2ZY3A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
510
structure length
510
Chain Sequence
b'ELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-aspartate beta-decarboxylase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
total genus 189
structure length 510
sequence length 510
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy3A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy3A01
3AEJA 1C7NA 1WYUB 3WGCA 2BIAA 1AHYA 1BKGA 3HLMA 2ZY2A 1PG8A 2BI2A 4ATQA 2F8JA 1M0NA 3AEMC 1AAWA 1AY5A 5EAAA 5JAYA 2CY8A 2HOYA 2ZY3A 2CFBA 3H7FA 3BWNC 3P6KA 4TN4A 4W8IA 4WB0B 3G8MA 4PFFA 1W7LA 3R9AA 4WYFA 3UE8A 4DBCA 4ADEA 3KKIA 1GEWA 2QB2A 4XJMA 1I48A 2ZC0A 3BB8A 3ISLA 2OGEA 4UQVA 1WYVA 3VK2A 1Y4IA 3E6GA 3AEJC 4IY7A 4WYAA 4IXSA 1ASMA 1AKBA 4ZSWA 3EUCA 3NTJA 2XBNA 1RV3A 1YAAA 2E7JA 1B8GA 2YCTA 3ASAA 4A6TA 3GZCA 1J04A 1BJNA 5I92A 4WLHA 4AH3A 3RQ1A 1IX6A 3WKRA 2BI9A 4W1WA 2FNUA 2EPJA 4WYCA 3N5MA 2CJHA 3NRAA 5J8QA 4A00A 1LKCA 3MAFA 4MSOA 3NNKA 2VGWA 3LWSA 1CQ7A 1UKJA 2JGTA 1ASGA 3F9TA 2WK8A 4K2IA 3TQXA 4XJLA 2FYFA 1WKHA 1MAQA 2W7LA 1N2TA 3PD6B 5AX8A 1D7RA 1ZC9A 9AATA 3WGBA 4GRXA 3QBOA 2QB3A 2HOZA 2VMWA 1MDZA 1AJSA 1WYVB 4F5HA 4M2KA 2Z20A 3GSBA 3TFTA 4W1XA 4IYOB 1IUGA 1S08A 1AMSA 1CZCA 3GETA 4W91A 2AY3A 1B5OA 2D5YA 1QZ9A 1X29A 4AZKA 1AMQA 1ASLA 3EI7A 3A9ZA 1ZODA 4K2MA 2R0TA 2CINA 3ASBA 3QI6A 4H51A 1ARTA 3B46A 1IJIA 2W7GA 2X5FA 5G4IA 2GSAA 1ARSA 1IAYA 2EZ1A 4OMAA 5M46A 3K28A 1AIBA 4ADDA 2CJGA 5F8VA 1DJEA 4I8AA 4BA4A 4U2HA 1LC7A 2W8UA 3NYSA 2VMRA 3QGUA 4AO9A 4F5LA 2BHXA 3D6KA 4GSAA 5G09A 1ARGA 1W3UA 4E3QA 1DFOA 2DR1A 3EIAA 2VMPA 1QJ5A 4BQ0A 2Z1YA 4GE7A 2VGSA 1I43A 3AOVA 3JWBA 1AIAA 2YCNA 2ORDA 1B9HA 5G0AA 3DZZA 1C7OA 2DOUA 3NDNA 3PPLA 1O4SA 2HUIA 1V2EA 3NYTA 3RBLA 3DXVA 2W8WA 1EQBA 1V72A 2BI5A 2QLRA 1T3IA 4ISYA 1BJ4A 2Z9XA 5HXXA 2BI3A 4O6ZA 4Y0HA 4ZM3A 1FG3A 4XK1A 3RCHB 1WYUA 4E1OA 3FKDA 1TOJA 3FRKA 1IVRA 1DTYA 4NOGA 4ZAHA 1OHYA 2W8JA 2C44A 3DRDA 4WYEA 1N31A 3NYUA 2OATA 2DKBA 1WKGA 3E2ZB 3LY1A 2R2NA 3PGYA 5EIGA 4JEYA 1EG5A 4KXKA 5K8BA 3JW9A 2W8VA 1I41A 3JWAA 1YIYA 3FDBA 4LW4A 2AY4A 1I29A 2VMUA 3ZRPA 3QN6A 1BJOA 4F4EA 2YOBA 3EI9A 3OP7A 1M32A 2PB0A 3TFUA 2CJDA 3MBBA 2R5CA 4W1VA 1V2DA 3FTBA 1AAMA 1AHFA 3PJ0A 5FT5A 1RV4A 3G7QA 4WP0A 4MQPA 1V2FA 4K2BA 1OATA 2FQ6A 2VGTA 3GZDA 2YKUA 1GD9A 4A6RA 5E5IA 2YHKA 4F5JA 1QIRA 1J32A 4ITXA 3I4JA 2VMZA 1MAPA 3N0LA 4ZWMA 2D66A 2ZSLA 4ZM4A 4FFCA 3FQ8A 3MAUA 4LNLA 1BW0A 1ZOBA 5EIGB 3TATA 3PD6A 1GEXA 1M0OA 4ZDPA 2VLFA 4LNMA 1TPLA 4JEWA 2ZYJA 1SZSA 2BWPA 3ECDA 2AY5A 1E5FA 1BJOB 1AX4A 1TOIA 2ZSMA 4ZDLA 4R5FA 5E3KA 2R5CB 3GJUA 2YKXA 4IYOA 5D5SA 1ASFA 5HDMA 7AATA 1D7VA 1P3WA 2VIBA 3CBFA 5FT4A 3A9YA 4WXBA 2JG2A 4E77A 1AKAA 3LVLB 1CL2A 1VJOA 2VLHA 4MKJA 1M0PA 2EGYA 2JJHA 2VI9A 3B1DA 2VMTA 2VYCA 3NU7A 4PIWA 2W7HA 4ZDOA 1GBNA 1GC0A 4GEBA 2BYJA 2YKVA 3BC8A 4J5UA 2D7YA 4F5IA 2WK9A 3ELPA 1PFFA 3GBXA 2VMOA 3N75A 5EFSA 4PFNA 1UU2A 4XAUA 4E3RA 5G2PA 1GDEA 3MC6A 4TMRA 1KKPA 3ZRRA 1SZKA 4IXOA 4JEVA 3Q8NA 2NMPA 1JS3A 3BCAA 2BYLA 2W7MA 3TCMA 2JJGA 4XJPA 4RKDA 3RUYA 1O69A 2AY9A 3II0A 3PA9A 2CH2A 3DODA 4F5MA 1CL1A 2E7UA 1ORDA 1FC4A 1LS3A 2D7ZA 3QPGA 1QITA 3M5UA 2VMSA 4CVQA 3CQ4A 3CAIA 2VMXA 1AICA 3BN1A 1AMRA 1TASA 2QBTA 2BIEA 3AOWA 4UHNA 1CZEA 2HUUA 4XJOA 4WXFA 3FVUA 3RCHA 2FN6A 2V1PA 1U08A 4BHDA 3KGWA 4PVFA 3MC6C 5HHYA 1AY4A 3KGXA 1ARHA 1SF2A 1DKAA 1D2FA 3AEPA 2XH1A 3NUIA 1B9IA 4IXZA 5DJ9A 1QISA 2W7FA 3BCBA 4Q75A 4UOYA 3AV7A 4A0FA 1BJWA 3MKJA 5C6UA 4L0OA 2ZJGA 1D7SA 3AENB 3IHJA 3ATHA 3E2ZA 4B98A 1TOGA 3HMUA 8AATA 4GDYA 4QGRA 4KYOA 2ZP7A 5F9SA 2C81A 1TOEA 4N0WA 4JEXA 4CXRA 3LVJA 1LW5A 4EB5A 2FNIA 4UHMA 5D95A 2W7EA 3L44A 1FG7A 4R2NA 1G7XA 2D63A 3EI6A 2W7KA 2TPLA 4HF8A 2Z1ZA 3VOMA 1MLYA 2BWOA 4ZWVA 2EH6A 4MQRA 4ZLVA 3ELEA 3WLXA 3VK4A 3ZZJA 3PIUA 1C0NA 4Q6RA 5EUEA 1G4XA 4A72A 1D7UA 2W7DA 1WSTA 2HP2A 1ASCA 2E54A 2W7JA 1MDOA 1WYTA 1AHEA 4WBTA 1ASNA 5E4ZA 1G7WA 4GE4A 1Z7DA 2VMYA 1SPAA 3FQ7A 1AY8A 3DR7A 4B9BA 1CQ8A 3CQ5A 5M4DA 3LVKA 3DR4A 1B5PA 2O7CA 2HUFA 3UWCA 1BS0A 3WX9A 1X28A 1ELUA 4ADBA 4RKCA 1YJZA 1OXPA 4AZJA 1GC3A 4KAMA 4MQQA 2AY7A 2ZY5A 2CSTA 3F6TA 3FSLA 3I5TA 4FL0A 4P3MA 1BQAA 4R8DA 2AATA 5EUDA 4F5KA 1RVUA 1IX8A 4A0GA 2WKAA 1MDXA 1SVVA 1LC8A 2VGUA 2RFVA 2Z9WA 4BA5A 3DU4A 1Z3ZA 3HL2A 3L8AA 1VEFA 3BWOA 1O62A 3R4TA 4ZSYA 2W7IA 2YRRA 2VGZA 4XEWA 3ZZKA 1WYTB 5EAVA 1IBJA 3PDBB 2BWNA 1GCKA 4RAEA 4WXGA 1O61A 3E2FA 1KMKA 1N8PA 1M6SA 4WD2A 1SFFA 1YNUA 3ACZA 1G4VA 3LVMA 1GC4A 1MGVA 3B1EA 4DGTA 4WLJA 4EB7A 1ASBA 2BIGA 4Y0IA 3FVSA 4ATPA 3JTXA 3MEBA 2BKWA 3GZDC 2PB2A 4WYDA 1DGEA 2HORA 2HP1A 4LNJA 1C4KA 3BV0A 2O0RA 1ASAA 3A9XA 4BMKA 1LK9A 1OHWA 3AELA 4LW2A 1H1CA 2JJEA 2EO5A 2QA3A 1TARA 1IX7A 1MLZA 2GMSA 4A0RA 2AY8A 2PO3A 2VMQA 1YJYA 4AOAA 1AMAA 2D64A 2QMAA 3WY7A 5DB5A 3T32A 2E7IA 5EQCA 3BS8A 1W7MA 3B8XA 2R5EA 3BCXA 1ASEA 3AENA 2X8UA 3DXWA 3FFRA 2AY6A 4EU1A 1OHVA 3HQTA 3OKSA 2VI8A 2YKYA 3E9KA 3NUBA 3COGA 2D61A 2HZPA 3EIBA 1JS6A 2Z9VA 3P1TA 3CQ6A 1OXOA 3NU8A 5TF5A 3VAXA 4IX8A 4JF1A 5FT8A 2Q7WA 4Y0DA 2WK7A 4CBSA 4UHOA 1YJSA 1XI9A 2AY1A 1TOKA 4A0HA 2CTZA 1EJIA 3FDDA 2CH1A 3K7YA 2FM1A 3DYDA 4XQ2A 3WZFA 2C7TA 3PAAA 4A6UA 1DGDA 1KL2A 1E5EA 2HOXA 2V0YA 3EZ1A 3QHXA 1IAXA 1AJRA 4OC9A 2OGAA 3FVXA 3NX3A 3PDXA 1B4XA 1ARIA 2AY2A 3F0HA 4LC3A 4JF0A 4IW7A 3USFA 1AHGA 1ASDA 1C7GA 2D65A 3DC1A 4Q76A 2EZ2A 1QJ3A 3HDOA 1TATA 2DKJA 1KMJA 2YRIA 3B1CA 1AHXA 1M7YA 3AEOA 5BJ3A 4OYTA 4Q31A 2CB1A 1UU0A 4W5KA 2Z9UA 1M4NA 3KE3A 1AKCA 5G2QA 5IWQA 4ADCA 3MAFB 2OQXA 5M49A 1SZUA 1S06A 3EI5A 3GR9A 2ZUKA 1JF9A 3FCRA 4WYGA 2GQNA 1H0CA 4MY5A 1C9CA 4M2JA 4F5FA 4DQ6A 2Z61A 2VMVA 3WKSA 3A8UX 4RJYA 4EFFA 4M2MA 3EZSA 1QGNA 2VGVA 3A2BA 4U1TA 3E2YA 3FQAA 5BJ4A 4R5ZA 1AJSB 1S07A 4HVKA 1ECXA 1M0QA 1X0MA 1RVYA 5EUNA 2GMUA 2O1BA 1YOOA 2YCPA 3PDBA 3FFHA 3EI8A 2BI1A 1YIZA 1GC2A 3MADA 5DJ1A 1S09A 4AO4A 1UU1A 1CQ6A 2G6WA 1W23A 1S0AA 1CS1A 1GEYA 3E77A 5FT6A 4CBRA 3LG0A 5G4JA 3AATA 4GE9A 4OTLA 1W7NA 1BT4A 4ITGA 2C0RA 3LV2A 1DJUA 1LC5A 2VMNA 3K40A 4F5GA 3RI6A 2ZY4A 4P7YA 4OCAA 5M4BA 2W8TA 3AEMA 4WB0A 4JEZA 2GB3A 3RBFA 1DJ9A 4OT8A 2VIAA 2X5DA 1KL1A 3BWNA 3UAKA 4EMYA 1BQDA 2CANA 1ELQA 2JJFA 4CXQA 1CJ0A 5DX5A 3VK3A 1JG8A 1LW4A 1VP4A 3ZRQA 1KKJA 1X2AA 4MKKA 3QM2A 4ZASA
chains in the Genus database with same CATH superfamily
