HOZA 2HOXA 4M2JA 5G0AA 2W7GA 4ZM4A 1BJOB 3WLXA 3LVMA 1ORDA 3PJ0A 2CY8A 4A0RA 2BI5A 4P7YA 2W7DA 4TV7A 4OT8A 2FM1A 3K28A 2VGUA 4LNLA 4HVKA 4KAMA 5EUDA 2W8TA 4R2NA 4A6RA 4AO4A 4JEZA 4H51A 1BJOA 3A2BA 2AATA 3B1EA 1M0NA 4WYFA 3UWCA 4UHOA 2W7FA 2FN6A 2ZY4A 4ITGA 3FDBA 4ADBA 2CFBA 4W91A 3HLMA 1GD9A 4UHNA 4XJOA 2VYCA 5G2PA 4R5ZA 2HUUA 2XBNA 4E1OA 4WXFA 5HDMA 2X5FA 2GQNA 2DKJA 4A6UA 1D7SA 3N4RA 4XAUA 1LC8A 2VIBA 2WK9A 4UHMA 1E5FA 3MAFB 4GEBA 4JEYA 1ASAA 2W7HA 3WY7A 3LVKA 1GC4A 3I16A 3LY1A 3N4XA 1YIZA 4A0FA 1B5PA 2BI3A 4ADCA 1OHWA 1H0CA 2E7IA 2VMSA 4WYGA 4UOYA 3FKDA 3NU8A 3LWSA 4Q31A 1KMJA 4MQQA 1MLYA 5G2QA 5M4BA 2Z20A 5LH9A 1LW5A 3AATA 3VK2A 2JJHA 2EPJA 1SZSA 3AEPA 2Z9WA 2VMVA 3G7QA 1CQ8A 1FC4A 1SF2A 3G0TA 3EUCA 2YRIA 5E3KA 4ZSYA 4EU1A 1BJNA 3LVJA 3NNKA 2VI8A 3QI6A 3QHXA 4TMRA 1Y4IA 1Z3ZA 3EIBA 3HQTA 1M0QA 5EAVA 1YJYA 3EI9A 4WXBA 3MADA 5D5SA 3AEJC 2ZYJA 1JS3A 5EFSA 4RJ0A 1XEYA 5I92A 1O62A 3DZZA 1G4XA 1GEYA 1CJ0A 3BWNC 2AEUA 3ISLA 4FFCA 1FG3A 1W7LA 1QJ5A 3PDBB 1I41A 3PD6A 3AEMA 3MEBA 4ZAHA 3N4SA 3FVSA 3RCHB 2ZY5A 5DJ9A 1M0PA 5EUNA 3FDDA 2CH2A 3NUBA 3VK4A 2WB6A 3R9AA 3QN6A 3DRDA 2XH1A 1YJZA 2BWOA 2QMAA 4XJMA 2PB2A 1JS6A 1AIAA 5EAAA 3PDBA 1W3UA 4DBCA 2CSTA 1VEFA 4BQ0A 4MKKA 2R5CB 1WKGA 3RCHA 7AATA 3FVUA 3II0A 3WGBA 1O61A 1WYVB 1M7YA 3TATA 1ASLA 3L44A 3FQ7A 4J8LA 2JISA 3PGYA 3E9KA 2VMZA 1XI9A 1M32A 3MAUA 1AMSA 3AOWA 1O69A 2AEVA 1GEWA 2BIAA 5HHYA 4WXGA 1WYVA 3RI6A 1S07A 2D5YA 4U2HA 3ELEA 4JE5A 2AY5A 3N7NA 3AOVA 2W8WA 3TCMA 3KGWA 1ASEA 2JGTA 1DJEA 4OTLA 1QIRA 2GMUA 1CQ6A 3ATHA 5AX8A 2JG2A 1ASMA 4IXZA 3BC8A 2ZUKA 4JE5D 4LNMA 1KL1A 1UU2A 2R5EA 4R5FA 2BYJA 4ZWVA 5K8BA 4F5MA 1Z7DA 1ZC9A 3DR4A 4MQPA 1VJOA 2W8VA 4EB7A 2GB3A 3QPGA 1LS3A 1BT4A 3HDOA 1PG8A 4Q6RA 4TN4A 4Y0DA 4MSOA 1GDEA 1BQAA 2F8JA 3AEMC 4IXOA 4Q75A 1AMRA 1OHVA 2QB3A 2D61A 3EI5A 4ZSWA 1M6SA 1WKHA 2AY4A 2EZ2A 2OQXA 3AELA 3L8AA 4WP0A 2FKIA 4CXRA 1BJWA 4PFFA 4K2IA 3QBOA 3QM2A 2D65A 3GJUA 4Y0HA 2VMTA 4ZDOA 3ACZA 1B9IA 3WCNA 2YCPA 3USFA 1RVYA 2VMRA 3ZRPA 4IXSA 3AEJA 5KTBA 1S09A 1BW0A 1CQ7A 4XJPA 2VMWA 3HBXA 3ASBA 4GE4A 3NRAA 3BWNA 3GETA 3ZZJA 2CH1A 1IUGA 3UE8A 1W23A 1YNUA 2CJDA 3AEOA 5M4DA 1ZOBA 1S08A 2FNUA 2R2NA 3ZRQA 1AIBA 3JWAA 2YKVA 3FZ6A 1ZODA 1IX7A 2HP2A 2JJEA 1ARIA 4WYEA 5E5IA 2AY2A 5F9SA 2E7UA 4IX8A 1ASBA 1YIYA 3F0HA 2EH6A 1IX8A 2QLRA 4OMAA 2WK7A 4R8DA 2VMQA 1V2EA 2ZSLA 1LW4A 3F6TA 3A9ZA 3AV7A 1KL2A 4AZKA 4CVQA 2HUIA 3B46A 2DKBA 4IYOA 3LV2A 3GZDC 3K7YA 2CANA 3IF2A 1C7NA 4WYDA 2VI9A 3MC6C 4W1WA 4JEXA 2VIAA 5EQCA 2X3LA 3HVYA 1H1CA 3FRKA 1DFOA 1DTYA 1GC3A 3PIUA 2GMSA 2YKYA 3EZSA 5EUEA 3JZLA 2W7MA 3NYUA 4A72A 1GCKA 1DGDA 2DR1A 2CINA 3TFUA 2V1PA 4P3MA 4HF8A 1MGVA 1X0MA 3BCBA 4EFFA 2HP1A 5DJ1A 1QJ3A 1C9CA 3WKRA 1TATA 1IAXA 1X29A 3GZCA 2VMXA 1IVRA 1J04A 1MDOA 1PMOA 2C44A 2EZ1A 2W8UA 3PD6B 3HMUA 4W1XA 3W1HA 4XJLA 4EMYA 2CJHA 3JWBA 3WKSA 3FCRA 1SZUA 2VLHA 1OHYA 3E2FA 2D7ZA 4F5JA 1P3WA 1OXPA 1N31A 1D2FA 1X2AA 2C81A 2QB2A 3PA9A 2VLFA 1UKJA 3NTJA 2YHKA 1AKAA 1ELQA 2BI1A 2HZPA 1U08A 3DC1A 3FFHA 3TQXA 2VMUA 4DQ6A 3H14A 3E2YA 3BB8A 1JF9A 2AY9A 1SFFA 2AY3A 4GSAA 4I8AA 2BI9A 4XQ2A 2WKAA 3RQ1A 1B4XA 4Y0IA 1B8GA 4WB0A 1AHEA 1AY5A 3BS8A 3H9XA 2ZC0A 1LKCA 4ZM3A 4K2BA 3FTBA 3DXWA 4N0BA 1GBNA 1ASFA 3BV0A 4M2KA 1IX6A 2E54A 2FYFA 4QGRA 4F5GA 1AHYA 2FNIA 1WYTA 1C7OA 2CTZA 2Z1YA 4N0WA 3CQ5A 5FT8A 3B1DA 1ARGA 4ZDPA 1AY8A 3NYTA 1AX4A 2PB0A 2OATA 2EYQA 1ASCA 1OXOA 3EZ1A 1V72A 1AAMA 3M5UA 4GRXA 4WYAA 4RKDA 4XEWA 5M46A 3RBLA 2AY8A 2D63A 2X5DA 2D66A 4FL0A 1EG5A 3BN1A 4CBRA 4AOAA 2ZY2A 3VAXA 2C0RA 3VK3A 4E3QA 4AZJA 3ASAA 2OKJA 2W7EA 3FD0A 4ITXA 5BJ4A 3OKSA 1EJIA 1E5EA 3GZDA 1G7XA 8AATA 3RBFA 3KKIA 3WCOA 3NX3A 3MC6A 3JTXA 4JEWA 1GC2A 2R0TA 4BMKA 1AHGA 3ZRRA 4DGTA 4OCAA 1BQDA 3E2ZB 3CQ4A 3CQ6A 1G4VA 3QGUA 2CB1A 2YKUA 3AENA 2YOBA 2ZP7A 2WK8A 2QA3A 4A00A 2BWNA 3FFRA 4WLHA 5EIGB 1AHFA 2W7IA 3E2ZA 4LW2A 4ZLVA 4K2MA 2AY6A 4MY5A 2YCTA 5FT6A 3COGA 2OGAA 1IJIA 3JW9A 2W7LA 4MQRA 1N8PA 1WYUB 4L0OA 4IY7A 1MLZA 4MKJA 5EIGA 2OKKA 3BCXA 1LC7A 1ELUA 1BJ4A 2BWPA 3EI7A 3GR9A 3GSBA 2FQ6A 3Q8NA 1V2FA 1I43A 2VGWA 1EQBA 4ATQA 1BS0A 2AY1A 2RFVA 5BJ3A 3VP6A 4BA5A 3W1IA 2V0YA 2W8JA 1W7NA 1WYUA 5FT5A 2HUFA 1TPLA 1CS1A 4OC9A 1LC5A 4IYOB 4F5LA 4Q76A 1IAYA 4PFNA 3MBBA 4W1VA 4O6ZA 4GDYA 2EGYA 2JJGA 1C7GA 3DODA 3E6GA 5IWQA 3ELPA 1V2DA 4ISYA 2DGLA 3PAAA 2Z67A 4XK1A 1D7RA 2O0RA 5LHAA 1TOKA 3EI8A 2VMYA 1DJ9A 2DGKA 3OP7A 3KE3A 2Z9VA 4PVFA 4IW7A 1GEXA 5C6UA 3B8XA 4KYOA 2KFPA 1VP4A 3DXVA 1I29A 4LW4A 2ORDA 1G7WA 1TOGA 1AICA 3UAKA 4AH3A 1W7MA 3FVXA 1S06A 3FZ7A 3W1JA 3KGXA 3P6KA 3MKJA 3EI6A 1D7VA 4F5HA 5M49A 4ZWMA 3FSLA 1KMKA 1PFFA 1AY4A 4GE7A 3GBXA 5JAYA 1GC0A 1DJUA 1M4NA 4K05A 2C7TA 4CXQA 1UU0A 1AKCA 4J5UA 1RV4A 5HXXA 2ZJGA 3R4TA 4JEVA 2AY7A 3N75A 1AHXA 4RKCA 4UQVA 2YKXA 2G7JA 1RV3A 3CAIA 1DKAA 1B5OA 9AATA 1QITA 2VGVA 1C4KA 5DB5A 2BHXA 2D64A 1N2TA 1OATA 1TASA 1QGNA 4F5IA 1DGEA 1TOIA 1SZKA 3N5MA 1KKJA 2D7YA 2QBTA 1JG8A 2Z9XA 3PDXA 4EB5A 3NUIA 4WB0B 3MAFA 4RM1A 2W7KA 3VOMA 2DGMA 4MGRA 4OBVA 2EO5A 4A0HA 1ECXA 1QZ9A 4RITA 3NU7A 2BIGA 1WYTB 4CBSA 3PPLA 1MAPA 1CZEA 3E77A 1BKGA 3G8MA 1AMAA 5TF5A 2O1BA 4E3RA 1YAAA 3ZZKA 1SVVA 2VMOA 4WD2A 2OGEA 4WYCA 3DU4A 2ZSMA 5E4ZA 3RUYA 1ASDA 4ATPA 4BHDA 5FT4A 3DYDA 2HORA 1D7UA 2BIEA 2TPLA 2Z61A 4RIZA 4BA4A 3WZFA 4RJYA 4H63Q 3CBFA 1AMQA 4OBUA 1YOOA 2W7JA 3H7FA 2G6WA 4RLGA 5G4IA 4F5KA 3HL2A 3N0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZAS A;  4F5F A;  1CL1 A;  4JF1 A;  4ADD A;  1CZC A;  3D6K A;  2YCN A;  4ZDL A;  1MAQ A;  3EIA A;  1TAR A;  1X28 A;  1C0N A;  3WX9 A;  1KKP A;  1S0A A;  2HOY A;  2ZY3 A;  4WLJ A;  1ART A;  4JF0 A;  3AEN B;  1AKB A;  4NOG A;  3K40 A;  1AJR A;  2YRR A;  2BYL A;  1I48 A;  3BCA A;  1J32 A;  1SPA A;  2GSA A;  1CL2 A;  5G09 A;  1IBJ A;  3FZ8 A;  5G4J A;  3P1T A;  4WBT A;  2Q7W A;  2Z9U A;  1AAW A;  1FG7 A;  3TFT A;  5F8V A;  2DOU A;  3GWP A;  3WGC A;  4A6T A;  2CJG A;  2PO3 A;  3A9X A;  2VMP A;  1O4S A;  2R5C A;  3A8U X;  1WST A;  4A0G A;  1B9H A;  1ARH A;  4GE9 A;  4W5K A;  2O7C A;  4AO9 A;  4F4E A;  4PIW A;  1AJS B;  3ECD A;  3F9T A;  4U1T A;  1MDZ A;  1ARS A;  1M0O A;  3DR7 A;  3IHJ A;  4M2M A;  3JU7 A;  2X8U A;  2VGZ A;  2E7J A;  2NMP A;  3LG0 A;  2VGT A;  5D95 A;  1MDX A;  1PMM A;  2Z1Z A;  3NYS A;  4W8I A;  3I5T A;  3NDN A;  4RAE A;  3A9Y A;  3B1C A;  3HT4 A;  1YJS A;  4LC3 A;  3LVL B;  1AJS A;  1TOE A;  1T3I A;  1LK9 A;  2JJF A;  2VGS A;  3FQ8 A;  2BI2 A;  5DX5 A;  3FQA A;  4ADE A;  4KXK A;  2VMN A;  4OYT A;  2BKW A;  3BWO A;  4B98 A;  4E77 A;  5J8Q A;  1ASN A;  4B9B A;  4LNJ A;  1RVU A;  3I4J A;  3T32 A;  1ASG A;  1UU1 A;  1TOJ A;  1QIS A;  2HOZ A;  2HOX A;  4M2J A;  5G0A A;  2W7G A;  4ZM4 A;  1BJO B;  3WLX A;  3LVM A;  1ORD A;  3PJ0 A;  2CY8 A;  4A0R A;  2BI5 A;  4P7Y A;  2W7D A;  4TV7 A;  4OT8 A;  2FM1 A;  3K28 A;  2VGU A;  4LNL A;  4HVK A;  4KAM A;  5EUD A;  2W8T A;  4R2N A;  4A6R A;  4AO4 A;  4JEZ A;  4H51 A;  1BJO A;  3A2B A;  2AAT A;  3B1E A;  1M0N A;  4WYF A;  3UWC A;  4UHO A;  2W7F A;  2FN6 A;  2ZY4 A;  4ITG A;  3FDB A;  4ADB A;  2CFB A;  4W91 A;  3HLM A;  1GD9 A;  4UHN A;  4XJO A;  2VYC A;  5G2P A;  4R5Z A;  2HUU A;  2XBN A;  4E1O A;  4WXF A;  5HDM A;  2X5F A;  2GQN A;  2DKJ A;  4A6U A;  1D7S A;  4XAU A;  1LC8 A;  2VIB A;  2WK9 A;  4UHM A;  1E5F A;  3MAF B;  4GEB A;  4JEY A;  1ASA A;  2W7H A;  3WY7 A;  3LVK A;  1GC4 A;  3I16 A;  3LY1 A;  1YIZ A;  4A0F A;  1B5P A;  2BI3 A;  4ADC A;  1OHW A;  1H0C A;  2E7I A;  2VMS A;  4WYG A;  4UOY A;  3FKD A;  3NU8 A;  3LWS A;  4Q31 A;  1KMJ A;  4MQQ A;  1MLY A;  5G2Q A;  5M4B A;  2Z20 A;  5LH9 A;  1LW5 A;  3AAT A;  3VK2 A;  2JJH A;  2EPJ A;  1SZS A;  3AEP A;  2Z9W A;  2VMV A;  3G7Q A;  1CQ8 A;  1FC4 A;  1SF2 A;  3G0T A;  3EUC A;  2YRI A;  5E3K A;  4ZSY A;  4EU1 A;  1BJN A;  3LVJ A;  3NNK A;  2VI8 A;  3QI6 A;  3QHX A;  4TMR A;  1Y4I A;  1Z3Z A;  3EIB A;  3HQT A;  1M0Q A;  5EAV A;  1YJY A;  3EI9 A;  4WXB A;  3MAD A;  5D5S A;  3AEJ C;  2ZYJ A;  1JS3 A;  5EFS A;  4RJ0 A;  1XEY A;  5I92 A;  1O62 A;  3DZZ A;  1G4X A;  1GEY A;  1CJ0 A;  3BWN C;  2AEU A;  3ISL A;  4FFC A;  1FG3 A;  1W7L A;  1QJ5 A;  3PDB B;  1I41 A;  3PD6 A;  3AEM A;  3MEB A;  4ZAH A;  3FVS A;  3RCH B;  2ZY5 A;  5DJ9 A;  1M0P A;  5EUN A;  3FDD A;  2CH2 A;  3NUB A;  3VK4 A;  3R9A A;  3QN6 A;  3DRD A;  2XH1 A;  1YJZ A;  2BWO A;  2QMA A;  4XJM A;  2PB2 A;  1JS6 A;  1AIA A;  5EAA A;  3PDB A;  1W3U A;  4DBC A;  2CST A;  1VEF A;  4BQ0 A;  4MKK A;  2R5C B;  1WKG A;  3RCH A;  7AAT A;  3FVU A;  3II0 A;  3WGB A;  1O61 A;  1WYV B;  1M7Y A;  3TAT A;  1ASL A;  3L44 A;  3FQ7 A;  4J8L A;  2JIS A;  3PGY A;  3E9K A;  2VMZ A;  1XI9 A;  1M32 A;  3MAU A;  1AMS A;  3AOW A;  1O69 A;  2AEV A;  1GEW A;  2BIA A;  5HHY A;  4WXG A;  1WYV A;  3RI6 A;  1S07 A;  2D5Y A;  4U2H A;  3ELE A;  4JE5 A;  2AY5 A;  3AOV A;  2W8W A;  3TCM A;  3KGW A;  1ASE A;  2JGT A;  1DJE A;  4OTL A;  1QIR A;  2GMU A;  1CQ6 A;  3ATH A;  5AX8 A;  2JG2 A;  1ASM A;  4IXZ A;  3BC8 A;  2ZUK A;  4JE5 D;  4LNM A;  1KL1 A;  1UU2 A;  2R5E A;  4R5F A;  2BYJ A;  4ZWV A;  5K8B A;  4F5M A;  1Z7D A;  1ZC9 A;  3DR4 A;  4MQP A;  1VJO A;  2W8V A;  4EB7 A;  2GB3 A;  3QPG A;  1LS3 A;  1BT4 A;  3HDO A;  1PG8 A;  4Q6R A;  4TN4 A;  4Y0D A;  4MSO A;  1GDE A;  1BQA A;  2F8J A;  3AEM C;  4IXO A;  4Q75 A;  1AMR A;  1OHV A;  2QB3 A;  2D61 A;  3EI5 A;  4ZSW A;  1M6S A;  1WKH A;  2AY4 A;  2EZ2 A;  2OQX A;  3AEL A;  3L8A A;  4WP0 A;  4CXR A;  1BJW A;  4PFF A;  4K2I A;  3QBO A;  3QM2 A;  2D65 A;  3GJU A;  4Y0H A;  2VMT A;  4ZDO A;  3ACZ A;  1B9I A;  3WCN A;  2YCP A;  3USF A;  1RVY A;  2VMR A;  3ZRP A;  4IXS A;  3AEJ A;  1S09 A;  1BW0 A;  1CQ7 A;  4XJP A;  2VMW A;  3HBX A;  3ASB A;  4GE4 A;  3NRA A;  3BWN A;  3GET A;  3ZZJ A;  2CH1 A;  1IUG A;  3UE8 A;  1W23 A;  1YNU A;  2CJD A;  3AEO A;  5M4D A;  1ZOB A;  1S08 A;  2FNU A;  2R2N A;  3ZRQ A;  1AIB A;  3JWA A;  2YKV A;  3FZ6 A;  1ZOD A;  1IX7 A;  2HP2 A;  2JJE A;  1ARI A;  4WYE A;  5E5I A;  2AY2 A;  5F9S A;  2E7U A;  4IX8 A;  1ASB A;  1YIY A;  3F0H A;  2EH6 A;  1IX8 A;  2QLR A;  4OMA A;  2WK7 A;  4R8D A;  2VMQ A;  1V2E A;  2ZSL A;  1LW4 A;  3F6T A;  3A9Z A;  3AV7 A;  1KL2 A;  4AZK A;  4CVQ A;  2HUI A;  3B46 A;  2DKB A;  4IYO A;  3LV2 A;  3GZD C;  3K7Y A;  2CAN A;  3IF2 A;  1C7N A;  4WYD A;  2VI9 A;  3MC6 C;  4W1W A;  4JEX A;  2VIA A;  5EQC A;  2X3L A;  3HVY A;  1H1C A;  3FRK A;  1DFO A;  1DTY A;  1GC3 A;  3PIU A;  2GMS A;  2YKY A;  3EZS A;  5EUE A;  3JZL A;  2W7M A;  3NYU A;  4A72 A;  1GCK A;  1DGD A;  2DR1 A;  2CIN A;  3TFU A;  2V1P A;  4P3M A;  4HF8 A;  1MGV A;  1X0M A;  3BCB A;  4EFF A;  2HP1 A;  5DJ1 A;  1QJ3 A;  1C9C A;  3WKR A;  1TAT A;  1IAX A;  1X29 A;  3GZC A;  2VMX A;  1IVR A;  1J04 A;  1MDO A;  1PMO A;  2C44 A;  2EZ1 A;  2W8U A;  3PD6 B;  3HMU A;  4W1X A;  3W1H A;  4XJL A;  4EMY A;  2CJH A;  3JWB A;  3WKS A;  3FCR A;  1SZU A;  2VLH A;  1OHY A;  3E2F A;  2D7Z A;  4F5J A;  1P3W A;  1OXP A;  1N31 A;  1D2F A;  1X2A A;  2C81 A;  2QB2 A;  3PA9 A;  2VLF A;  1UKJ A;  3NTJ A;  2YHK A;  1AKA A;  1ELQ A;  2BI1 A;  2HZP A;  1U08 A;  3DC1 A;  3FFH A;  3TQX A;  2VMU A;  4DQ6 A;  3H14 A;  3E2Y A;  3BB8 A;  1JF9 A;  2AY9 A;  1SFF A;  2AY3 A;  4GSA A;  4I8A A;  2BI9 A;  4XQ2 A;  2WKA A;  3RQ1 A;  1B4X A;  4Y0I A;  1B8G A;  4WB0 A;  1AHE A;  1AY5 A;  3BS8 A;  2ZC0 A;  1LKC A;  4ZM3 A;  4K2B A;  3FTB A;  3DXW A;  4N0B A;  1GBN A;  1ASF A;  3BV0 A;  4M2K A;  1IX6 A;  2E54 A;  2FYF A;  4QGR A;  4F5G A;  1AHY A;  2FNI A;  1WYT A;  1C7O A;  2CTZ A;  2Z1Y A;  4N0W A;  3CQ5 A;  5FT8 A;  3B1D A;  1ARG A;  4ZDP A;  1AY8 A;  3NYT A;  1AX4 A;  2PB0 A;  2OAT A;  1ASC A;  1OXO A;  3EZ1 A;  1V72 A;  1AAM A;  3M5U A;  4GRX A;  4WYA A;  4RKD A;  4XEW A;  5M46 A;  3RBL A;  2AY8 A;  2D63 A;  2X5D A;  2D66 A;  4FL0 A;  1EG5 A;  3BN1 A;  4CBR A;  4AOA A;  2ZY2 A;  3VAX A;  2C0R A;  3VK3 A;  4E3Q A;  4AZJ A;  3ASA A;  2OKJ A;  2W7E A;  3FD0 A;  4ITX A;  5BJ4 A;  3OKS A;  1EJI A;  1E5E A;  3GZD A;  1G7X A;  8AAT A;  3RBF A;  3KKI A;  3WCO A;  3NX3 A;  3MC6 A;  3JTX A;  4JEW A;  1GC2 A;  2R0T A;  4BMK A;  1AHG A;  3ZRR A;  4DGT A;  4OCA A;  1BQD A;  3E2Z B;  3CQ4 A;  3CQ6 A;  1G4V A;  3QGU A;  2CB1 A;  2YKU A;  3AEN A;  2YOB A;  2ZP7 A;  2WK8 A;  2QA3 A;  4A00 A;  2BWN A;  3FFR A;  4WLH A;  5EIG B;  1AHF A;  2W7I A;  3E2Z A;  4LW2 A;  4ZLV A;  4K2M A;  2AY6 A;  4MY5 A;  2YCT A;  5FT6 A;  3COG A;  2OGA A;  1IJI A;  3JW9 A;  2W7L A;  4MQR A;  1N8P A;  1WYU B;  