3W96D 3AZLB 3X1UD 3AN2D 2BIAA 1ID3C 3NQJA 4ATQA 3X1SB 5AVCC 3AEMC 5EAAA 4H9PA 3H7FA 4J8UB 4YM6D 3P6KA 5AV9C 4X23B 4TN4A 3R9AA 4XUJB 4WYFA 5B40B 1I48A 3BB8A 3ISLA 3VK2A 3X1VC 3AEJC 4H63Q 4Z2MH 5AY8A 1RV3A 1YAAA 3ASAA 4H9NA 1B8GA 1P3IC 3UTAB 1BJNA 4AH3A 3RQ1A 1M18A 2FNUA 5B1MD 5J8QA 3NNKA 1UKJA 2PYOD 3F9TA 2WK8A 3TQXA 3UT9A 5BNXB 5B32A 4QLCC 3B0DB 3WGBA 4GRXA 3QBOA 2QB3A 3MGQB 2HOZA 2VMWA 3AV1D 2OKKA 3GSBA 3TFTA 4W1XA 1TZYB 3AYWA 3REIC 1B5OA 3W98A 2JSSA 2F8NH 2YFWA 3A9ZA 2CINA 3ASBA 1B67A 3AZKA 3B46A 4R8PB 1IJIA 2X5FA 1ARSA 1IAYA 2NZDD 3B6FD 3WA9A 3K28A 2CJGA 1DJEA 3W96B 2Y2OA 4U2HA 3QGUA 4F5LA 5G09A 3AZFD 4GE7A 2F8NB 1I43A 3JWBA 3N7NA 3X1VD 3DZZA 1ZLAD 3N4RA 3RBLA 1P3GC 1EQBA 4H9SC 3AZMD 5BO0B 5GSUA 2Z9XA 2BI3A 4O6ZA 4ZM3A 4XK1A 4JJNB 4Z66D 3AV2B 1IVRA 3AZEB 2W8JA 2BYKB 4WNNA 1R4VA 3NYUA 2OATA 2DKBA 1WKGA 3E2ZB 4J8UA 4WU9B 4H9RB 4JEYA 1EG5A 4KXKA 4XUJA 4K05A 5C3IB 2VMUA 3ZRPA 3QN6A 1BJOA 1M32A 3AZJB 3FTBA 3PJ0A 5FT5A 1RV4A 5F99C 3C1CB 3G7QA 5GT0B 4AWLB 3B6GD 2VGTA 2DGLA 5B33A 5E5IA 4F5JA 1QIRA 1J32A 5B2JB 3I4JA 3KFUG 1MAPA 3N0LA 4ZWMA 2D66A 3LZ0B 4ZM4A 3FQ8A 5BNXA 3TATA 5AV6C 3W97C 3AZHC 1M0OA 4ZDPA 1TPLA 4YS3A 2AROA 3WKJC 3MGQA 5E3KA 5B1LC 2R5CB 3WAAC 1ASFA 3EPHA 4KGCD 1D7VA 2CWEA 4E77A 2JG2A 1AKAA 3LVLB 3LJAD 1CL2A 4MKJA 2EGYA 2JJHA 2VI9A 5FUGB 2XD1A 4XZQD 3NU7A 5BNVB 1GC0A 4GEBA 4F5IA 2WB6A 1Q9CA 4PFNA 3MC6A 1KKPA 1SZKA 1EQZB 2CV5D 2W7MA 1P3KD 3TCMA 4RKDA 3II0A 3PA9A 3N4XA 2F8NA 3DODA 3MVDB 1P3AC 1ORDA 1LS3A 1KX4D 3QPGA 3M5UA 1P3PC 3CQ4A 3CAIA 3AZID 5BO0A 1TASA 2QBTA 2BIEA 3AFAD 2RVQC 3C1BD 2V1PA 5GXQC 3AV2A 1KX5B 3B6GB 5DJ9A 2XH1A 1QISA 3BCBA 3V9RA 5B0YD 2BYKA 2ZJGA 3E2ZA 4WU9A 4H9RA 4KYOA 3WKJD 1TOEA 4N0WA 3LVJA 3L44A 4R2NA 1G7XA 2W7KA 2TPLA 3W1IA 3VOMA 2EH6A 3C1CA 5GT0A 3WLXA 4WJ3C 4G91B 5AVBA 2HP2A 2E54A 3VH6A 4J8WA 2W7JA 3MNNB 1G7WA 5AV8A 3EPLA 3NQUA 3MGRA 3CQ5A 3DR4A 2HUFA 3EPJA 4RKCA 1OXPA 4AZJA 1TAFA 1GC3A 3FSLA 4P3MA 2XD5A 2AATA 5EUDA 2NQBD 3AZNB 1MDXA 2RFVA 3DU4A 1Z3ZA 5AVCA 5FUGA 5CPIC 3R4TA 5B0ZB 1M1AC 2W7IA 4J8XC 1IBJA 3PDBB 5BT1C 1BH8A 4Z5TD 1YNUA 3TU4C 1MGVA 1EQZA 1ASBA 3JTXA 2HORA 5E5AC 1OHWA 3KXBA 1H1CA 1IX7A 1MLZA 2Y2KA 3WY7A 3A6ND 1KX5A 5DB5A 3BS8A 3LELD 3DXWA 2X8UA 4G92C 4ZUXD 3OKSA 3NUBA 3UTBC 3EIBA 3CQ6A 3VAXA 4JF1A 4UHOA 2AY1A 1XI9A 4KUDC 1TOKA 1EJIA 3FDDA 5DNMD 3K7YA 4XQ2A 3WZFA 2HIOB 2C7TA 3PAAA 1E5EA 5CPID 1P3MD 3USFA 1C7GA 3MNNA 2D65A 1QJ3A 1TATA 5CP6C 3KWQC 2YRIA 1AOIA 4OYTA 2FJ7C 1M4NA 5G2QA 3MAFB 5E5AD 4E44A 1SZUA 1S06A 3EI5A 1S32A 5CPJC 2GQNA 1H0CA 1P3BC 4M2JA 4DQ6A 4J8LA 3AZNA 4EFFA 4M2MA 4WV4B 3EZSA 3A2BA 5BJ4A 3E2YA 3FQAA 4R5ZA 1JFIB 1RVYA 5EUNA 2GMUA 3PDBA 3EI8A 3MADA 5DJ1A 3WTPE 1W23A 4CBRA 3AATA 3W99B 1F66B 2Y2PA 1W7NA 3WTPB 3WCNA 2DGKA 2HUEC 5B31A 4WB0A 4JEZA 1KL1A 3BWNA 4EMYA 5G49B 3RELB 1BFMA 1CJ0A 3VK3A 2DQNC 1LW4A 4MKKA 3UT9D 2FJ7D 5B1LA 3X1TC 1AHYA 2ZY2A 2F8JA 5AV5D 1M0NA 3R45A 5JAYA 2VQRA 4M6BA 2HOYA 2ZY3A 3GWPA 4W8IA 1W7LA 3KKIA 2JISA 4XJMA 3MGPC 2OGEA 1WYVA 3E6GA 1P3LB 3AZKD 1ASMA 1AKBA 4ZSWA 3NTJA 2DF4C 1U35A 4WU8A 1P3AA 4WLHA 1IX6A 3VH5A 3WKRA 1P3PA 4WYCA 2CJHA 3MAFA 4MSOA 1CQ7A 2JGTA 5CPKC 2FYFA 4H9PB 1F1EA 1N2TA 3FZ7A 1D7RA 9AATA 5JA4A 5GSUD 3MGSC 1JFIA 5AY8B 1AMSA 3O62C 1CZCA 3AZLD 2AY3A 5B2IB 1QZ9A 4AZKA 3X1SD 1M18B 1ZODA 4H9QB 3W96C 4H51A 1ARTA 3X1UC 3AN2C 4J8UD 2W7GA 5G4IA 2GSAA 4X23D 2EZ1A 1F66A 4Z2MG 3H0RC 4XUJD 3FZ8A 5F8VA 5B40D 5B32B 1LC7A 4YM6C 5DNNA 2BHXA 4J8VB 2Z1YA 2VGSA 2ORDA 1B9HA 3UTAD 2DOUA 3AYWB 1O4SA 3W98B 2HUIA 3NYTA 3RELA 2IO5B 2BI5A 1T3IA 3AZGB 3AZEC 5JRGB 3RCHB 5B1MC 3WA9B 1DTYA 4ZAHA 2PYOC 3DRDA 2F8NG 3MGQD 4WYEA 2R2NA 5EIGA 1TZYD 5BS7C 1M1AA 3JW9A 3REHA 3AV1C 4F4EA 3OP7A 2PB0A 4AWLC 3TU4A 4W1VA 4DRAA 4R8PD 1AHFA 4WP0A 5B2JC 1V2FA 4K2BA 4A6RA 2YHKA 4ITXA 2VMZA 2NZDC 3B6FC 2YFVB 4WNNB 2ZSLA 2F8ND 4LNLA 1BW0A 2ZYJA 3AZFC 1BJOB 1TOIA 4ZDLA 2YKXA 1ZLAC 4JJND 3REJA 7AATA 5B2IA 3AV2D 1P3WA 3CBFA 3AZMC 3AZED 4WXBA 1KX3B 2VLHA 5B33B 3HVYA 4H9QA 5GT3B 4Z66C 4KUDA 4ZDOA 4WU9D 4PIWA 3BC8A 4J5UA 1P3OB 2WK9A 3N75A 2VMOA 5EFSA 1UU2A 5G2PA 3AZJD 3MVDC 4LD9B 4TMRA 3ZRRA 4IXOA 4JEVA 4YS3B 2NMPA 2AROB 2BYLA 4J8VA 4XJPA 3RUYA 3C1CD 5GT0D 2D7ZA 2VMSA 4CVQA 3KWQA 1HQ3B 3BN1A 5B2JD 1P3FB 3AOWA 3AZGA 4UHNA 1CZEA 3B6GC 3LZ0D 5B24B 5JRGA 3RCHA 2FN6A 1U08A 4PVFA 1DKAA 4IXZA 4UOYA 4A0FA 3A1KA 1BJWA 2BYMA 1D7SA 3AENB 3G0TA 4EB5A 4UHMA 5D95A 4CSRB 4KGCC 4G91C 1MLYA 4ZLVA 3LJAC 1C0NA 4NFTA 1P34A 4XZQC 1EQZD 3V9RB 2YFVA 1MDOA 1AHEA 3MVDD 1Z7DA 3FQ7A 2CV5C 1CQ8A 3LZ1B 1P3KC 1B5PA 3WX9A 4ADBA 1KX4C 4MQQA 4UUZA 3I5TA 4FL0A 3AZIC 1KX5D 1RVUA 5B0ZC 3X1TA 1KX3A 3AFAC 1LC8A 3C1BC 2VGUA 5AVBB 5GT3A 3L8AA 3BWOA 1O62A 4J8WB 2VGZA 4XEWA 4EO5B 1P3OA 4RAEA 3B0CW 5AV8B 5B0YC 4WXGA 3NQUB 1N8PA 3REKB 4LD9A 3MGRB 4EB7A 2BIGA 2F2AC 2BKWA 2FKIA 1TAFB 4WYDA 4LNJA 1C4KA 1PZRA 2O0RA 1HQ3A 4BMKA 1LK9A 1P3FA 1ID3B 2JJEA 2QA3A 5B24A 5AVCB 3MNND 1PMOA 1YJYA 1AMAA 2QMAA 1BH8B 5AV9B 5EQCA 3AENA 2AY6A 3KUYA 4DRBA 1M19A 3COGA 1JS6A 2Z9VA 3O62A 1OXOA 4H9OB 4IX8A 3AZND 4CSRA 5FT8A 2HIOC 2WK7A 1P3IB 3KXBB 2CH1A 5B0ZD 2FM1A 3DYDA 2Y2QA 3X1UA 2LY8A 2NQBC 1B4XA 2Y2IA 4QLCB 4RLGA 4Q76A 3VH6W 4Z5TC 1AHXA 3LZ1A 4KHAA 2Z9UA 1AKCA 5IWQA 4ADCA 3GR9A 3FCRA 1C9CA 2Z61A 5B1MA 3A8UX 2VGVA 1N1JB 2PYOA 1AJSB 3A6NC 2Y2NA 1ECXA 1M0QA 1X0MA 2O1BA 1A7WA 3LELC 3A1IA 1YIZA 1S09A 4AO4A 3REKA 3AV1A 4ZUXC 1AOIB 2G6WA 3WTPC 1GEYA 3E77A 1P3GB 3LG0A 2HIOD 1ULYA 1S32B 1LC5A 5DNMC 1ID3A 3RI6A 2ZY4A 3B6FA 2W8TA 3AEMA 2Y2HA 3P5JB 1P3MC 5AV9A 3UAKA 1BQDA 2CANA 4CXQA 2QSRA 1VP4A 1KKJA 1X2AA 2J8PA 3QM2A 4ATPA 3X1VA 3AEJA 1ZLAA 3H0MC 1B6WA 4E45A 5F99B 1BKGA 4H9OA 2BI2A 1P3IA 1AAWA 1AY5A 4Z66A 2CFBA 5B31B 4WB0B 3G8MA 3UE8A 1P3LC 3I16A 3WCOA 4ADEA 2G5HC 1GEWA 5AV6B 4UQVA 3AZHB 4QLCA 4WYAA 4IXSA 2XBNA 3W99D 1F66D 2E7JA 3GZCA 5B1LB 3WTPD 3FZ6A 3WAAB 3REIA 3FD0A 2EPJA 4A00A 3LWSA 3R45B 1WKHA 1MAQA 2W7LA 3PD6B 2Y2LA 5AX8A 1ZC9A 3RELD 1N1JA 1AJSA 1WYVB 2Z20A 4IYOB 1M18C 3GETA 4W91A 2BG1A 1U35B 4WU8B 1X29A 1P3AB 1ASLA 3EI7A 4K2MA 2R0TA 3UT9C 1P3PB 3QI6A 1P3GA 5B32C 4H9SA 4OMAA 5AV5C 1AIBA 4ADDA 4BA4A 3NYSA 5GXQB 2VMRA 3D6KA 1P3LD 4GSAA 1W3UA 5JA4B 1QJ5A 4NE6A 2IO5C 1AIAA 3NDNA 3AZKC 1V2EA 2CV5A 2QLRA 4ISYA 3B0CT 3WA9C 5HXXA 5B32G 4Y0HA 1KX4A 4E1OA 3FRKA 5F99A 1N31A 3C1BA 5DNNB 3PGYA 5AY8D 5K8BA 2W8VA 5B2ID 2RIQA 1YIYA 2AY4A 1I29A 2KFPA 2YOBA 5GSUC 3W97A 5AV6A 3AZHA 1M18D 3EI9A 3TFUA 1V2DA 3AZLC 1AAMA 3WKJA 1OATA 3X1SC 2W8SA 2YKUA 3WAAA 5B32D 4J8UC 4X23C 3W1HA 4HGAB 4XUJC 3VH5W 4J8VD 5B40C 4FFCA 5EIGB 3PD6A 3AYWD 1M1AB 4JEWA 1SZSA 3W98D 3ECDA 4J8XB 3REHB 1AX4A 4R5FA 2AEUA 3AZGD 3HT4A 3TU4B 3UTAC 5JRGD 4IYOA 5D5SA 2VIBA 4OBUA 3WA9D 5FT4A 3A9YA 3VH6T 3B1DA 2W7HA 2BYJA 3B0DC 3MGQC 3ELPA 1PFFA 3GBXA 4XAUA 5GXQA 1TZYC 3Q8NA 3BCAA 2DGMA 2JJGA 1O69A 4F5MA 2CH2A 1FC4A 4G92B 1QITA 3REJB 4OBVA 3UTBB 1AICA 2VMXA 4R8PC 1AMRA 4XJOA 3FVUA 2ZM5A 4KUDB 4BHDA 3KGWA 3MC6C 5HHYA 1ARHA 1SF2A 3VK4A 3AEPA 3NUIA 1B9IA 2W7FA 1W2EA 3MKJA 5C6UA 3IHJA 4B98A 3HMUA 4GDYA 2ZP7A 5F9SA 4JEXA 1KX3D 2W7EA 5CP6B 5B33D 3KWQB 1FG7A 4JJNC 5GT3D 4ZUXA 4HF8A 3AV2C 2Z1ZA 2BWOA 1P3OD 3ZZJA 5EUEA 1G4XA 4A72A 5CPJB 1D7UA 4LD9D 1WSTA 4WU9C 1P3BB 4YS3D 2AROD 2BYMB 1WYTA 5C3IC 5E4ZA 4GE4A 5CPIA 1SPAA 2VMYA 3AZJC 1AY8A 3DR7A 4B9BA 4J8XA 1HQ3D 5M4DA 3LVKA 2O7CA 1P3FD 3C1CC 5GT0C 1BS0A 1X28A 3IP4C 1ELUA 5B24D 2AY7A 2ZY5A 5AVBC 4WZSB 3HBXA 4R8DA 1IX8A 4DQYB 4J8WC 1SVVA 3LZ0C 2Z9WA 5E5AA 1P34B 4BA5A 5AV8C 3HL2A 1VEFA 2JCHA 4ZSYA 2HUEB 3MGRC 4WD2A 3ACZA 1G4VA 3LVMA 3B1EA 4Y0IA 3MEBA 3GZDC 4CAYA 1DGEA 4UUZB 3BV0A 3AL0C 3A9XA 3UTBA 3AELA 3X1TB 1TARA 2VMQA 4AOAA 3T32A 1EQZC 3LZ1D 4ZBJB 1BH9A 3BCXA 1ASEA 3FFRA 3MGPB 3P1TA 3KXBC 5TF5A 5CP6A 5AVBD 4RJ0A 4A0HA 2FJ7A 4J8WD 1KX5C 4A6UA 5AV8D 3QHXA 5CPKB 1AJRA 5AV5A 5CPJA 3REKD 3MGRD 1P3BA 4LC3A 4JF0A 1AHGA 1ASDA 3KUYB 2EZ2A 1M19B 3MGSB 3B1CA 4Q31A 2CB1A 3O62B 4W5KA 1ID3D 2OQXA 5AVCD 4WYGA 3X1UB 3AN2B 4F5FA 5AV9D 2VMVA 3WKSA 1QGNA 3MNNC 1WWIA 4HVKA 4YM6B 1AOIC 2BI1A 3VH5T 4UPKA 1UU1A 1P3ID 1S32C 4KHAB 1S0AA 3KXBD 5G4JA 3AZLA 4OTLA 3AZNC 1BT4A 3LV2A 3X1SA 4QLCD 5B1MB 4F5GA 4X23A 2PYOB 5M4BA 2GB3A 2Y2MA 1DJ9A 5B40A 4OT8A 2X5DA 3REID 3AV1B 3ZRQA 3MGPA 4ZASA 1C7NA 3UTAA 1WYUB 3WGCA 2G5IC 3HLMA 1PG8A 2X3LA 5B31C 2CY8A 3BWNC 2NZDB 3B6FB 4PFFA 4DBCA 5CPKA 2QB2A 2ZC0A 3VP6A 1AOID 1Y4IA 4IY7A 1P3GD 1TZYA 3AZFB 3EUCA 4A6TA 2YCTA 3MGSA 1S32D 1J04A 3X1VB 1ZLAB 5I92A 2BI9A 4W1WA 5B31G 3N5MA 3NRAA 3AZMB 1LKCA 4R8PA 3EPKA 2VGWA 1ASGA 2EYQA 4K2IA 4XJLA 4Z66B 3W96A 3AN2A 2L5AA 1U35C 1MDZA 4WU8C 4F5HA 4M2KA 4YM6A 1IUGA 1S08A 5F99D 2D5YA 1AMQA 2FFFB 3REIB 4JJNA 5B31D 5M46A 3AZEA 4I8AA 1H3OB 5AV6D 3W97D 2W8UA 3AZHD 4AO9A 1ARGA 4E3QA 1DFOA 2DR1A 3EIAA 2VMPA 4BQ0A 3AOVA 2YCNA 5G0AA 5B1LD 1C7OA 3PPLA 3WAAD 5BS7A 3AZJA 3DXVA 2W8WA 1V72A 3W99C 4RM1A 1F66C 1BJ4A 1FG3A 1WYUA 3FKDA 1TOJA 4KGCB 5DNNC 1T3UA 4NOGA 5B2JA 1OHYA 3LJAB 2C44A 1Z2CB 3KSYA 3LZ0A 4XZQB 3LY1A 1HTAA 2NZDA 3RELC 1I41A 1U35D 3JWAA 3FDBA 4WU8D 4LW4A 1P3AD 2CJDA 3MBBA 2F8NK 1P3PD 2R5CA 2CV5B 3AZFA 1P3KB 4MQPA 2RVQD 1KX4B 2FQ6A 4HGAC 3GZDA 1GD9A 3AZIB 5GXQD 3AZMA 3JZLA 3AFAB 5BNVA 3C1BB 3REHC 3MAUA 1ZOBA 1GEXA 2VLFA 4LNMA 2BWPA 2AY5A 1E5FA 2ZSMA 5B0YB 3W97B 3GJUA 3MVDA 5KDMB 5HDMA 3WKJB 3H0LC 1VJOA 1M0PA 2VMTA 5DNND 2VYCA 2Y2GA 1GBNA 3B6GA 1KAFA 2YKVA 2D7YA 1H3OA 4E3RA 1GDEA 5AY8C 1JS3A 3REJC 5B2IC 2AY9A 1CL1A 2E7UA 2HUUA 4WXFA 4KGCA 1AY4A 1M1AD 3KGXA 1D2FA 4NE5A 4J8XD 2NQBB 5BT1D 3LJAA 3REHD 1KU5A 4Q75A 3AV7A 4J8VC 4L0OA 4RIZA 3ATHA 3TU4D 4XZQA 1TOGA 8AATA 3AYWC 4QGRA 3W98C 2C81A 3H9XA 4CXRA 3AZGC 1LW5A 2FNIA 4Z5TB 5JRGC 2D63A 3EI6A 1P3KA 4ZWVA 4MQRA 3ELEA 3PIUA 4Q6RA 3AZIA 3EG5B 2W7DA 1ASCA 1XEYA 5B0ZA 3AFAA 4WBTA 1ASNA 3A6NB 3REJD 3UTBD 3UWCA 3LELB 5B0YA 5KDMA 1YJZA 4ZUXB 4KAMA 4KUDD 2CSTA 3F6TA 1P34C 2AEVA 1BQAA 4F5KA 4A0GA 2WKAA 2Y2JA 5DNMB 1WWSA 2YRRA 3ZZKA 1WYTB 5EAVA 2BWNA 1GCKA 5CPIB 1O61A 3E2FA 1KMKA 1M6SA 1SFFA 1P3MB 5CP6D 1GC4A 3KWQD 4DGTA 4WLJA 3FVSA 1KX3C 2PB2A 2HP1A 5B33C 5GT3C 5CPJD 1ASAA 4LW2A 1P3BD 2EO5A 2HIOA 5E5AB 1P3OC 2GMSA 4A0RA 2AY8A 2PO3A 4ZBJC 2D64A 4LD9C 4YS3C 2AROC 2E7IA 2NQBA 1W7MA 3B8XA 2R5EA 4EU1A 1OHVA 3HQTA 2VI8A 2YKYA 3E9KA 1HQ3C 2D61A 2HZPA 1P3FC 3NU8A 4CAYB 3NQJB 2Q7WA 4Z5TA 4Y0DA 4CBSA 5B24C 1P34D 1YJSA 2CTZA 1DGDA 1KL2A 2HOXA 2V0YA 3EZ1A 1IAXA 4OC9A 2OGAA 3FVXA 1PMMA 3NX3A 3PDXA 1ARIA 3KUYC 2AY2A 3F0HA 1M19C 4IW7A 3W1JA 1BH9B 3DC1A 4H9NB 2A1VA 3HDOA 3A6NA 2DKJA 1KMJA 1M7YA 3AEOA 5BJ3A 1UU0A 3LELA 3X1TD 3KE3A 5M49A 3W99A 3UT9B 2FJ7B 3WTPA 2ZUKA 1JF9A 5CHLB 4RITA 4MY5A 4RJYA 5AV5B 4U1TA 1S07A 3MGPD 5DNMA 1YOOA 2YCPA 2JE5A 3LZ1C 3FFHA 5G49A 1GC2A 2G7JA 2YFWB 1P3MA 1CQ6A 2OKJA 1CS1A 3AZKB 5FT6A 4GE9A 4ITGA 5CPKD 3B0BA 2C0RA 5KTBA 1DJUA 4NE3A 2VMNA 3K40A 4P7YA 4EO5C 4OCAA 3KUYD 3RBFA 1M19D 3MGSD 2VIAA 3REKC 3N4SA 3O62D 1P3LA 1ELQA 2JJFA 5DX5A 2UWXA 1JG8A 5GSUB
chains in the Genus database with same CATH topology
3W96D 3AZLB 3X1UD 3AN2D 2BIAA 1ID3C 3NQJA 4ATQA 3X1SB 5AVCC 3AEMC 5EAAA 4H9PA 3H7FA 4J8UB 4YM6D 3P6KA 5AV9C 4X23B 4TN4A 3R9AA 4XUJB 4WYFA 5B40B 1I48A 3BB8A 3ISLA 3VK2A 3X1VC 3AEJC 4H63Q 4Z2MH 5AY8A 1RV3A 1YAAA 3ASAA 4H9NA 1B8GA 1P3IC 3UTAB 1BJNA 4AH3A 3RQ1A 1M18A 2FNUA 5B1MD 5J8QA 3NNKA 1UKJA 2PYOD 3F9TA 2WK8A 3TQXA 3UT9A 5BNXB 5B32A 4QLCC 3B0DB 3WGBA 4GRXA 3QBOA 2QB3A 3MGQB 2HOZA 2VMWA 3AV1D 2OKKA 3GSBA 3TFTA 4W1XA 1TZYB 3AYWA 3REIC 1B5OA 3W98A 2JSSA 2F8NH 2YFWA 3A9ZA 2CINA 3ASBA 1B67A 3AZKA 3B46A 4R8PB 1IJIA 2X5FA 1ARSA 1IAYA 2NZDD 3B6FD 3WA9A 3K28A 2CJGA 1DJEA 3W96B 2Y2OA 4U2HA 3QGUA 4F5LA 5G09A 3AZFD 4GE7A 2F8NB 1I43A 3JWBA 3N7NA 3X1VD 3DZZA 1ZLAD 3N4RA 3RBLA 1P3GC 1EQBA 4H9SC 3AZMD 5BO0B 5GSUA 2Z9XA 2BI3A 4O6ZA 4ZM3A 4XK1A 4JJNB 4Z66D 3AV2B 1IVRA 3AZEB 2W8JA 2BYKB 4WNNA 1R4VA 3NYUA 2OATA 2DKBA 1WKGA 3E2ZB 4J8UA 4WU9B 4H9RB 4JEYA 1EG5A 4KXKA 4XUJA 4K05A 5C3IB 2VMUA 3ZRPA 3QN6A 1BJOA 1M32A 3AZJB 3FTBA 3PJ0A 5FT5A 1RV4A 5F99C 3C1CB 3G7QA 5GT0B 4AWLB 3B6GD 2VGTA 2DGLA 5B33A 5E5IA 4F5JA 1QIRA 1J32A 5B2JB 3I4JA 3KFUG 1MAPA 3N0LA 4ZWMA 2D66A 3LZ0B 4ZM4A 3FQ8A 5BNXA 3TATA 5AV6C 3W97C 3AZHC 1M0OA 4ZDPA 1TPLA 4YS3A 2AROA 3WKJC 3MGQA 5E3KA 5B1LC 2R5CB 3WAAC 1ASFA 3EPHA 4KGCD 1D7VA 2CWEA 4E77A 2JG2A 1AKAA 3LVLB 3LJAD 1CL2A 4MKJA 2EGYA 2JJHA 2VI9A 5FUGB 2XD1A 4XZQD 3NU7A 5BNVB 1GC0A 4GEBA 4F5IA 2WB6A 1Q9CA 4PFNA 3MC6A 1KKPA 1SZKA 1EQZB 2CV5D 2W7MA 1P3KD 3TCMA 4RKDA 3II0A 3PA9A 3N4XA 2F8NA 3DODA 3MVDB 1P3AC 1ORDA 1LS3A 1KX4D 3QPGA 3M5UA 1P3PC 3CQ4A 3CAIA 3AZID 5BO0A 1TASA 2QBTA 2BIEA 3AFAD 2RVQC 3C1BD 2V1PA 5GXQC 3AV2A 1KX5B 3B6GB 5DJ9A 2XH1A 1QISA 3BCBA 3V9RA 5B0YD 2BYKA 2ZJGA 3E2ZA 4WU9A 4H9RA 4KYOA 3WKJD 1TOEA 4N0WA 3LVJA 3L44A 4R2NA 1G7XA 2W7KA 2TPLA 3W1IA 3VOMA 2EH6A 3C1CA 5GT0A 3WLXA 4WJ3C 4G91B 5AVBA 2HP2A 2E54A 3VH6A 4J8WA 2W7JA 3MNNB 1G7WA 5AV8A 3EPLA 3NQUA 3MGRA 3CQ5A 3DR4A 2HUFA 3EPJA 4RKCA 1OXPA 4AZJA 1TAFA 1GC3A 3FSLA 4P3MA 2XD5A 2AATA 5EUDA 2NQBD 3AZNB 1MDXA 2RFVA 3DU4A 1Z3ZA 5AVCA 5FUGA 5CPIC 3R4TA 5B0ZB 1M1AC 2W7IA 4J8XC 1IBJA 3PDBB 5BT1C 1BH8A 4Z5TD 1YNUA 3TU4C 1MGVA 1EQZA 1ASBA 3JTXA 2HORA 5E5AC 1OHWA 3KXBA 1H1CA 1IX7A 1MLZA 2Y2KA 3WY7A 3A6ND 1KX5A 5DB5A 3BS8A 3LELD 3DXWA 2X8UA 4G92C 4ZUXD 3OKSA 3NUBA 3UTBC 3EIBA 3CQ6A 3VAXA 4JF1A 4UHOA 2AY1A 1XI9A 4KUDC 1TOKA 1EJIA 3FDDA 5DNMD 3K7YA 4XQ2A 3WZFA 2HIOB 2C7TA 3PAAA 1E5EA 5CPID 1P3MD 3USFA 1C7GA 3MNNA 2D65A 1QJ3A 1TATA 5CP6C 3KWQC 2YRIA 1AOIA 4OYTA 2FJ7C 1M4NA 5G2QA 3MAFB 5E5AD 4E44A 1SZUA 1S06A 3EI5A 1S32A 5CPJC 2GQNA 1H0CA 1P3BC 4M2JA 4DQ6A 4J8LA 3AZNA 4EFFA 4M2MA 4WV4B 3EZSA 3A2BA 5BJ4A 3E2YA 3FQAA 4R5ZA 1JFIB 1RVYA 5EUNA 2GMUA 3PDBA 3EI8A 3MADA 5DJ1A 3WTPE 1W23A 4CBRA 3AATA 3W99B 1F66B 2Y2PA 1W7NA 3WTPB 3WCNA 2DGKA 2HUEC 5B31A 4WB0A 4JEZA 1KL1A 3BWNA 4EMYA 5G49B 3RELB 1BFMA 1CJ0A 3VK3A 2DQNC 1LW4A 4MKKA 3UT9D 2FJ7D 5B1LA 3X1TC 1AHYA 2ZY2A 2F8JA 5AV5D 1M0NA 3R45A 5JAYA 2VQRA 4M6BA 2HOYA 2ZY3A 3GWPA 4W8IA 1W7LA 3KKIA 2JISA 4XJMA 3MGPC 2OGEA 1WYVA 3E6GA 1P3LB 3AZKD 1ASMA 1AKBA 4ZSWA 3NTJA 2DF4C 1U35A 4WU8A 1P3AA 4WLHA 1IX6A 3VH5A 3WKRA 1P3PA 4WYCA 2CJHA 3MAFA 4MSOA 1CQ7A 2JGTA 5CPKC 2FYFA 4H9PB 1F1EA 1N2TA 3FZ7A 1D7RA 