4L0O A;  4IY7 A;  1MLZ A;  4MKJ A;  5EIG A;  2OKK A;  3BCX A;  1LC7 A;  1ELU A;  1BJ4 A;  2BWP A;  3EI7 A;  3GR9 A;  3GSB A;  2FQ6 A;  3Q8N A;  1V2F A;  1I43 A;  2VGW A;  1EQB A;  4ATQ A;  1BS0 A;  2AY1 A;  2RFV A;  5BJ3 A;  3VP6 A;  4BA5 A;  3W1I A;  2V0Y A;  2W8J A;  1W7N A;  1WYU A;  5FT5 A;  2HUF A;  1TPL A;  1CS1 A;  4OC9 A;  1LC5 A;  4IYO B;  4F5L A;  4Q76 A;  1IAY A;  4PFN A;  3MBB A;  4W1V A;  4O6Z A;  4GDY A;  2EGY A;  2JJG A;  1C7G A;  3DOD A;  3E6G A;  5IWQ A;  3ELP A;  1V2D A;  4ISY A;  2DGL A;  3PAA A;  2Z67 A;  4XK1 A;  1D7R A;  2O0R A;  5LHA A;  1TOK A;  3EI8 A;  2VMY A;  1DJ9 A;  2DGK A;  3OP7 A;  3KE3 A;  2Z9V A;  4PVF A;  4IW7 A;  1GEX A;  5C6U A;  3B8X A;  4KYO A;  1VP4 A;  3DXV A;  1I29 A;  4LW4 A;  2ORD A;  1G7W A;  1TOG A;  1AIC A;  3UAK A;  4AH3 A;  1W7M A;  3FVX A;  1S06 A;  3FZ7 A;  3W1J A;  3KGX A;  3P6K A;  3MKJ A;  3EI6 A;  1D7V A;  4F5H A;  5M49 A;  4ZWM A;  3FSL A;  1KMK A;  1PFF A;  1AY4 A;  4GE7 A;  3GBX A;  5JAY A;  1GC0 A;  1DJU A;  1M4N A;  2C7T A;  4CXQ A;  1UU0 A;  1AKC A;  4J5U A;  1RV4 A;  5HXX A;  2ZJG A;  3R4T A;  4JEV A;  2AY7 A;  3N75 A;  1AHX A;  4RKC A;  4UQV A;  2YKX A;  1RV3 A;  3CAI A;  1DKA A;  1B5O A;  9AAT A;  1QIT A;  2VGV A;  1C4K A;  5DB5 A;  2BHX A;  2D64 A;  1N2T A;  1OAT A;  1TAS A;  1QGN A;  4F5I A;  1DGE A;  1TOI A;  1SZK A;  3N5M A;  1KKJ A;  2D7Y A;  2QBT A;  1JG8 A;  2Z9X A;  3PDX A;  4EB5 A;  3NUI A;  4WB0 B;  3MAF A;  4RM1 A;  2W7K A;  3VOM A;  2DGM A;  4MGR A;  4OBV A;  2EO5 A;  4A0H A;  1ECX A;  1QZ9 A;  4RIT A;  3NU7 A;  2BIG A;  1WYT B;  4CBS A;  3PPL A;  1MAP A;  1CZE A;  3E77 A;  1BKG A;  3G8M A;  1AMA A;  5TF5 A;  2O1B A;  4E3R A;  1YAA A;  3ZZK A;  1SVV A;  2VMO A;  4WD2 A;  2OGE A;  4WYC A;  3DU4 A;  2ZSM A;  5E4Z A;  3RUY A;  1ASD A;  4ATP A;  4BHD A;  5FT4 A;  3DYD A;  2HOR A;  1D7U A;  2BIE A;  2TPL A;  2Z61 A;  4RIZ A;  4BA4 A;  3WZF A;  4RJY A;  3CBF A;  1AMQ A;  4OBU A;  1YOO A;  2W7J A;  3H7F A;  2G6W A;  4RLG A;  5G4I A;  4F5K A;  3HL2 A;  3N0L A; 
#chains in the Genus database with same CATH topology
 4ZAS A;  4F5F A;  1CL1 A;  4JF1 A;  4ADD A;  1CZC A;  3D6K A;  2QSR A;  2YCN A;  4ZDL A;  1MAQ A;  3EIA A;  1TAR A;  1X28 A;  1C0N A;  3WX9 A;  1KKP A;  1S0A A;  2HOY A;  2ZY3 A;  4WLJ A;  1ART A;  4JF0 A;  3AEN B;  1AKB A;  4NOG A;  3K40 A;  1AJR A;  2YRR A;  2BYL A;  1I48 A;  3BCA A;  1J32 A;  1SPA A;  2GSA A;  1CL2 A;  5G09 A;  1IBJ A;  3FZ8 A;  5G4J A;  3P1T A;  4WBT A;  2Q7W A;  2Z9U A;  1AAW A;  1FG7 A;  3TFT A;  5F8V A;  2DOU A;  3GWP A;  3WGC A;  4A6T A;  2CJG A;  2PO3 A;  3A9X A;  2VMP A;  1O4S A;  2R5C A;  3A8U X;  1WST A;  4A0G A;  1B9H A;  1ARH A;  4GE9 A;  4W5K A;  2O7C A;  4AO9 A;  4F4E A;  4PIW A;  1AJS B;  3ECD A;  3F9T A;  4U1T A;  1MDZ A;  1ARS A;  1M0O A;  3DR7 A;  3IHJ A;  4M2M A;  3JU7 A;  2X8U A;  2VGZ A;  2E7J A;  2NMP A;  3LG0 A;  2VGT A;  5D95 A;  1MDX A;  1PMM A;  2Z1Z A;  3NYS A;  4W8I A;  3I5T A;  3NDN A;  4RAE A;  3A9Y A;  3B1C A;  3HT4 A;  1YJS A;  4LC3 A;  3LVL B;  1AJS A;  1TOE A;  1T3I A;  1LK9 A;  2JJF A;  2VGS A;  3FQ8 A;  2BI2 A;  5DX5 A;  3FQA A;  4ADE A;  4KXK A;  2VMN A;  4OYT A;  2BKW A;  3BWO A;  4B98 A;  4E77 A;  5J8Q A;  1ASN A;  4B9B A;  4LNJ A;  1RVU A;  2A1V A;  3I4J A;  3T32 A;  1ASG A;  1UU1 A;  1TOJ A;  1QIS A;  2HOZ A;  2HOX A;  4M2J A;  5G0A A;  2W7G A;  4ZM4 A;  1BJO B;  3WLX A;  3LVM A;  1ORD A;  3PJ0 A;  2CY8 A;  4A0R A;  2BI5 A;  4P7Y A;  2W7D A;  4TV7 A;  4OT8 A;  2FM1 A;  3K28 A;  2VGU A;  4LNL A;  4HVK A;  4KAM A;  5EUD A;  2W8T A;  4R2N A;  4A6R A;  4AO4 A;  4JEZ A;  4H51 A;  1BJO A;  3A2B A;  2AAT A;  3B1E A;  1M0N A;  4WYF A;  3UWC A;  4UHO A;  2W7F A;  2FN6 A;  2ZY4 A;  4ITG A;  3FDB A;  4ADB A;  2CFB A;  4W91 A;  3HLM A;  1GD9 A;  4UHN A;  4XJO A;  2VYC A;  5G2P A;  4R5Z A;  2HUU A;  2XBN A;  4E1O A;  4WXF A;  5HDM A;  2X5F A;  2GQN A;  2DKJ A;  4A6U A;  1D7S A;  3N4R A;  4XAU A;  1LC8 A;  2VIB A;  2WK9 A;  4UHM A;  1E5F A;  3MAF B;  4GEB A;  4JEY A;  1ASA A;  2W7H A;  3WY7 A;  3LVK A;  1GC4 A;  3I16 A;  3LY1 A;  3N4X A;  1YIZ A;  4A0F A;  1B5P A;  2BI3 A;  4ADC A;  1OHW A;  1H0C A;  2E7I A;  2VMS A;  4WYG A;  4UOY A;  3FKD A;  3NU8 A;  3LWS A;  4Q31 A;  1KMJ A;  4MQQ A;  1MLY A;  5G2Q A;  5M4B A;  2Z20 A;  5LH9 A;  1LW5 A;  3AAT A;  3VK2 A;  2JJH A;  2EPJ A;  1SZS A;  3AEP A;  2Z9W A;  2VMV A;  3G7Q A;  1CQ8 A;  1FC4 A;  1SF2 A;  3G0T A;  3EUC A;  2YRI A;  5E3K A;  4ZSY A;  4EU1 A;  1BJN A;  3LVJ A;  3NNK A;  2VI8 A;  3QI6 A;  3QHX A;  4TMR A;  1Y4I A;  1Z3Z A;  3EIB A;  3HQT A;  1M0Q A;  5EAV A;  1YJY A;  3EI9 A;  4WXB A;  3MAD A;  5D5S A;  3AEJ C;  2ZYJ A;  1JS3 A;  5EFS A;  4RJ0 A;  1XEY A;  5I92 A;  1O62 A;  3DZZ A;  1G4X A;  1GEY A;  1CJ0 A;  3BWN C;  2AEU A;  3ISL A;  4FFC A;  1FG3 A;  1W7L A;  1QJ5 A;  3PDB B;  1I41 A;  3PD6 A;  3AEM A;  3MEB A;  4ZAH A;  3N4S A;  3FVS A;  3RCH B;  2ZY5 A;  5DJ9 A;  1M0P A;  5EUN A;  3FDD A;  2CH2 A;  3NUB A;  3VK4 A;  2WB6 A;  3R9A A;  3QN6 A;  3DRD A;  2XH1 A;  1YJZ A;  2BWO A;  2QMA A;  4XJM A;  2PB2 A;  1JS6 A;  1AIA A;  5EAA A;  3PDB A;  1W3U A;  4DBC A;  2CST A;  1VEF A;  4BQ0 A;  4MKK A;  2R5C B;  1WKG A;  3RCH A;  7AAT A;  3FVU A;  3II0 A;  3WGB A;  1O61 A;  1WYV B;  1M7Y A;  3TAT A;  1ASL A;  3L44 A;  3FQ7 A;  4J8L A;  2JIS A;  3PGY A;  3E9K A;  2VMZ A;  1XI9 A;  1M32 A;  3MAU A;  1AMS A;  3AOW A;  1O69 A;  2AEV A;  1GEW A;  2BIA A;  5HHY A;  4WXG A;  1WYV A;  3RI6 A;  1S07 A;  2D5Y A;  4U2H A;  3ELE A;  4JE5 A;  2AY5 A;  3N7N A;  3AOV A;  2W8W A;  3TCM A;  3KGW A;  1ASE A;  2JGT A;  1DJE A;  4OTL A;  1QIR A;  2GMU A;  1CQ6 A;  3ATH A;  5AX8 A;  2JG2 A;  1ASM A;  4IXZ A;  3BC8 A;  2ZUK A;  4JE5 D;  4LNM A;  1KL1 A;  1UU2 A;  2R5E A;  4R5F A;  2BYJ A;  4ZWV A;  5K8B A;  4F5M A;  1Z7D A;  1ZC9 A;  3DR4 A;  4MQP A;  1VJO A;  2W8V A;  4EB7 A;  2GB3 A;  3QPG A;  1LS3 A;  1BT4 A;  3HDO A;  1PG8 A;  4Q6R A;  4TN4 A;  4Y0D A;  4MSO A;  1GDE A;  1BQA A;  2F8J A;  3AEM C;  4IXO A;  4Q75 A;  1AMR A;  1OHV A;  2QB3 A;  2D61 A;  3EI5 A;  4ZSW A;  1M6S A;  1WKH A;  2AY4 A;  2EZ2 A;  2OQX A;  3AEL A;  3L8A A;  4WP0 A;  2FKI A;  4CXR A;  1BJW A;  4PFF A;  4K2I A;  3QBO A;  3QM2 A;  2D65 A;  3GJU A;  4Y0H A;  2VMT A;  4ZDO A;  3ACZ A;  1B9I A;  3WCN A;  2YCP A;  3USF A;  1RVY A;  2VMR A;  3ZRP A;  4IXS A;  3AEJ A;  5KTB A;  1S09 A;  1BW0 A;  1CQ7 A;  4XJP A;  2VMW A;  3HBX A;  3ASB A;  4GE4 A;  3NRA A;  3BWN A;  3GET A;  3ZZJ A;  2CH1 A;  1IUG A;  3UE8 A;  1W23 A;  1YNU A;  2CJD A;  3AEO A;  5M4D A;  1ZOB A;  1S08 A;  2FNU A;  2R2N A;  3ZRQ A;  1AIB A;  3JWA A;  2YKV A;  3FZ6 A;  1ZOD A;  1IX7 A;  2HP2 A;  2JJE A;  1ARI A;  4WYE A;  5E5I A;  2AY2 A;  5F9S A;  2E7U A;  4IX8 A;  1ASB A;  1YIY A;  3F0H A;  2EH6 A;  1IX8 A;  2QLR A;  4OMA A;  2WK7 A;  4R8D A;  2VMQ A;  1V2E A;  2ZSL A;  1LW4 A;  3F6T A;  3A9Z A;  3AV7 A;  1KL2 A;  4AZK A;  4CVQ A;  2HUI A;  3B46 A;  2DKB A;  4IYO A;  3LV2 A;  3GZD C;  3K7Y A;  2CAN A;  3IF2 A;  1C7N A;  4WYD A;  2VI9 A;  3MC6 C;  4W1W A;  4JEX A;  2VIA A;  5EQC A;  2X3L A;  3HVY A;  1H1C A;  3FRK A;  1DFO A;  1DTY A;  1GC3 A;  3PIU A;  2GMS A;  2YKY A;  3EZS A;  5EUE A;  3JZL A;  2W7M A;  3NYU A;  4A72 A;  1GCK A;  1DGD A;  2DR1 A;  2CIN A;  3TFU A;  1KAF A;  2V1P A;  4P3M A;  4HF8 A;  1MGV A;  1X0M A;  3BCB A;  4EFF A;  2HP1 A;  5DJ1 A;  1QJ3 A;  1C9C A;  3WKR A;  1TAT A;  1IAX A;  1X29 A;  3GZC A;  2VMX A;  1IVR A;  1J04 A;  1MDO A;  1PMO A;  2C44 A;  2EZ1 A;  2W8U A;  3PD6 B;  3HMU A;  4W1X A;  3W1H A;  4XJL A;  4EMY A;  2CJH A;  3JWB A;  3WKS A;  3FCR A;  1SZU A;  2VLH A;  1OHY A;  3E2F A;  2D7Z A;  4F5J A;  1P3W A;  1OXP A;  1N31 A;  1D2F A;  1X2A A;  2C81 A;  2QB2 A;  3PA9 A;  2VLF A;  1UKJ A;  3NTJ A;  2YHK A;  1AKA A;  1ELQ A;  2BI1 A;  2HZP A;  1U08 A;  3DC1 A;  3FFH A;  3TQX A;  2VMU A;  4DQ6 A;  3H14 A;  3E2Y A;  3BB8 A;  1JF9 A;  2AY9 A;  1SFF A;  2AY3 A;  4GSA A;  4I8A A;  2BI9 A;  4XQ2 A;  2WKA A;  3RQ1 A;  1B4X A;  4Y0I A;  1B8G A;  4WB0 A;  1AHE A;  1AY5 A;  3BS8 A;  3H9X A;  2ZC0 A;  1LKC A;  4ZM3 A;  4K2B A;  3FTB A;  3DXW A;  4N0B A;  1GBN A;  1ASF A;  3BV0 A;  4M2K A;  1IX6 A;  2E54 A;  2FYF A;  4QGR A;  4F5G A;  1AHY A;  2FNI A;  1WYT