9AATA 5JA4A 5GSUD 3MGSC 1JFIA 5AY8B 1AMSA 3O62C 1CZCA 3AZLD 2AY3A 5B2IB 1QZ9A 4AZKA 3X1SD 1M18B 1ZODA 4H9QB 3W96C 4H51A 1ARTA 3X1UC 3AN2C 4J8UD 2W7GA 5G4IA 2GSAA 4X23D 2EZ1A 1F66A 4Z2MG 3H0RC 4XUJD 3FZ8A 5F8VA 5B40D 5B32B 1LC7A 4YM6C 5DNNA 2BHXA 4J8VB 2Z1YA 2VGSA 2ORDA 1B9HA 3UTAD 2DOUA 3AYWB 1O4SA 3W98B 2HUIA 3NYTA 3RELA 2IO5B 2BI5A 1T3IA 3AZGB 3AZEC 5JRGB 3RCHB 5B1MC 3WA9B 1DTYA 4ZAHA 2PYOC 3DRDA 2F8NG 3MGQD 4WYEA 2R2NA 5EIGA 1TZYD 5BS7C 1M1AA 3JW9A 3REHA 3AV1C 4F4EA 3OP7A 2PB0A 4AWLC 3TU4A 4W1VA 4DRAA 4R8PD 1AHFA 4WP0A 5B2JC 1V2FA 4K2BA 4A6RA 2YHKA 4ITXA 2VMZA 2NZDC 3B6FC 2YFVB 4WNNB 2ZSLA 2F8ND 4LNLA 1BW0A 2ZYJA 3AZFC 1BJOB 1TOIA 4ZDLA 2YKXA 1ZLAC 4JJND 3REJA 7AATA 5B2IA 3AV2D 1P3WA 3CBFA 3AZMC 3AZED 4WXBA 1KX3B 2VLHA 5B33B 3HVYA 4H9QA 5GT3B 4Z66C 4KUDA 4ZDOA 4WU9D 4PIWA 3BC8A 4J5UA 1P3OB 2WK9A 3N75A 2VMOA 5EFSA 1UU2A 5G2PA 3AZJD 3MVDC 4LD9B 4TMRA 3ZRRA 4IXOA 4JEVA 4YS3B 2NMPA 2AROB 2BYLA 4J8VA 4XJPA 3RUYA 3C1CD 5GT0D 2D7ZA 2VMSA 4CVQA 3KWQA 1HQ3B 3BN1A 5B2JD 1P3FB 3AOWA 3AZGA 4UHNA 1CZEA 3B6GC 3LZ0D 5B24B 5JRGA 3RCHA 2FN6A 1U08A 4PVFA 1DKAA 4IXZA 4UOYA 4A0FA 3A1KA 1BJWA 2BYMA 1D7SA 3AENB 3G0TA 4EB5A 4UHMA 5D95A 4CSRB 4KGCC 4G91C 1MLYA 4ZLVA 3LJAC 1C0NA 4NFTA 1P34A 4XZQC 1EQZD 3V9RB 2YFVA 1MDOA 1AHEA 3MVDD 1Z7DA 3FQ7A 2CV5C 1CQ8A 3LZ1B 1P3KC 1B5PA 3WX9A 4ADBA 1KX4C 4MQQA 4UUZA 3I5TA 4FL0A 3AZIC 1KX5D 1RVUA 5B0ZC 3X1TA 1KX3A 3AFAC 1LC8A 3C1BC 2VGUA 5AVBB 5GT3A 3L8AA 3BWOA 1O62A 4J8WB 2VGZA 4XEWA 4EO5B 1P3OA 4RAEA 3B0CW 5AV8B 5B0YC 4WXGA 3NQUB 1N8PA 3REKB 4LD9A 3MGRB 4EB7A 2BIGA 2F2AC 2BKWA 2FKIA 1TAFB 4WYDA 4LNJA 1C4KA 1PZRA 2O0RA 1HQ3A 4BMKA 1LK9A 1P3FA 1ID3B 2JJEA 2QA3A 5B24A 5AVCB 3MNND 1PMOA 1YJYA 1AMAA 2QMAA 1BH8B 5AV9B 5EQCA 3AENA 2AY6A 3KUYA 4DRBA 1M19A 3COGA 1JS6A 2Z9VA 3O62A 1OXOA 4H9OB 4IX8A 3AZND 4CSRA 5FT8A 2HIOC 2WK7A 1P3IB 3KXBB 2CH1A 5B0ZD 2FM1A 3DYDA 2Y2QA 3X1UA 2LY8A 2NQBC 1B4XA 2Y2IA 4QLCB 4RLGA 4Q76A 3VH6W 4Z5TC 1AHXA 3LZ1A 4KHAA 2Z9UA 1AKCA 5IWQA 4ADCA 3GR9A 3FCRA 1C9CA 2Z61A 5B1MA 3A8UX 2VGVA 1N1JB 2PYOA 1AJSB 3A6NC 2Y2NA 1ECXA 1M0QA 1X0MA 2O1BA 1A7WA 3LELC 3A1IA 1YIZA 1S09A 4AO4A 3REKA 3AV1A 4ZUXC 1AOIB 2G6WA 3WTPC 1GEYA 3E77A 1P3GB 3LG0A 2HIOD 1ULYA 1S32B 1LC5A 5DNMC 1ID3A 3RI6A 2ZY4A 3B6FA 2W8TA 3AEMA 2Y2HA 3P5JB 1P3MC 5AV9A 3UAKA 1BQDA 2CANA 4CXQA 2QSRA 1VP4A 1KKJA 1X2AA 2J8PA 3QM2A 4ATPA 3X1VA 3AEJA 1ZLAA 3H0MC 1B6WA 4E45A 5F99B 1BKGA 4H9OA 2BI2A 1P3IA 1AAWA 1AY5A 4Z66A 2CFBA 5B31B 4WB0B 3G8MA 3UE8A 1P3LC 3I16A 3WCOA 4ADEA 2G5HC 1GEWA 5AV6B 4UQVA 3AZHB 4QLCA 4WYAA 4IXSA 2XBNA 3W99D 1F66D 2E7JA 3GZCA 5B1LB 3WTPD 3FZ6A 3WAAB 3REIA 3FD0A 2EPJA 4A00A 3LWSA 3R45B 1WKHA 1MAQA 2W7LA 3PD6B 2Y2LA 5AX8A 1ZC9A 3RELD 1N1JA 1AJSA 1WYVB 2Z20A 4IYOB 1M18C 3GETA 4W91A 2BG1A 1U35B 4WU8B 1X29A 1P3AB 1ASLA 3EI7A 4K2MA 2R0TA 3UT9C 1P3PB 3QI6A 1P3GA 5B32C 4H9SA 4OMAA 5AV5C 1AIBA 4ADDA 4BA4A 3NYSA 5GXQB 2VMRA 3D6KA 1P3LD 4GSAA 1W3UA 5JA4B 1QJ5A 4NE6A 2IO5C 1AIAA 3NDNA 3AZKC 1V2EA 2CV5A 2QLRA 4ISYA 3B0CT 3WA9C 5HXXA 5B32G 4Y0HA 1KX4A 4E1OA 3FRKA 5F99A 1N31A 3C1BA 5DNNB 3PGYA 5AY8D 5K8BA 2W8VA 5B2ID 2RIQA 1YIYA 2AY4A 1I29A 2KFPA 2YOBA 5GSUC 3W97A 5AV6A 3AZHA 1M18D 3EI9A 3TFUA 1V2DA 3AZLC 1AAMA 3WKJA 1OATA 3X1SC 2W8SA 2YKUA 3WAAA 5B32D 4J8UC 4X23C 3W1HA 4HGAB 4XUJC 3VH5W 4J8VD 5B40C 4FFCA 5EIGB 3PD6A 3AYWD 1M1AB 4JEWA 1SZSA 3W98D 3ECDA 4J8XB 3REHB 1AX4A 4R5FA 2AEUA 3AZGD 3HT4A 3TU4B 3UTAC 5JRGD 4IYOA 5D5SA 2VIBA 4OBUA 3WA9D 5FT4A 3A9YA 3VH6T 3B1DA 2W7HA 2BYJA 3B0DC 3MGQC 3ELPA 1PFFA 3GBXA 4XAUA 5GXQA 1TZYC 3Q8NA 3BCAA 2DGMA 2JJGA 1O69A 4F5MA 2CH2A 1FC4A 4G92B 1QITA 3REJB 4OBVA 3UTBB 1AICA 2VMXA 4R8PC 1AMRA 4XJOA 3FVUA 2ZM5A 4KUDB 4BHDA 3KGWA 3MC6C 5HHYA 1ARHA 1SF2A 3VK4A 3AEPA 3NUIA 1B9IA 2W7FA 1W2EA 3MKJA 5C6UA 3IHJA 4B98A 3HMUA 4GDYA 2ZP7A 5F9SA 4JEXA 1KX3D 2W7EA 5CP6B 5B33D 3KWQB 1FG7A 4JJNC 5GT3D 4ZUXA 4HF8A 3AV2C 2Z1ZA 2BWOA 1P3OD 3ZZJA 5EUEA 1G4XA 4A72A 5CPJB 1D7UA 4LD9D 1WSTA 4WU9C 1P3BB 4YS3D 2AROD 2BYMB 1WYTA 5C3IC 5E4ZA 4GE4A 5CPIA 1SPAA 2VMYA 3AZJC 1AY8A 3DR7A 4B9BA 4J8XA 1HQ3D 5M4DA 3LVKA 2O7CA 1P3FD 3C1CC 5GT0C 1BS0A 1X28A 3IP4C 1ELUA 5B24D 2AY7A 2ZY5A 5AVBC 4WZSB 3HBXA 4R8DA 1IX8A 4DQYB 4J8WC 1SVVA 3LZ0C 2Z9WA 5E5AA 1P34B 4BA5A 5AV8C 3HL2A 1VEFA 2JCHA 4ZSYA 2HUEB 3MGRC 4WD2A 3ACZA 1G4VA 3LVMA 3B1EA 4Y0IA 3MEBA 3GZDC 4CAYA 1DGEA 4UUZB 3BV0A 3AL0C 3A9XA 3UTBA 3AELA 3X1TB 1TARA 2VMQA 4AOAA 3T32A 1EQZC 3LZ1D 4ZBJB 1BH9A 3BCXA 1ASEA 3FFRA 3MGPB 3P1TA 3KXBC 5TF5A 5CP6A 5AVBD 4RJ0A 4A0HA 2FJ7A 4J8WD 1KX5C 4A6UA 5AV8D 3QHXA 5CPKB 1AJRA 5AV5A 5CPJA 3REKD 3MGRD 1P3BA 4LC3A 4JF0A 1AHGA 1ASDA 3KUYB 2EZ2A 1M19B 3MGSB 3B1CA 4Q31A 2CB1A 3O62B 4W5KA 1ID3D 2OQXA 5AVCD 4WYGA 3X1UB 3AN2B 4F5FA 5AV9D 2VMVA 3WKSA 1QGNA 3MNNC 1WWIA 4HVKA 4YM6B 1AOIC 2BI1A 3VH5T 4UPKA 1UU1A 1P3ID 1S32C 4KHAB 1S0AA 3KXBD 5G4JA 3AZLA 4OTLA 3AZNC 1BT4A 3LV2A 3X1SA 4QLCD 5B1MB 4F5GA 4X23A 2PYOB 5M4BA 2GB3A 2Y2MA 1DJ9A 5B40A 4OT8A 2X5DA 3REID 3AV1B 3ZRQA 3MGPA 4ZASA 1C7NA 3UTAA 1WYUB 3WGCA 2G5IC 3HLMA 1PG8A 2X3LA 5B31C 2CY8A 3BWNC 2NZDB 3B6FB 4PFFA 4DBCA 5CPKA 2QB2A 2ZC0A 3VP6A 1AOID 1Y4IA 4IY7A 1P3GD 1TZYA 3AZFB 3EUCA 4A6TA 2YCTA 3MGSA 1S32D 1J04A 3X1VB 1ZLAB 5I92A 2BI9A 4W1WA 5B31G 3N5MA 3NRAA 3AZMB 1LKCA 4R8PA 3EPKA 2VGWA 1ASGA 2EYQA 4K2IA 4XJLA 4Z66B 3W96A 3AN2A 2L5AA 1U35C 1MDZA 4WU8C 4F5HA 4M2KA 4YM6A 1IUGA 1S08A 5F99D 2D5YA 1AMQA 2FFFB 3REIB 4JJNA 5B31D 5M46A 3AZEA 4I8AA 1H3OB 5AV6D 3W97D 2W8UA 3AZHD 4AO9A 1ARGA 4E3QA 1DFOA 2DR1A 3EIAA 2VMPA 4BQ0A 3AOVA 2YCNA 5G0AA 5B1LD 1C7OA 3PPLA 3WAAD 5BS7A 3AZJA 3DXVA 2W8WA 1V72A 3W99C 4RM1A 1F66C 1BJ4A 1FG3A 1WYUA 3FKDA 1TOJA 4KGCB 5DNNC 1T3UA 4NOGA 5B2JA 1OHYA 3LJAB 2C44A 1Z2CB 3KSYA 3LZ0A 4XZQB 3LY1A 1HTAA 2NZDA 3RELC 1I41A 1U35D 3JWAA 3FDBA 4WU8D 4LW4A 1P3AD 2CJDA 3MBBA 2F8NK 1P3PD 2R5CA 2CV5B 3AZFA 1P3KB 4MQPA 2RVQD 1KX4B 2FQ6A 4HGAC 3GZDA 1GD9A 3AZIB 5GXQD 3AZMA 3JZLA 3AFAB 5BNVA 3C1BB 3REHC 3MAUA 1ZOBA 1GEXA 2VLFA 4LNMA 2BWPA 2AY5A 1E5FA 2ZSMA 5B0YB 3W97B 3GJUA 3MVDA 5KDMB 5HDMA 3WKJB 3H0LC 1VJOA 1M0PA 2VMTA 5DNND 2VYCA 2Y2GA 1GBNA 3B6GA 2YKVA 2D7YA 1H3OA 4E3RA 1GDEA 5AY8C 1JS3A 3REJC 5B2IC 2AY9A 1CL1A 2E7UA 2HUUA 4WXFA 4KGCA 1AY4A 1M1AD 3KGXA 1D2FA 4NE5A 4J8XD 2NQBB 5BT1D 3LJAA 3REHD 1KU5A 4Q75A 3AV7A 4J8VC 4L0OA 4RIZA 3ATHA 3TU4D 4XZQA 1TOGA 8AATA 3AYWC 4QGRA 3W98C 2C81A 3H9XA 4CXRA 3AZGC 1LW5A 2FNIA 4Z5TB 5JRGC 2D63A 3EI6A 1P3KA 4ZWVA 4MQRA 3ELEA 3PIUA 4Q6RA 3AZIA 3EG5B 2W7DA 1ASCA 1XEYA 5B0ZA 3AFAA 4WBTA 1ASNA 3A6NB 3REJD 3UTBD 3UWCA 3LELB 5B0YA 5KDMA 1YJZA 4ZUXB 4KAMA 4KUDD 2CSTA 3F6TA 1P34C 2AEVA 1BQAA 4F5KA 4A0GA 2WKAA 2Y2JA 5DNMB 1WWSA 2YRRA 3ZZKA 1WYTB 5EAVA 2BWNA 1GCKA 5CPIB 1O61A 3E2FA 1KMKA 1M6SA 1SFFA 1P3MB 5CP6D 1GC4A 3KWQD 4DGTA 4WLJA 3FVSA 1KX3C 2PB2A 2HP1A 5B33C 5GT3C 5CPJD 1ASAA 