A;  1C7O A;  2CTZ A;  2Z1Y A;  4N0W A;  3CQ5 A;  5FT8 A;  3B1D A;  1ARG A;  4ZDP A;  1AY8 A;  3NYT A;  1AX4 A;  2PB0 A;  2OAT A;  2EYQ A;  1ASC A;  1OXO A;  3EZ1 A;  1V72 A;  1AAM A;  3M5U A;  4GRX A;  4WYA A;  4RKD A;  4XEW A;  5M46 A;  3RBL A;  2AY8 A;  2D63 A;  2X5D A;  2D66 A;  4FL0 A;  1EG5 A;  3BN1 A;  4CBR A;  4AOA A;  2ZY2 A;  3VAX A;  2C0R A;  3VK3 A;  4E3Q A;  4AZJ A;  3ASA A;  2OKJ A;  2W7E A;  3FD0 A;  4ITX A;  5BJ4 A;  3OKS A;  1EJI A;  1E5E A;  3GZD A;  1G7X A;  8AAT A;  3RBF A;  3KKI A;  3WCO A;  3NX3 A;  3MC6 A;  3JTX A;  4JEW A;  1GC2 A;  2R0T A;  4BMK A;  1AHG A;  3ZRR A;  4DGT A;  4OCA A;  1BQD A;  3E2Z B;  3CQ4 A;  3CQ6 A;  1G4V A;  3QGU A;  2CB1 A;  2YKU A;  3AEN A;  2YOB A;  2ZP7 A;  2WK8 A;  2QA3 A;  4A00 A;  2BWN A;  3FFR A;  4WLH A;  5EIG B;  1AHF A;  2W7I A;  3E2Z A;  4LW2 A;  4ZLV A;  4K2M A;  2AY6 A;  4MY5 A;  2YCT A;  5FT6 A;  3COG A;  2OGA A;  1IJI A;  3JW9 A;  2W7L A;  4MQR A;  1N8P A;  1WYU B;  4L0O A;  4IY7 A;  1MLZ A;  4MKJ A;  5EIG A;  2OKK A;  3BCX A;  1LC7 A;  1ELU A;  1BJ4 A;  2BWP A;  3EI7 A;  3GR9 A;  3GSB A;  2FQ6 A;  3Q8N A;  1V2F A;  1I43 A;  2VGW A;  1EQB A;  4ATQ A;  1BS0 A;  2AY1 A;  2RFV A;  5BJ3 A;  3VP6 A;  4BA5 A;  3W1I A;  2V0Y A;  2W8J A;  1W7N A;  1WYU A;  5FT5 A;  2HUF A;  1TPL A;  1CS1 A;  4OC9 A;  1LC5 A;  4IYO B;  4F5L A;  4Q76 A;  1IAY A;  4PFN A;  3MBB A;  4W1V A;  4O6Z A;  4GDY A;  2EGY A;  2JJG A;  1C7G A;  3DOD A;  3E6G A;  5IWQ A;  3ELP A;  1V2D A;  4ISY A;  2DGL A;  3PAA A;  2Z67 A;  4XK1 A;  1D7R A;  2O0R A;  5LHA A;  1TOK A;  3EI8 A;  2VMY A;  1DJ9 A;  2DGK A;  3OP7 A;  3KE3 A;  2Z9V A;  4PVF A;  4IW7 A;  1GEX A;  5C6U A;  3B8X A;  4KYO A;  2KFP A;  1VP4 A;  3DXV A;  1I29 A;  4LW4 A;  2ORD A;  1G7W A;  1TOG A;  1AIC A;  3UAK A;  4AH3 A;  1W7M A;  3FVX A;  1S06 A;  3FZ7 A;  3W1J A;  3KGX A;  3P6K A;  3MKJ A;  3EI6 A;  1D7V A;  4F5H A;  5M49 A;  4ZWM A;  3FSL A;  1KMK A;  1PFF A;  1AY4 A;  4GE7 A;  3GBX A;  5JAY A;  1GC0 A;  1DJU A;  1M4N A;  4K05 A;  2C7T A;  4CXQ A;  1UU0 A;  1AKC A;  4J5U A;  1RV4 A;  5HXX A;  2ZJG A;  3R4T A;  4JEV A;  2AY7 A;  3N75 A;  1AHX A;  4RKC A;  4UQV A;  2YKX A;  2G7J A;  1RV3 A;  3CAI A;  1DKA A;  1B5O A;  9AAT A;  1QIT A;  2VGV A;  1C4K A;  5DB5 A;  2BHX A;  2D64 A;  1N2T A;  1OAT A;  1TAS A;  1QGN A;  4F5I A;  1DGE A;  1TOI A;  1SZK A;  3N5M A;  1KKJ A;  2D7Y A;  2QBT A;  1JG8 A;  2Z9X A;  3PDX A;  4EB5 A;  3NUI A;  4WB0 B;  3MAF A;  4RM1 A;  2W7K A;  3VOM A;  2DGM A;  4MGR A;  4OBV A;  2EO5 A;  4A0H A;  1ECX A;  1QZ9 A;  4RIT A;  3NU7 A;  2BIG A;  1WYT B;  4CBS A;  3PPL A;  1MAP A;  1CZE A;  3E77 A;  1BKG A;  3G8M A;  1AMA A;  5TF5 A;  2O1B A;  4E3R A;  1YAA A;  3ZZK A;  1SVV A;  2VMO A;  4WD2 A;  2OGE A;  4WYC A;  3DU4 A;  2ZSM A;  5E4Z A;  3RUY A;  1ASD A;  4ATP A;  4BHD A;  5FT4 A;  3DYD A;  2HOR A;  1D7U A;  2BIE A;  2TPL A;  2Z61 A;  4RIZ A;  4BA4 A;  3WZF A;  4RJY A;  4H63 Q;  3CBF A;  1AMQ A;  4OBU A;  1YOO A;  2W7J A;  3H7F A;  2G6W A;  4RLG A;  5G4I A;  4F5K A;  3HL2 A;  3N0L A; 
#chains in the Genus database with same CATH homology
 4ZAS A;  4F5F A;  1CL1 A;  4JF1 A;  4ADD A;  1CZC A;  3D6K A;  2QSR A;  2YCN A;  4ZDL A;  1MAQ A;  3EIA A;  1TAR A;  1X28 A;  1C0N A;  3WX9 A;  1KKP A;  1S0A A;  2HOY A;  2ZY3 A;  4WLJ A;  1ART A;  4JF0 A;  3AEN B;  1AKB A;  4NOG A;  3K40 A;  1AJR A;  2YRR A;  2BYL A;  1I48 A;  3BCA A;  1J32 A;  1SPA A;  2GSA A;  1CL2 A;  5G09 A;  1IBJ A;  3FZ8 A;  5G4J A;  3P1T A;  4WBT A;  2Q7W A;  2Z9U A;  1AAW A;  1FG7 A;  3TFT A;  5F8V A;  2DOU A;  3GWP A;  3WGC A;  4A6T A;  2CJG A;  2PO3 A;  3A9X A;  2VMP A;  1O4S A;  2R5C A;  3A8U X;  1WST A;  4A0G A;  1B9H A;  1ARH A;  4GE9 A;  4W5K A;  2O7C A;  4AO9 A;  4F4E A;  4PIW A;  1AJS B;  3ECD A;  3F9T A;  4U1T A;  1MDZ A;  1ARS A;  1M0O A;  3DR7 A;  3IHJ A;  4M2M A;  3JU7 A;  2X8U A;  2VGZ A;  2E7J A;  2NMP A;  3LG0 A;  2VGT A;  5D95 A;  1MDX A;  1PMM A;  2Z1Z A;  3NYS A;  4W8I A;  3I5T A;  3NDN A;  4RAE A;  3A9Y A;  3B1C A;  3HT4 A;  1YJS A;  4LC3 A;  3LVL B;  1AJS A;  1TOE A;  1T3I A;  1LK9 A;  2JJF A;  2VGS