4LW2A 1P3BD 2EO5A 2HIOA 5E5AB 1P3OC 2GMSA 4A0RA 2AY8A 2PO3A 4ZBJC 2D64A 4LD9C 4YS3C 2AROC 2E7IA 2NQBA 1W7MA 3B8XA 2R5EA 4EU1A 1OHVA 3HQTA 2VI8A 2YKYA 3E9KA 1HQ3C 2D61A 2HZPA 1P3FC 3NU8A 4CAYB 3NQJB 2Q7WA 4Z5TA 4Y0DA 4CBSA 5B24C 1P34D 1YJSA 2CTZA 1DGDA 1KL2A 2HOXA 2V0YA 3EZ1A 1IAXA 4OC9A 2OGAA 3FVXA 1PMMA 3NX3A 3PDXA 1ARIA 3KUYC 2AY2A 3F0HA 1M19C 4IW7A 3W1JA 1BH9B 3DC1A 4H9NB 2A1VA 3HDOA 3A6NA 2DKJA 1KMJA 1M7YA 3AEOA 5BJ3A 1UU0A 3LELA 3X1TD 3KE3A 5M49A 3W99A 3UT9B 2FJ7B 3WTPA 2ZUKA 1JF9A 5CHLB 4RITA 4MY5A 4RJYA 5AV5B 4U1TA 1S07A 3MGPD 5DNMA 1YOOA 2YCPA 2JE5A 3LZ1C 3FFHA 5G49A 1GC2A 2G7JA 2YFWB 1P3MA 1CQ6A 2OKJA 1CS1A 3AZKB 5FT6A 4GE9A 4ITGA 5CPKD 3B0BA 2C0RA 5KTBA 1DJUA 4NE3A 2VMNA 3K40A 4P7YA 4EO5C 4OCAA 3KUYD 3RBFA 1M19D 3MGSD 2VIAA 3REKC 3N4SA 3O62D 1P3LA 1ELQA 2JJFA 5DX5A 2UWXA 1JG8A 5GSUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEJ A;  1C7N A;  1WYU B;  3WGC A;  2BIA A;  1AHY A;  1BKG A;  3HLM A;  2ZY2 A;  1PG8 A;  2BI2 A;  4ATQ A;  2F8J A;  1M0N A;  3AEM C;  1AAW A;  1AY5 A;  5EAA A;  5JAY A;  2CY8 A;  2HOY A;  2ZY3 A;  2CFB A;  3H7F A;  3BWN C;  3P6K A;  4TN4 A;  4W8I A;  4WB0 B;  3G8M A;  4PFF A;  1W7L A;  3R9A A;  4WYF A;  3UE8 A;  4DBC A;  4ADE A;  3KKI A;  1GEW A;  2QB2 A;  4XJM A;  1I48 A;  2ZC0 A;  3BB8 A;  3ISL A;  2OGE A;  4UQV A;  1WYV A;  3VK2 A;  1Y4I A;  3E6G A;  3AEJ C;  4IY7 A;  4WYA A;  4IXS A;  1ASM A;  1AKB A;  4ZSW A;  3EUC A;  3NTJ A;  2XBN A;  1RV3 A;  1YAA A;  2E7J A;  1B8G A;  2YCT A;  3ASA A;  4A6T A;  3GZC A;  1J04 A;  1BJN A;  5I92 A;  4WLH A;  4AH3 A;  3RQ1 A;  1IX6 A;  3WKR A;  2BI9 A;  4W1W A;  2FNU A;  2EPJ A;  4WYC A;  3N5M A;  2CJH A;  3NRA A;  5J8Q A;  4A00 A;  1LKC A;  3MAF A;  4MSO A;  3NNK A;  2VGW A;  3LWS A;  1CQ7 A;  1UKJ A;  2JGT A;  1ASG A;  3F9T A;  2WK8 A;  4K2I A;  3TQX A;  4XJL A;  2FYF A;  1WKH A;  1MAQ A;  2W7L A;  1N2T A;  3PD6 B;  5AX8 A;  1D7R A;  1ZC9 A;  9AAT A;  3WGB A;  4GRX A;  3QBO A;  2QB3 A;  2HOZ A;  2VMW A;  1MDZ A;  1AJS A;  1WYV B;  4F5H A;  4M2K A;  2Z20 A;  3GSB A;  3TFT A;  4W1X A;  4IYO B;  1IUG A;  1S08 A;  1AMS A;  1CZC A;  3GET A;  4W91 A;  2AY3 A;  1B5O A;  2D5Y A;  1QZ9 A;  1X29 A;  4AZK A;  1AMQ A;  1ASL A;  3EI7 A;  3A9Z A;  1ZOD A;  4K2M A;  2R0T A;  2CIN A;  3ASB A;  3QI6 A;  4H51 A;  1ART A;  3B46 A;  1IJI A;  2W7G A;  2X5F A;  5G4I A;  2GSA A;  1ARS A;  1IAY A;  2EZ1 A;  4OMA A;  5M46 A;  3K28 A;  1AIB A;  4ADD A;  2CJG A;  5F8V A;  1DJE A;  4I8A A;  4BA4 A;  4U2H A;  1LC7 A;  2W8U A;  3NYS A;  2VMR A;  3QGU A;  4AO9 A;  4F5L A;  2BHX A;  3D6K A;  4GSA A;  5G09 A;  1ARG A;  1W3U A;  4E3Q A;  1DFO A;  2DR1 A;  3EIA A;  2VMP A;  1QJ5 A;  4BQ0 A;  2Z1Y A;  4GE7 A;  2VGS A;  1I43 A;  3AOV A;  3JWB A;  1AIA A;  2YCN A;  2ORD A;  1B9H A;  5G0A A;  3DZZ A;  1C7O A;  2DOU A;  3NDN A;  3PPL A;  1O4S A;  2HUI A;  1V2E A;  3NYT A;  3RBL A;  3DXV A;  2W8W A;  1EQB A;  1V72 A;  2BI5 A;  2QLR A;  1T3I A;  4ISY A;  1BJ4 A;  2Z9X A;  5HXX A;  2BI3 A;  4O6Z A;  4Y0H A;  4ZM3 A;  1FG3 A;  4XK1 A;  3RCH B;  1WYU A;  4E1O A;  3FKD A;  1TOJ A;  3FRK A;  1IVR A;  1DTY A;  4NOG A;  4ZAH A;  1OHY A;  2W8J A;  2C44 A;  3DRD A;  4WYE A;  1N31 A;  3NYU A;  2OAT A;  2DKB A;  1WKG A;  3E2Z B;  3LY1 A;  2R2N A;  3PGY A;  5EIG A;  4JEY A;  1EG5 A;  4KXK A;  5K8B A;  3JW9 A;  2W8V A;  1I41 A;  3JWA A;  1YIY A;  3FDB A;  4LW4 A;  2AY4 A;  1I29 A;  2VMU A;  3ZRP A;  3QN6 A;  1BJO A;  4F4E A;  2YOB A;  3EI9 A;  3OP7 A;  1M32 A;  2PB0 A;  3TFU A;  2CJD A;  3MBB A;  2R5C A;  4W1V A;  1V2D A;  3FTB A;  1AAM A;  1AHF A;  3PJ0 A;  5FT5 A;  1RV4 A;  3G7Q A;  4WP0 A;  4MQP A;  1V2F A;  4K2B A;  1OAT A;  2FQ6 A;  2VGT A;  3GZD A;  2YKU A;  1GD9 A;  4A6R A;  5E5I A;  2YHK A;  4F5J A;  1QIR A;  1J32 A;  4ITX A;  3I4J A;  2VMZ A;  1MAP A;  3N0L A;  4ZWM A;  2D66 A;  2ZSL A;  4ZM4 A;  4FFC A;  3FQ8 A;  3MAU A;  4LNL A;  1BW0 A;  1ZOB A;  5EIG B;  3TAT A;  3PD6 A;  1GEX A;  1M0O A;  4ZDP A;  2VLF A;  4LNM A;  1TPL A;  4JEW A;  2ZYJ A;  1SZS A;  2BWP A;  3ECD A;  2AY5 A;  1E5F A;  1BJO B;  1AX4 A;  1TOI A;  2ZSM A;  4ZDL A;  4R5F A;  5E3K A;  2R5C B;  3GJU A;  2YKX A;  4IYO A;  5D5S A;  1ASF A;  5HDM A;  7AAT A;  1D7V A;  1P3W A;  2VIB A;  3CBF A;  5FT4 A;  3A9Y A;  4WXB A;  2JG2 A;  4E77 A;  1AKA A;  3LVL B;  1CL2 A;  1VJO A;  2VLH A;  4MKJ A;  1M0P A;  2EGY A;  2JJH A;  2VI9 A;  3B1D A;  2VMT A;  2VYC A;  3NU7 A;  4PIW A;  2W7H A;  4ZDO A;  1GBN A;  1GC0 A;  4GEB A;  2BYJ A;  2YKV A;  3BC8 A;  4J5U A;  2D7Y A;  4F5I A;  2WK9 A;  3ELP A;  1PFF A;  3GBX A;  2VMO A;  3N75 A;  5EFS A;  4PFN A;  1UU2 A;  4XAU A;  4E3R A;  5G2P A;  1GDE A;  3MC6 A;  4TMR A;  1KKP A;  3ZRR A;  1SZK A;  4IXO A;  4JEV A;  3Q8N A;  2NMP A;  1JS3 A;  3BCA A;  2BYL A;  2W7M A;  3TCM A;  2JJG A;  4XJP A;  4RKD A;  3RUY A;  1O69 A;  2AY9 A;  3II0 A;  3PA9 A;  2CH2 A;  3DOD A;  4F5M A;  1CL1 A;  2E7U A;  1ORD A;  1FC4 A;  1LS3 A;  2D7Z A;  3QPG A;  1QIT A;  3M5U A;  2VMS A;  4CVQ A;  3CQ4 A;  3CAI A;  2VMX A;  1AIC A;  3BN1 A;  1AMR A;  1TAS A;  2QBT A;  2BIE A;  3AOW A;  4UHN A;  1CZE A;  2HUU A;  4XJO A;  4WXF A;  3FVU A;  3RCH A;  2FN6 A;  2V1P A;  1U08 A;  4BHD A;  3KGW A;  4PVF A;  3MC6 C;  5HHY A;  1AY4 A;  3KGX A;  1ARH A;  1SF2 A;  1DKA A;  1D2F A;  3AEP A;  2XH1 A;  3NUI A;  1B9I A;  4IXZ A;  5DJ9 A;  1QIS A;  2W7F A;  3BCB A;  4Q75 A;  4UOY A;  3AV7 A;  4A0F A;  1BJW A;  3MKJ A;  5C6U A;  4L0O A;  2ZJG A;  1D7S A;  3AEN B;  3IHJ A;  3ATH A;  3E2Z A;  4B98 A;  1TOG A;  3HMU A;  8AAT A;  4GDY A;  4QGR A;  4KYO A;  2ZP7 A;  5F9S A;  2C81 A;  1TOE A;  4N0W A;  4JEX A;  4CXR A;  3LVJ A;  1LW5 A;  4EB5 A;  2FNI A;  4UHM A;  5D95 A;  2W7E A;  3L44 A;  1FG7 A;  4R2N A;  1G7X A;  2D63 A;  3EI6 A;  2W7K A;  2TPL A;  4HF8 A;  2Z1Z A;  3VOM A;  1MLY A;  2BWO A;  4ZWV A;  2EH6 A;  4MQR A;  4ZLV A;  3ELE A;  3WLX A;  3VK4 A;  3ZZJ A;  3PIU A;  1C0N A;  4Q6R A;  5EUE A;  1G4X A;  4A72 A;  1D7U A;  2W7D A;  1WST A;  2HP2 A;  1ASC A;  2E54 A;  2W7J A;  1MDO A;  1WYT A;  1AHE A;  4WBT A;  1ASN A;  5E4Z A;  1G7W A;  4GE4 A;  1Z7D A;  2VMY A;  1SPA A;  3FQ7 A;  1AY8 A;  3DR7 A;  4B9B A;  1CQ8 A;  3CQ5 A;  5M4D A;  3LVK A;  3DR4 A;  1B5P A;  2O7C A;  2HUF A;  3UWC A;  1BS0 A;  3WX9 A;  1X28 A;  1ELU A;  4ADB A;  4RKC A;  1YJZ A;  1OXP A;  4AZJ A;  1GC3 A;  4KAM A;  4MQQ A;  2AY7 A;  2ZY5 A;  2CST A;  3F6T A;  3FSL A;  3I5T A;  4FL0 A;  4P3M A;  1BQA A;  4R8D A;  2AAT A;  5EUD A;  4F5K A;  1RVU A;  1IX8 A;  4A0G A;  2WKA A;  1MDX A;  1SVV A;  1LC8 A;  2VGU A;  2RFV A;  2Z9W A;  4BA5 A;  3DU4 A;  1Z3Z A;  3HL2 A;  3L8A A;  1VEF A;  3BWO A;  1O62 A;  3R4T A;  4ZSY A;  2W7I A;  2YRR A;  2VGZ A;  4XEW A;  3ZZK A;  1WYT B;  5EAV