A;  3FQ8 A;  2BI2 A;  5DX5 A;  3FQA A;  4ADE A;  4KXK A;  2VMN A;  4OYT A;  2BKW A;  3BWO A;  4B98 A;  4E77 A;  5J8Q A;  1ASN A;  4B9B A;  4LNJ A;  1RVU A;  2A1V A;  3I4J A;  3T32 A;  1ASG A;  1UU1 A;  1TOJ A;  1QIS A;  2HOZ A;  2HOX A;  4M2J A;  5G0A A;  2W7G A;  4ZM4 A;  1BJO B;  3WLX A;  3LVM A;  1ORD A;  3PJ0 A;  2CY8 A;  4A0R A;  2BI5 A;  4P7Y A;  2W7D A;  4TV7 A;  4OT8 A;  2FM1 A;  3K28 A;  2VGU A;  4LNL A;  4HVK A;  4KAM A;  5EUD A;  2W8T A;  4R2N A;  4A6R A;  4AO4 A;  4JEZ A;  4H51 A;  1BJO A;  3A2B A;  2AAT A;  3B1E A;  1M0N A;  4WYF A;  3UWC A;  4UHO A;  2W7F A;  2FN6 A;  2ZY4 A;  4ITG A;  3FDB A;  4ADB A;  2CFB A;  4W91 A;  3HLM A;  1GD9 A;  4UHN A;  4XJO A;  2VYC A;  5G2P A;  4R5Z A;  2HUU A;  2XBN A;  4E1O A;  4WXF A;  5HDM A;  2X5F A;  2GQN A;  2DKJ A;  4A6U A;  1D7S A;  3N4R A;  4XAU A;  1LC8 A;  2VIB A;  2WK9 A;  4UHM A;  1E5F A;  3MAF B;  4GEB A;  4JEY A;  1ASA A;  2W7H A;  3WY7 A;  3LVK A;  1GC4 A;  3I16 A;  3LY1 A;  3N4X A;  1YIZ A;  4A0F A;  1B5P A;  2BI3 A;  4ADC A;  1OHW A;  1H0C A;  2E7I A;  2VMS A;  4WYG A;  4UOY A;  3FKD A;  3NU8 A;  3LWS A;  4Q31 A;  1KMJ A;  4MQQ A;  1MLY A;  5G2Q A;  5M4B A;  2Z20 A;  5LH9 A;  1LW5 A;  3AAT A;  3VK2 A;  2JJH A;  2EPJ A;  1SZS A;  3AEP A;  2Z9W A;  2VMV A;  3G7Q A;  1CQ8 A;  1FC4 A;  1SF2 A;  3G0T A;  3EUC A;  2YRI A;  5E3K A;  4ZSY A;  4EU1 A;  1BJN A;  3LVJ A;  3NNK A;  2VI8 A;  3QI6 A;  3QHX A;  4TMR A;  1Y4I A;  1Z3Z A;  3EIB A;  3HQT A;  1M0Q A;  5EAV A;  1YJY A;  3EI9 A;  4WXB A;  3MAD A;  5D5S A;  3AEJ C;  2ZYJ A;  1JS3 A;  5EFS A;  4RJ0 A;  1XEY A;  5I92 A;  1O62 A;  3DZZ A;  1G4X A;  1GEY A;  1CJ0 A;  3BWN C;  2AEU A;  3ISL A;  4FFC A;  1FG3 A;  1W7L A;  1QJ5 A;  3PDB B;  1I41 A;  3PD6 A;  3AEM A;  3MEB A;  4ZAH A;  3N4S A;  3FVS A;  3RCH B;  2ZY5 A;  5DJ9 A;  1M0P A;  5EUN A;  3FDD A;  2CH2 A;  3NUB A;  3VK4 A;  2WB6 A;  3R9A A;  3QN6 A;  3DRD A;  2XH1 A;  1YJZ A;  2BWO A;  2QMA A;  4XJM A;  2PB2 A;  1JS6 A;  1AIA A;  5EAA A;  3PDB A;  1W3U A;  4DBC A;  2CST A;  1VEF A;  4BQ0 A;  4MKK A;  2R5C B;  1WKG A;  3RCH A;  7AAT A;  3FVU A;  3II0 A;  3WGB A;  1O61 A;  1WYV B;  1M7Y A;  3TAT A;  1ASL A;  3L44 A;  3FQ7 A;  4J8L A;  2JIS A;  3PGY A;  3E9K A;  2VMZ A;  1XI9 A;  1M32 A;  3MAU A;  1AMS A;  3AOW A;  1O69 A;  2AEV A;  1GEW A;  2BIA A;  5HHY A;  4WXG A;  1WYV A;  3RI6 A;  1S07 A;  2D5Y A;  4U2H A;  3ELE A;  4JE5 A;  2AY5 A;  3N7N A;  3AOV A;  2W8W A;  3TCM A;  3KGW A;  1ASE A;  2JGT A;  1DJE A;  4OTL A;  1QIR A;  2GMU A;  1CQ6 A;  3ATH A;  5AX8 A;  2JG2 A;  1ASM A;  4IXZ A;  3BC8 A;  2ZUK A;  4JE5 D;  4LNM A;  1KL1 A;  1UU2 A;  2R5E A;  4R5F A;  2BYJ A;  4ZWV A;  5K8B A;  4F5M A;  1Z7D A;  1ZC9 A;  3DR4 A;  4MQP A;  1VJO A;  2W8V A;  4EB7 A;  2GB3 A;  3QPG A;  1LS3 A;  1BT4 A;  3HDO A;  1PG8 A;  4Q6R A;  4TN4 A;  4Y0D A;  4MSO A;  1GDE A;  1BQA A;  2F8J A;  3AEM C;  4IXO A;  4Q75 A;  1AMR A;  1OHV A;  2QB3 A;  2D61 A;  3EI5 A;  4ZSW A;  1M6S A;  1WKH A;  2AY4 A;  2EZ2 A;  2OQX A;  3AEL A;  3L8A A;  4WP0 A;  2FKI A;  4CXR A;  1BJW A;  4PFF A;  4K2I A;  3QBO A;  3QM2 A;  2D65 A;  3GJU A;  4Y0H A;  2VMT A;  4ZDO A;  3ACZ A;  1B9I A;  3WCN A;  2YCP A;  3USF A;  1RVY A;  2VMR A;  3ZRP A;  4IXS A;  3AEJ A;  5KTB A;  1S09 A;  1BW0 A;  1CQ7 A;  4XJP A;  2VMW A;  3HBX A;  3ASB A;  4GE4 A;  3NRA A;  3BWN A;  3GET A;  3ZZJ A;  2CH1 A;  1IUG A;  3UE8 A;  1W23 A;  1YNU A;  2CJD A;  3AEO A;  5M4D A;  1ZOB A;  1S08 A;  2FNU A;  2R2N A;  3ZRQ A;  1AIB A;  3JWA A;  2YKV A;  3FZ6 A;  1ZOD A;  1IX7 A;  2HP2 A;  2JJE A;  1ARI A;  4WYE A;  5E5I A;  2AY2 A;  5F9S A;  2E7U A;  4IX8 A;  1ASB A;  1YIY A;  3F0H A;  2EH6 A;  1IX8 A;  2QLR A;  4OMA A;  2WK7 A;  4R8D A;  2VMQ A;  1V2E A;  2ZSL A;  1LW4 A;  3F6T A;  3A9Z A;  3AV7 A;  1KL2 A;  4AZK A;  4CVQ A;  2HUI A;  3B46 A;  2DKB A;  4IYO A;  3LV2 A;  3GZD C;  3K7Y A;  2CAN A;  3IF2 A;  1C7N A;  4WYD A;  2VI9 A;  3MC6 C;  4W1W A;  4JEX A;  2VIA A;  5EQC A;  2X3L A;  3HVY A;  1H1C A;  3FRK A;  1DFO A;  1DTY A;  1GC3 A;  3PIU A;  2GMS A;  2YKY A;  3EZS A;  5EUE A;  3JZL A;  2W7M A;  3NYU A;  