A;  1IBJ A;  3PDB B;  2BWN A;  1GCK A;  4RAE A;  4WXG A;  1O61 A;  3E2F A;  1KMK A;  1N8P A;  1M6S A;  4WD2 A;  1SFF A;  1YNU A;  3ACZ A;  1G4V A;  3LVM A;  1GC4 A;  1MGV A;  3B1E A;  4DGT A;  4WLJ A;  4EB7 A;  1ASB A;  2BIG A;  4Y0I A;  3FVS A;  4ATP A;  3JTX A;  3MEB A;  2BKW A;  3GZD C;  2PB2 A;  4WYD A;  1DGE A;  2HOR A;  2HP1 A;  4LNJ A;  1C4K A;  3BV0 A;  2O0R A;  1ASA A;  3A9X A;  4BMK A;  1LK9 A;  1OHW A;  3AEL A;  4LW2 A;  1H1C A;  2JJE A;  2EO5 A;  2QA3 A;  1TAR A;  1IX7 A;  1MLZ A;  2GMS A;  4A0R A;  2AY8 A;  2PO3 A;  2VMQ A;  1YJY A;  4AOA A;  1AMA A;  2D64 A;  2QMA A;  3WY7 A;  5DB5 A;  3T32 A;  2E7I A;  5EQC A;  3BS8 A;  1W7M A;  3B8X A;  2R5E A;  3BCX A;  1ASE A;  3AEN A;  2X8U A;  3DXW A;  3FFR A;  2AY6 A;  4EU1 A;  1OHV A;  3HQT A;  3OKS A;  2VI8 A;  2YKY A;  3E9K A;  3NUB A;  3COG A;  2D61 A;  2HZP A;  3EIB A;  1JS6 A;  2Z9V A;  3P1T A;  3CQ6 A;  1OXO A;  3NU8 A;  5TF5 A;  3VAX A;  4IX8 A;  4JF1 A;  5FT8 A;  2Q7W A;  4Y0D A;  2WK7 A;  4CBS A;  4UHO A;  1YJS A;  1XI9 A;  2AY1 A;  1TOK A;  4A0H A;  2CTZ A;  1EJI A;  3FDD A;  2CH1 A;  3K7Y A;  2FM1 A;  3DYD A;  4XQ2 A;  3WZF A;  2C7T A;  3PAA A;  4A6U A;  1DGD A;  1KL2 A;  1E5E A;  2HOX A;  2V0Y A;  3EZ1 A;  3QHX A;  1IAX A;  1AJR A;  4OC9 A;  2OGA A;  3FVX A;  3NX3 A;  3PDX A;  1B4X A;  1ARI A;  2AY2 A;  3F0H A;  4LC3 A;  4JF0 A;  4IW7 A;  3USF A;  1AHG A;  1ASD A;  1C7G A;  2D65 A;  3DC1 A;  4Q76 A;  2EZ2 A;  1QJ3 A;  3HDO A;  1TAT A;  2DKJ A;  1KMJ A;  2YRI A;  3B1C A;  1AHX A;  1M7Y A;  3AEO A;  5BJ3 A;  4OYT A;  4Q31 A;  2CB1 A;  1UU0 A;  4W5K A;  2Z9U A;  1M4N A;  3KE3 A;  1AKC A;  5G2Q A;  5IWQ A;  4ADC A;  3MAF B;  2OQX A;  5M49 A;  1SZU A;  1S06 A;  3EI5 A;  3GR9 A;  2ZUK A;  1JF9 A;  3FCR A;  4WYG A;  2GQN A;  1H0C A;  4MY5 A;  1C9C A;  4M2J A;  4F5F A;  4DQ6 A;  2Z61 A;  2VMV A;  3WKS A;  3A8U X;  4RJY A;  4EFF A;  4M2M A;  3EZS A;  1QGN A;  2VGV A;  3A2B A;  4U1T A;  3E2Y A;  3FQA A;  5BJ4 A;  4R5Z A;  1AJS B;  1S07 A;  4HVK A;  1ECX A;  1M0Q A;  1X0M A;  1RVY A;  5EUN A;  2GMU A;  2O1B A;  1YOO A;  2YCP A;  3PDB A;  3FFH A;  3EI8 A;  2BI1 A;  1YIZ A;  1GC2 A;  3MAD A;  5DJ1 A;  1S09 A;  4AO4 A;  1UU1 A;  1CQ6 A;  2G6W A;  1W23 A;  1S0A A;  1CS1 A;  1GEY A;  3E77 A;  5FT6 A;  4CBR A;  3LG0 A;  5G4J A;  3AAT A;  4GE9 A;  4OTL A;  1W7N A;  1BT4 A;  4ITG A;  2C0R A;  3LV2 A;  1DJU A;  1LC5 A;  2VMN A;  3K40 A;  4F5G A;  3RI6 A;  2ZY4 A;  4P7Y A;  4OCA A;  5M4B A;  2W8T A;  3AEM A;  4WB0 A;  4JEZ A;  2GB3 A;  3RBF A;  1DJ9 A;  4OT8 A;  2VIA A;  2X5D A;  1KL1 A;  3BWN A;  3UAK A;  4EMY A;  1BQD A;  2CAN A;  1ELQ A;  2JJF A;  4CXQ A;  1CJ0 A;  5DX5 A;  3VK3 A;  1JG8 A;  1LW4 A;  1VP4 A;  3ZRQ A;  1KKJ A;  1X2A A;  4MKK A;  3QM2 A;  4ZAS A; 
#chains in the Genus database with same CATH topology
 3W96 D;  3AZL B;  3X1U D;  3AN2 D;  2BIA A;  1ID3 C;  3NQJ A;  4ATQ A;  3X1S B;  5AVC C;  3AEM C;  5EAA A;  4H9P A;  3H7F A;  4J8U B;  4YM6 D;  3P6K A;  5AV9 C;  4X23 B;  4TN4 A;  3R9A A;  4XUJ B;  4WYF A;  5B40 B;  1I48 A;  3BB8 A;  3ISL A;  3VK2 A;  3X1V C;  3AEJ C;  4H63 Q;  4Z2M H;  5AY8 A;  1RV3 A;  1YAA A;  3ASA A;  4H9N A;  1B8G A;  1P3I C;  3UTA B;  1BJN A;  4AH3 A;  3RQ1 A;  1M18 A;  2FNU A;  5B1M D;  5J8Q A;  3NNK A;  1UKJ A;  2PYO D;  3F9T A;  2WK8 A;  3TQX A;  3UT9 A;  5BNX B;  5B32 A;  4QLC C;  3B0D B;  3WGB A;  4GRX A;  3QBO A;  2QB3 A;  3MGQ B;  2HOZ A;  2VMW A;  3AV1 D;  2OKK A;  3GSB A;  3TFT A;  4W1X A;  1TZY B;  3AYW A;  3REI C;  1B5O A;  3W98 A;  2JSS A;  2F8N H;  2YFW A;  3A9Z A;  2CIN A;  3ASB A;  1B67 A;  3AZK A;  3B46 A;  4R8P B;  1IJI A;  2X5F A;  1ARS A;  1IAY A;  2NZD D;  3B6F D;  3WA9 A;  3K28 A;  2CJG A;  1DJE A;  3W96 B;  2Y2O A;  4U2H A;  3QGU A;  4F5L A;  5G09 A;  3AZF D;  4GE7 A;  2F8N B;  1I43 A;  3JWB A;  3N7N A;  3X1V D;  3DZZ A;  1ZLA D;  3N4R A;  3RBL A;  1P3G C;  1EQB A;  4H9S C;  3AZM D;  5BO0 B;  5GSU A;  2Z9X A;  2BI3 A;  4O6Z A;  4ZM3 A;  4XK1 A;  4JJN B;  4Z66 D;  3AV2 B;  1IVR A;  3AZE B;  2W8J A;  2BYK B;  4WNN A;  1R4V A;  3NYU A;  2OAT A;  2DKB A;  1WKG A;  3E2Z B;  4J8U A;  4WU9 B;  4H9R B;  4JEY A;  1EG5 A;  4KXK A;  4XUJ A;  4K05 A;  5C3I B;  2VMU A;  3ZRP A;  3QN6 A;  1BJO A;  1M32 A;  3AZJ B;  3FTB A;  3PJ0 A;  5FT5 A;  1RV4 A;  5F99 C;  3C1C B;  3G7Q A;  5GT0 B;  4AWL B;  3B6G D;  2VGT A;  2DGL A;  5B33 A;  5E5I A;  4F5J A;  1QIR A;  1J32 A;  5B2J B;  3I4J A;  3KFU G;  1MAP A;  3N0L A;  4ZWM A;  2D66 A;  3LZ0 B;  4ZM4 A;  3FQ8 A;  5BNX A;  3TAT A;  5AV6 C;  3W97 C;  3AZH C;  1M0O A;  4ZDP A;  1TPL A;  4YS3 A;  2ARO A;  3WKJ C;  3MGQ A;  5E3K A;  5B1L C;  2R5C B;  3WAA C;  1ASF A;  3EPH A;  4KGC D;  1D7V A;  2CWE A;  4E77 A;  2JG2 A;  1AKA A;  3LVL B;  3LJA D;  1CL2 A;  4MKJ A;  2EGY A;  2JJH A;  2VI9 A;  5FUG B;  2XD1 A;  4XZQ D;  3NU7 A;  5BNV B;  1GC0 A;  4GEB A;  4F5I A;  2WB6 A;  1Q9C A;  4PFN A;  3MC6 A;  1KKP A;  1SZK A;  1EQZ B;  2CV5 D;  2W7M A;  1P3K D;  3TCM A;  4RKD A;  3II0 A;  3PA9 A;  3N4X A;  2F8N A;  3DOD A;  3MVD B;  1P3A C;  1ORD A;  1LS3 A;  1KX4 D;  3QPG A;  3M5U A;  1P3P C;  3CQ4 A;  3CAI A;  3AZI D;  5BO0 A;  1TAS A;  2QBT A;  2BIE A;  3AFA D;  2RVQ C;  3C1B D;  2V1P A;  5GXQ C;  3AV2 A;  1KX5 B;  3B6G B;  5DJ9 A;  2XH1 A;  1QIS A;  3BCB A;  3V9R A;  5B0Y D;  2BYK A;  2ZJG A;  3E2Z A;  4WU9 A;  4H9R A;  4KYO A;  3WKJ D;  1TOE A;  4N0W A;  3LVJ A;  3L44 A;  4R2N A;  1G7X A;  2W7K A;  2TPL A;  3W1I A;  3VOM A;  2EH6 A;  3C1C A;  5GT0 A;  3WLX A;  4WJ3 C;  4G91 B;  5AVB A;  2HP2 A;  2E54 A;  3VH6 A;  4J8W A;  2W7J A;  3MNN B;  1G7W A;  5AV8 A;  3EPL A;  3NQU A;  3MGR A;  3CQ5 A;  3DR4 A;  2HUF A;  3EPJ A;  4RKC A;  1OXP A;  4AZJ A;  1TAF A;  1GC3 A;  3FSL A;  4P3M A;  2XD5 A;  2AAT A;  5EUD A;  2NQB D;  3AZN B;  1MDX A;  2RFV A;  3DU4 A;  1Z3Z A;  5AVC A;  5FUG A;  5CPI C;  3R4T A;  5B0Z B;  1M1A C;  2W7I A;  4J8X C;  1IBJ A;  3PDB B;  5BT1 C;  1BH8 A;  4Z5T D;  1YNU A;  3TU4 C;  1MGV A;  1EQZ A;  1ASB A;  3JTX A;  2HOR A;  5E5A C;  1OHW A;  3KXB A;  1H1C A;  1IX7 A;  1MLZ A;  2Y2K A;  3WY7 A;  3A6N D;  1KX5 A;  5DB5 A;  3BS8 A;  3LEL D;  3DXW A;  2X8U A;  4G92 C;  4ZUX D;  3OKS A;  3NUB A;  3UTB C;  3EIB A;  3CQ6 A;  3VAX A;  4JF1 A;  4UHO A;  2AY1 A;  1XI9 A;  4KUD C;  1TOK A;  1EJI A;  3FDD A;  5DNM D;  3K7Y A;  4XQ2 A;  3WZF A;  2HIO B;  2C7T A;  3PAA A;  1E5E A;  5CPI D;  1P3M D;  3USF A;  1C7G A;  3MNN A;  2D65 A;  1QJ3 A;  1TAT A;  5CP6 C;  3KWQ C;  2YRI A;  1AOI A;  4OYT A;  2FJ7 C;  1M4N A;  5G2Q A;  3MAF B;  5E5A D;  4E44 A;  1SZU A;  1S06 A;  3EI5 A;  1S32 A;  5CPJ C;  2GQN A;  1H0C A;  1P3B C;  4M2J A;  4DQ6 A;  4J8L A;  3AZN A;  4EFF A;  4M2M A;  4WV4 B;  3EZS A;  3A2B A;  5BJ4 A;  3E2Y A;  3FQA A;  4R5Z A;  1JFI B;  1RVY A;  5EUN A;  2GMU A;  3PDB A;  3EI8 A;  3MAD A;  5DJ1 A;  3WTP E;  1W23 A;  4CBR A;  3AAT A;  3W99 B;  1F66 B;  2Y2P A;  1W7N A;  3WTP B;  3WCN A;  2DGK A;  2HUE C;  5B31 A;  4WB0 A;  4JEZ A;  1KL1 A;  3BWN A;  4EMY A;  5G49 B;  3REL B;  1BFM A;  1CJ0 A;  3VK3 A;  2DQN C;  1LW4 A;  4MKK A;  3UT9 D;  2FJ7 D;  5B1L A;  3X1T C;  1AHY A;  2ZY2 A;  2F8J A;  5AV5 D;  1M0N A;  3R45 A;  5JAY A;  2VQR A;  4M6B A;  2HOY A;  2ZY3 A;  3GWP A;  4W8I A;  1W7L A;  3KKI A;  2JIS A;  4XJM A;  3MGP C;  2OGE A;  1WYV A;  3E6G A;  1P3L B;  3AZK D;  1ASM A;  1AKB A;  4ZSW A;  3NTJ A;  2DF4 C;  1U35 A;  4WU8 A;  1P3A A;  4WLH A;  1IX6 A;  3VH5 A;  3WKR A;  1P3P A;  4WYC A;  2CJH A;  3MAF A;  4MSO A;  1CQ7 A;  2JGT A;  5CPK C;  2FYF A;  4H9P B;  1F1E A;  1N2T A;  3FZ7 A;  1D7R A;  9AAT A;  5JA4 A;  5GSU D;  3MGS C;  1JFI A;  5AY8 B;  1AMS A;  3O62 C;  1CZC A;  3AZL D;  2AY3 A;  5B2I B;  1QZ9 A;  4AZK A;  3X1S D;  1M18 B;  1ZOD A;  4H9Q B;  3W96 C;  4H51 A;  1ART A;  3X1U C;  3AN2 C;  4J8U D;  2W7G A;  5G4I A;  2GSA A;  4X23 D;  2EZ1 A;  1F66 A;  4Z2M G;  3H0R C;  4XUJ D;  3FZ8 A;  5F8V A;  5B40 D;  5B32 B;  1LC7 A;  4YM6 C;  5DNN A;  2BHX A;  4J8V B;  2Z1Y A;  2VGS A;  2ORD A;  1B9H A;  3UTA D;  2DOU A;  3AYW B;  1O4S A;  3W98 B;  2HUI A;  3NYT A;  3REL A;  2IO5 B;  2BI5 A;  1T3I A;  3AZG B;  3AZE C;  5JRG B;  3RCH B;  5B1M C;  3WA9 B;  1DTY A;  4ZAH A;  2PYO C;  3DRD A;  2F8N G;  3MGQ D;  4WYE A;  2R2N A;  5EIG A;  1TZY D;  5BS7 C;  1M1A A;  3JW9 A;  3REH A;  3AV1 C;  4F4E A;  3OP7 A;  2PB0 A;  4AWL C;  3TU4 A;  4W1V A;  4DRA A;  4R8P D;  1AHF A;  4WP0 A;  5B2J C;  1V2F A;  4K2B A;  4A6R A;  2YHK A;  4ITX A;  2VMZ A;  2NZD C;  3B6F C;  2YFV B;  4WNN B;  2ZSL A;  2F8N D;  4LNL A;  1BW0 A;  2ZYJ A;  3AZF C;  1BJO B;  1TOI A;  4ZDL A;  2YKX A;  1ZLA C;  4JJN D;  3REJ A;  7AAT A;  5B2I A;  3AV2 D;  1P3W A;  3CBF A;  3AZM C;  3AZE D;  4WXB A;  1KX3 B;  2VLH A;  5B33 B;  3HVY A;  4H9Q A;  5GT3 B;  4Z66 C;  4KUD A;  4ZDO A;  4WU9 D;  4PIW A;  3BC8 A;  4J5U A;  1P3O B;  2WK9 A;  3N75 A;  2VMO A;  5EFS A;  1UU2 A;  5G2P A;  3AZJ D;  3MVD C;  4LD9 B;  4TMR A;  3ZRR A;  4IXO A;  4JEV A;  4YS3 B;  2NMP A;  2ARO B;  2BYL A;  4J8V A;  4XJP A;  3RUY A;  3C1C D;  5GT0 D;  2D7Z A;  2VMS A;  4CVQ A;  3KWQ A;  1HQ3 B;  3BN1 A;  5B2J D;  1P3F B;  3AOW A;  3AZG A;  4UHN A;  1CZE A;  3B6G C;  3LZ0 D;  5B24 B;  5JRG A;  3RCH A;  2FN6 A;  1U08 A;  4PVF A;  1DKA A;  4IXZ A;  4UOY A;  4A0F A;  3A1K A;  1BJW A;  2BYM A;  1D7S A;  3AEN B;  3G0T A;  4EB5 A;  4UHM A;  5D95 A;  4CSR B;  4KGC C;  4G91 C;  1MLY A;  4ZLV A;  3LJA C;  1C0N A;  4NFT A;  1P34 A;  4XZQ C;  1EQZ D;  3V9R B;  2YFV A;  1MDO A;  1AHE A;  3MVD D;  1Z7D A;  3FQ7 A;  2CV5 C;  1CQ8 A;  3LZ1 B;  1P3K C;  1B5P A;  3WX9 A;  4ADB A;  1KX4 C;  4MQQ A;  4UUZ A;  3I5T A;  4FL0 A;  3AZI C;  1KX5 D;  1RVU A;  5B0Z C;  3X1T A;  1KX3 A;  3AFA C;  1LC8 A;  3C1B C;  2VGU A;  5AVB B;  5GT3 A;  3L8A A;  3BWO A;  1O62 A;  4J8W B;  2VGZ A;  4XEW A;  4EO5 B;  1P3O A;  4RAE A;  3B0C W;  5AV8 B;  5B0Y C;  4WXG A;  3NQU B;  1N8P A;  3REK B;  4LD9 A;  3MGR B;  4EB7 A;  2BIG A;  2F2A C;  2BKW A;  2FKI A;  1TAF B;  4WYD A;  4LNJ A;  1C4K A;  1PZR A;  2O0R A;  1HQ3 A;  4BMK A;  1LK9 A;  1P3F A;  1ID3 B;  2JJE A;  2QA3 A;  5B24 A;  5AVC B;  3MNN D;  1PMO A;  1YJY A;  1AMA A;  2QMA A;  1BH8 B;  5AV9 B;  5EQC A;  3AEN A;  2AY6 A;  3KUY A;  4DRB A;  1M19 A;  3COG A;  1JS6 A;  2Z9V A;  3O62 A;  1OXO A;  4H9O B;  4IX8 A;  3AZN D;  4CSR A;  5FT8 A;  2HIO C;  2WK7 A;  1P3I B;  3KXB B;  2CH1 A;  5B0Z D;  2FM1 A;  3DYD A;  2Y2Q A;  3X1U A;  2LY8 A;  2NQB C;  1B4X A;  2Y2I A;  4QLC B;  4RLG A;  4Q76 A;  3VH6 W;  4Z5T C;  1AHX A;  3LZ1 A;  4KHA A;  2Z9U A;  1AKC A;  5IWQ A;  4ADC A;  3GR9 A;  3FCR A;  1C9C A;  2Z61 A;  5B1M A;  3A8U X;  2VGV A;  1N1J B;  2PYO A;  1AJS B;  3A6N C;  2Y2N A;  1ECX A;  1M0Q A;  1X0M A;  2O1B A;  1A7W A;  3LEL C;  3A1I A;  1YIZ A;  1S09 A;  4AO4 A;  3REK A;  3AV1 A;  4ZUX C;  1AOI B;  2G6W A;  3WTP C;  1GEY A;  3E77 A;  1P3G B;  3LG0 A;  2HIO D;  1ULY A;  1S32 B;  1LC5 A;  5DNM C;  1ID3 A;  3RI6 A;  2ZY4 A;  3B6F A;  2W8T A;  3AEM A;  2Y2H A;  3P5J B;  1P3M C;  5AV9 A;  3UAK A;  1BQD A;  2CAN A;  4CXQ A;  2QSR A;  1VP4 A;  1KKJ A;  1X2A A;  2J8P A;  3QM2 A;  4ATP A;  3X1V A;  3AEJ A;  1ZLA A;  3H0M C;  1B6W A;  4E45 A;  5F99 B;  1BKG A;  4H9O A;  2BI2 A;  1P3I A;  1AAW A;  1AY5 A;  4Z66 A;  2CFB A;  5B31 B;  4WB0 B;  3G8M A;  3UE8 A;  1P3L C;  3I16 A;  3WCO A;  4ADE A;  2G5H C;  1GEW A;  5AV6 B;  4UQV A;  3AZH B;  4QLC A;  4WYA A;  4IXS A;  2XBN A;  3W99 D;  1F66 D;  2E7J A;  3GZC A;  5B1L B;  3WTP D;  3FZ6 A;  3WAA B;  3REI A;  3FD0 A;  2EPJ A;  4A00 A;  3LWS A;  3R45 B;  1WKH A;  1MAQ A;  2W7L A;  3PD6 B;  2Y2L A;  5AX8 A;  1ZC9 A;  3REL D;  1N1J A;  1AJS A;  1WYV B;  2Z20 A;  4IYO B;  1M18 C;  3GET A;  4W91 A;  2BG1 A;  1U35 B;  4WU8 B;  1X29 A;  1P3A B;  1ASL A;  3EI7 A;  4K2M A;  2R0T A;  3UT9 C;  1P3P B;  3QI6 A;  1P3G A;  5B32 C;  4H9S A;  4OMA A;  5AV5 C;  1AIB A;  4ADD A;  4BA4 A;  3NYS A;  5GXQ B;  2VMR A;  3D6K A;  1P3L D;  4GSA A;  1W3U A;  5JA4 B;  1QJ5 A;  4NE6 A;  2IO5 C;  1AIA A;  3NDN A;  3AZK C;  1V2E A;  2CV5 A;  2QLR A;  4ISY A;  3B0C T;  3WA9 C;  5HXX A;  5B32 G;  4Y0H A;  1KX4 A;  4E1O A;  3FRK A;  5F99 A;  1N31 A;  3C1B A;  5DNN B;  3PGY A;  5AY8 D;  5K8B A;  2W8V A;  5B2I D;  2RIQ A;  1YIY A;  2AY4 A;  1I29 A;  2KFP A;  2YOB A;  5GSU C;  3W97 A;  5AV6 A;  3AZH A;  1M18 D;  3EI9 A;  3TFU A;  1V2D A;  3AZL C;  1AAM A;  3WKJ A;  1OAT A;  3X1S C;  2W8S A;  2YKU A;  3WAA A;  5B32 D;  4J8U C;  4X23 C;  3W1H A;  4HGA B;  4XUJ C;  3VH5 W;  4J8V D;  5B40 C;  4FFC A;  5EIG B;  3PD6 A;  3AYW D;  1M1A B;  4JEW A;  1SZS A;  3W98 D;  3ECD A;  4J8X B;  3REH B;  1AX4 A;  4R5F A;  2AEU A;  3AZG D;  3HT4 A;  3TU4 B;  3UTA C;  5JRG D;  4IYO A;  5D5S A;  2VIB A;  4OBU A;  3WA9 D;  5FT4 A;  3A9Y A;  3VH6 T;  3B1D A;  2W7H A;  2BYJ A;  3B0D C;  3MGQ C;  3ELP A;  1PFF A;  3GBX A;  4XAU A;  5GXQ A;  1TZY C;  3Q8N A;  3BCA A;  2DGM A;  2JJG A;  1O69 A;  4F5M A;  2CH2 A;  1FC4 A;  4G92 B;  1QIT A;  3REJ B;  4OBV A;  3UTB B;  1AIC A;  2VMX A;  4R8P C;  1AMR A;  4XJO A;  3FVU A;  2ZM5 A;  4KUD B;  4BHD A;  3KGW A;  3MC6 C;  5HHY A;  1ARH A;  1SF2 A;  3VK4 A;  3AEP A;  3NUI A;  1B9I A;  2W7F A;  1W2E A;  3MKJ A;  5C6U A;  3IHJ A;  4B98 A;  3HMU A;  4GDY A;  2ZP7 A;  5F9S A;  4JEX A;  1KX3 D;  2W7E A;  5CP6 B;  5B33 D;  3KWQ B;  1FG7 A;  4JJN C;  5GT3 D;  4ZUX A;  4HF8 A;  3AV2 C;  2Z1Z A;  2BWO A;  1P3O D;  3ZZJ A;  5EUE A;  1G4X A;  4A72 A;  5CPJ B;  1D7U A;  4LD9 D;  1WST