4A72 A;  1GCK A;  1DGD A;  2DR1 A;  2CIN A;  3TFU A;  2V1P A;  4P3M A;  4HF8 A;  1MGV A;  1X0M A;  3BCB A;  4EFF A;  2HP1 A;  5DJ1 A;  1QJ3 A;  1C9C A;  3WKR A;  1TAT A;  1IAX A;  1X29 A;  3GZC A;  2VMX A;  1IVR A;  1J04 A;  1MDO A;  1PMO A;  2C44 A;  2EZ1 A;  2W8U A;  3PD6 B;  3HMU A;  4W1X A;  3W1H A;  4XJL A;  4EMY A;  2CJH A;  3JWB A;  3WKS A;  3FCR A;  1SZU A;  2VLH A;  1OHY A;  3E2F A;  2D7Z A;  4F5J A;  1P3W A;  1OXP A;  1N31 A;  1D2F A;  1X2A A;  2C81 A;  2QB2 A;  3PA9 A;  2VLF A;  1UKJ A;  3NTJ A;  2YHK A;  1AKA A;  1ELQ A;  2BI1 A;  2HZP A;  1U08 A;  3DC1 A;  3FFH A;  3TQX A;  2VMU A;  4DQ6 A;  3H14 A;  3E2Y A;  3BB8 A;  1JF9 A;  2AY9 A;  1SFF A;  2AY3 A;  4GSA A;  4I8A A;  2BI9 A;  4XQ2 A;  2WKA A;  3RQ1 A;  1B4X A;  4Y0I A;  1B8G A;  4WB0 A;  1AHE A;  1AY5 A;  3BS8 A;  3H9X A;  2ZC0 A;  1LKC A;  4ZM3 A;  4K2B A;  3FTB A;  3DXW A;  4N0B A;  1GBN A;  1ASF A;  3BV0 A;  4M2K A;  1IX6 A;  2E54 A;  2FYF A;  4QGR A;  4F5G A;  1AHY A;  2FNI A;  1WYT A;  1C7O A;  2CTZ A;  2Z1Y A;  4N0W A;  3CQ5 A;  5FT8 A;  3B1D A;  1ARG A;  4ZDP A;  1AY8 A;  3NYT A;  1AX4 A;  2PB0 A;  2OAT A;  2EYQ A;  1ASC A;  1OXO A;  3EZ1 A;  1V72 A;  1AAM A;  3M5U A;  4GRX A;  4WYA A;  4RKD A;  4XEW A;  5M46 A;  3RBL A;  2AY8 A;  2D63 A;  2X5D A;  2D66 A;  4FL0 A;  1EG5 A;  3BN1 A;  4CBR A;  4AOA A;  2ZY2 A;  3VAX A;  2C0R A;  3VK3 A;  4E3Q A;  4AZJ A;  3ASA A;  2OKJ A;  2W7E A;  3FD0 A;  4ITX A;  5BJ4 A;  3OKS A;  1EJI A;  1E5E A;  3GZD A;  1G7X A;  8AAT A;  3RBF A;  3KKI A;  3WCO A;  3NX3 A;  3MC6 A;  3JTX A;  4JEW A;  1GC2 A;  2R0T A;  4BMK A;  1AHG A;  3ZRR A;  4DGT A;  4OCA A;  1BQD A;  3E2Z B;  3CQ4 A;  3CQ6 A;  1G4V A;  3QGU A;  2CB1 A;  2YKU A;  3AEN A;  2YOB A;  2ZP7 A;  2WK8 A;  2QA3 A;  4A00 A;  2BWN A;  3FFR A;  4WLH A;  5EIG B;  1AHF A;  2W7I A;  3E2Z A;  4LW2 A;  4ZLV A;  4K2M A;  2AY6 A;  4MY5 A;  2YCT A;  5FT6 A;  3COG A;  2OGA A;  1IJI A;  3JW9 A;  2W7L A;  4MQR A;  1N8P A;  1WYU B;  4L0O A;  4IY7 A;  1MLZ A;  4MKJ A;  5EIG A;  2OKK A;  3BCX A;  1LC7 A;  1ELU A;  1BJ4 A;  2BWP A;  3EI7 A;  3GR9 A;  3GSB A;  2FQ6 A;  3Q8N A;  1V2F A;  1I43 A;  2VGW A;  1EQB A;  4ATQ A;  1BS0 A;  2AY1 A;  2RFV A;  5BJ3 A;  3VP6 A;  4BA5 A;  3W1I A;  2V0Y A;  2W8J A;  1W7N A;  1WYU A;  5FT5 A;  2HUF A;  1TPL A;  1CS1 A;  4OC9 A;  1LC5 A;  4IYO B;  4F5L A;  4Q76 A;  1IAY A;  4PFN A;  3MBB A;  4W1V A;  4O6Z A;  4GDY A;  2EGY A;  2JJG A;  1C7G A;  3DOD A;  3E6G A;  5IWQ A;  3ELP A;  1V2D A;  4ISY A;  2DGL A;  3PAA A;  2Z67 A;  4XK1 A;  1D7R A;  2O0R A;  5LHA A;  1TOK A;  3EI8 A;  2VMY A;  1DJ9 A;  2DGK A;  3OP7 A;  3KE3 A;  2Z9V A;  4PVF A;  4IW7 A;  1GEX A;  5C6U A;  3B8X A;  4KYO A;  2KFP A;  1VP4 A;  3DXV A;  1I29 A;  4LW4 A;  2ORD A;  1G7W A;  1TOG A;  1AIC A;  3UAK A;  4AH3 A;  1W7M A;  3FVX A;  1S06 A;  3FZ7 A;  3W1J A;  3KGX A;  3P6K A;  3MKJ A;  3EI6 A;  1D7V A;  4F5H A;  5M49 A;  4ZWM A;  3FSL A;  1KMK A;  1PFF A;  1AY4 A;  4GE7 A;  3GBX A;  5JAY A;  1GC0 A;  1DJU A;  1M4N A;  4K05 A;  2C7T A;  4CXQ A;  1UU0 A;  1AKC A;  4J5U A;  1RV4 A;  5HXX A;  2ZJG A;  3R4T A;  4JEV A;  2AY7 A;  3N75 A;  1AHX A;  4RKC A;  4UQV A;  2YKX A;  2G7J A;  1RV3 A;  3CAI A;  1DKA A;  1B5O A;  9AAT A;  1QIT A;  2VGV A;  1C4K A;  5DB5 A;  2BHX A;  2D64 A;  1N2T A;  1OAT A;  1TAS A;  1QGN A;  4F5I A;  1DGE A;  1TOI A;  1SZK A;  3N5M A;  1KKJ A;  2D7Y A;  2QBT A;  1JG8 A;  2Z9X A;  3PDX A;  4EB5 A;  3NUI A;  4WB0 B;  3MAF A;  4RM1 A;  2W7K A;  3VOM A;  2DGM A;  4MGR A;  4OBV A;  2EO5 A;  4A0H A;  1ECX A;  1QZ9 A;  4RIT A;  3NU7 A;  2BIG A;  1WYT B;  4CBS A;  3PPL A;  1MAP A;  1CZE A;  3E77 A;  1BKG A;  3G8M A;  1AMA A;  5TF5 A;  2O1B A;  4E3R A;  1YAA A;  3ZZK A;  1SVV A;  2VMO A;  4WD2 A;  2OGE A;  4WYC A;  3DU4 A;  2ZSM A;  5E4Z A;  3RUY A;  1ASD A;  4ATP A;  4BHD A;  5FT4 A;  3DYD A;  2HOR A;  1D7U A;  2BIE A;  2TPL A;  2Z61 A;  4RIZ A;  4BA4 A;  3WZF A;  4RJY A;  4H63 Q;  3CBF A;  1AMQ A;  4OBU A;  1YOO A;  2W7J A;  3H7F A;  2G6W A;  4RLG A;  5G4I A;  4F5K A;  3HL2 A;  3N0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...