A;  4WU9 C;  1P3B B;  4YS3 D;  2ARO D;  2BYM B;  1WYT A;  5C3I C;  5E4Z A;  4GE4 A;  5CPI A;  1SPA A;  2VMY A;  3AZJ C;  1AY8 A;  3DR7 A;  4B9B A;  4J8X A;  1HQ3 D;  5M4D A;  3LVK A;  2O7C A;  1P3F D;  3C1C C;  5GT0 C;  1BS0 A;  1X28 A;  3IP4 C;  1ELU A;  5B24 D;  2AY7 A;  2ZY5 A;  5AVB C;  4WZS B;  3HBX A;  4R8D A;  1IX8 A;  4DQY B;  4J8W C;  1SVV A;  3LZ0 C;  2Z9W A;  5E5A A;  1P34 B;  4BA5 A;  5AV8 C;  3HL2 A;  1VEF A;  2JCH A;  4ZSY A;  2HUE B;  3MGR C;  4WD2 A;  3ACZ A;  1G4V A;  3LVM A;  3B1E A;  4Y0I A;  3MEB A;  3GZD C;  4CAY A;  1DGE A;  4UUZ B;  3BV0 A;  3AL0 C;  3A9X A;  3UTB A;  3AEL A;  3X1T B;  1TAR A;  2VMQ A;  4AOA A;  3T32 A;  1EQZ C;  3LZ1 D;  4ZBJ B;  1BH9 A;  3BCX A;  1ASE A;  3FFR A;  3MGP B;  3P1T A;  3KXB C;  5TF5 A;  5CP6 A;  5AVB D;  4RJ0 A;  4A0H A;  2FJ7 A;  4J8W D;  1KX5 C;  4A6U A;  5AV8 D;  3QHX A;  5CPK B;  1AJR A;  5AV5 A;  5CPJ A;  3REK D;  3MGR D;  1P3B A;  4LC3 A;  4JF0 A;  1AHG A;  1ASD A;  3KUY B;  2EZ2 A;  1M19 B;  3MGS B;  3B1C A;  4Q31 A;  2CB1 A;  3O62 B;  4W5K A;  1ID3 D;  2OQX A;  5AVC D;  4WYG A;  3X1U B;  3AN2 B;  4F5F A;  5AV9 D;  2VMV A;  3WKS A;  1QGN A;  3MNN C;  1WWI A;  4HVK A;  4YM6 B;  1AOI C;  2BI1 A;  3VH5 T;  4UPK A;  1UU1 A;  1P3I D;  1S32 C;  4KHA B;  1S0A A;  3KXB D;  5G4J A;  3AZL A;  4OTL A;  3AZN C;  1BT4 A;  3LV2 A;  3X1S A;  4QLC D;  5B1M B;  4F5G A;  4X23 A;  2PYO B;  5M4B A;  2GB3 A;  2Y2M A;  1DJ9 A;  5B40 A;  4OT8 A;  2X5D A;  3REI D;  3AV1 B;  3ZRQ A;  3MGP A;  4ZAS A;  1C7N A;  3UTA A;  1WYU B;  3WGC A;  2G5I C;  3HLM A;  1PG8 A;  2X3L A;  5B31 C;  2CY8 A;  3BWN C;  2NZD B;  3B6F B;  4PFF A;  4DBC A;  5CPK A;  2QB2 A;  2ZC0 A;  3VP6 A;  1AOI D;  1Y4I A;  4IY7 A;  1P3G D;  1TZY A;  3AZF B;  3EUC A;  4A6T A;  2YCT A;  3MGS A;  1S32 D;  1J04 A;  3X1V B;  1ZLA B;  5I92 A;  2BI9 A;  4W1W A;  5B31 G;  3N5M A;  3NRA A;  3AZM B;  1LKC A;  4R8P A;  3EPK A;  2VGW A;  1ASG A;  2EYQ A;  4K2I A;  4XJL A;  4Z66 B;  3W96 A;  3AN2 A;  2L5A A;  1U35 C;  1MDZ A;  4WU8 C;  4F5H A;  4M2K A;  4YM6 A;  1IUG A;  1S08 A;  5F99 D;  2D5Y A;  1AMQ A;  2FFF B;  3REI B;  4JJN A;  5B31 D;  5M46 A;  3AZE A;  4I8A A;  1H3O B;  5AV6 D;  3W97 D;  2W8U A;  3AZH D;  4AO9 A;  1ARG A;  4E3Q A;  1DFO A;  2DR1 A;  3EIA A;  2VMP A;  4BQ0 A;  3AOV A;  2YCN A;  5G0A A;  5B1L D;  1C7O A;  3PPL A;  3WAA D;  5BS7 A;  3AZJ A;  3DXV A;  2W8W A;  1V72 A;  3W99 C;  4RM1 A;  1F66 C;  1BJ4 A;  1FG3 A;  1WYU A;  3FKD A;  1TOJ A;  4KGC B;  5DNN C;  1T3U A;  4NOG A;  5B2J A;  1OHY A;  3LJA B;  2C44 A;  1Z2C B;  3KSY A;  3LZ0 A;  4XZQ B;  3LY1 A;  1HTA A;  2NZD A;  3REL C;  1I41 A;  1U35 D;  3JWA A;  3FDB A;  4WU8 D;  4LW4 A;  1P3A D;  2CJD A;  3MBB A;  2F8N K;  1P3P D;  2R5C A;  2CV5 B;  3AZF A;  1P3K B;  4MQP A;  2RVQ D;  1KX4 B;  2FQ6 A;  4HGA C;  3GZD A;  1GD9 A;  3AZI B;  5GXQ D;  3AZM A;  3JZL A;  3AFA B;  5BNV A;  3C1B B;  3REH C;  3MAU A;  1ZOB A;  1GEX A;  2VLF A;  4LNM A;  2BWP A;  2AY5 A;  1E5F A;  2ZSM A;  5B0Y B;  3W97 B;  3GJU A;  3MVD A;  5KDM B;  5HDM A;  3WKJ B;  3H0L C;  1VJO A;  1M0P A;  2VMT A;  5DNN D;  2VYC A;  2Y2G A;  1GBN A;  3B6G A;  1KAF A;  2YKV A;  2D7Y A;  1H3O A;  4E3R A;  1GDE A;  5AY8 C;  1JS3 A;  3REJ C;  5B2I C;  2AY9 A;  1CL1 A;  2E7U A;  2HUU A;  4WXF A;  4KGC A;  1AY4 A;  1M1A D;  3KGX A;  1D2F A;  4NE5 A;  4J8X D;  2NQB B;  5BT1 D;  3LJA A;  3REH D;  1KU5 A;  4Q75 A;  3AV7 A;  4J8V C;  4L0O A;  4RIZ A;  3ATH A;  3TU4 D;  4XZQ A;  1TOG A;  8AAT A;  3AYW C;  4QGR A;  3W98 C;  2C81 A;  3H9X A;  4CXR A;  3AZG C;  1LW5 A;  2FNI A;  4Z5T B;  5JRG C;  2D63 A;  3EI6 A;  1P3K A;  4ZWV A;  4MQR A;  3ELE A;  3PIU A;  4Q6R A;  3AZI A;  3EG5 B;  2W7D A;  1ASC A;  1XEY A;  5B0Z A;  3AFA A;  4WBT A;  1ASN A;  3A6N B;  3REJ D;  3UTB D;  3UWC A;  3LEL B;  5B0Y A;  5KDM A;  1YJZ A;  4ZUX B;  4KAM A;  4KUD D;  2CST A;  3F6T A;  1P34 C;  2AEV A;  1BQA A;  4F5K A;  4A0G A;  2WKA A;  2Y2J A;  5DNM B;  1WWS A;  2YRR A;  3ZZK A;  1WYT B;  5EAV A;  2BWN A;  1GCK A;  5CPI B;  1O61 A;  3E2F A;  1KMK A;  1M6S A;  1SFF A;  1P3M B;  5CP6 D;  1GC4 A;  3KWQ D;  4DGT A;  4WLJ A;  3FVS A;  1KX3 C;  2PB2 A;  2HP1 A;  5B33 C;  5GT3 C;  5CPJ D;  1ASA A;  4LW2 A;  1P3B D;  2EO5 A;  2HIO A;  5E5A B;  1P3O C;  2GMS A;  4A0R A;  2AY8 A;  2PO3 A;  4ZBJ C;  2D64 A;  4LD9 C;  4YS3 C;  2ARO C;  2E7I A;  2NQB A;  1W7M A;  3B8X A;  2R5E A;  4EU1 A;  1OHV A;  3HQT A;  2VI8 A;  2YKY A;  3E9K A;  1HQ3 C;  2D61 A;  2HZP A;  1P3F C;  3NU8 A;  4CAY B;  3NQJ B;  2Q7W A;  4Z5T A;  4Y0D A;  4CBS A;  5B24 C;  1P34 D;  1YJS A;  2CTZ A;  1DGD A;  1KL2 A;  2HOX A;  2V0Y A;  3EZ1 A;  1IAX A;  4OC9 A;  2OGA A;  3FVX A;  1PMM A;  3NX3 A;  3PDX A;  1ARI A;  3KUY C;  2AY2 A;  3F0H A;  1M19 C;  4IW7 A;  3W1J A;  1BH9 B;  3DC1 A;  4H9N B;  2A1V A;  3HDO A;  3A6N A;  2DKJ A;  1KMJ A;  1M7Y A;  3AEO A;  5BJ3 A;  1UU0 A;  3LEL A;  3X1T D;  3KE3 A;  5M49 A;  3W99 A;  3UT9 B;  2FJ7 B;  3WTP A;  2ZUK A;  1JF9 A;  5CHL B;  4RIT A;  4MY5 A;  4RJY A;  5AV5 B;  4U1T A;  1S07 A;  3MGP D;  5DNM A;  1YOO A;  2YCP A;  2JE5 A;  3LZ1 C;  3FFH A;  5G49 A;  1GC2 A;  2G7J A;  2YFW B;  1P3M A;  1CQ6 A;  2OKJ A;  1CS1 A;  3AZK B;  5FT6 A;  4GE9 A;  4ITG A;  5CPK D;  3B0B A;  2C0R A;  5KTB A;  1DJU A;  4NE3 A;  2VMN A;  3K40 A;  4P7Y A;  4EO5 C;  4OCA A;  3KUY D;  3RBF A;  1M19 D;  3MGS D;  2VIA A;  3REK C;  3N4S A;  3O62 D;  1P3L A;  1ELQ A;  2JJF A;  5DX5 A;  2UWX A;  1JG8 A;  5GSU B; 
#chains in the Genus database with same CATH homology
 3W96 D;  3AZL B;  3X1U D;  3AN2 D;  2BIA A;  1ID3 C;  3NQJ A;  4ATQ A;  3X1S B;  5AVC C;  3AEM C;  5EAA A;  4H9P A;  3H7F A;  4J8U B;  4YM6 D;  3P6K A;  5AV9 C;  4X23 B;  4TN4 A;  3R9A A;  4XUJ B;  4WYF A;  5B40 B;  1I48 A;  3BB8 A;  3ISL A;  3VK2 A;  3X1V C;  3AEJ C;  4H63 Q;  4Z2M H;  5AY8 A;  1RV3 A;  1YAA A;  3ASA A;  4H9N A;  1B8G A;  1P3I C;  3UTA B;  1BJN A;  4AH3 A;  3RQ1 A;  1M18 A;  2FNU A;  5B1M D;  5J8Q A;  3NNK A;  1UKJ A;  2PYO D;  3F9T A;  2WK8 A;  3TQX A;  3UT9 A;  5BNX B;  5B32 A;  4QLC C;  3B0D B;  3WGB A;  4GRX A;  3QBO A;  2QB3 A;  3MGQ B;  2HOZ A;  2VMW A;  3AV1 D;  2OKK A;  3GSB A;  3TFT A;  4W1X A;  1TZY B;  3AYW A;  3REI C;  1B5O A;  3W98 A;  2JSS A;  2F8N H;  2YFW A;  3A9Z A;  2CIN A;  3ASB A;  1B67 A;  3AZK A;  3B46 A;  4R8P B;  1IJI A;  2X5F A;  1ARS A;  1IAY A;  2NZD D;  3B6F D;  3WA9 A;  3K28 A;  2CJG A;  1DJE A;  3W96 B;  2Y2O A;  4U2H A;  3QGU A;  4F5L A;  5G09 A;  3AZF D;  4GE7 A;  2F8N B;  1I43 A;  3JWB A;  3N7N A;  3X1V D;  3DZZ A;  1ZLA D;  3N4R A;  3RBL A;  1P3G C;  1EQB A;  4H9S C;  3AZM D;  5BO0 B;  5GSU A;  2Z9X A;  2BI3 A;  4O6Z A;  4ZM3 A;  4XK1 A;  4JJN B;  4Z66 D;  3AV2 B;  1IVR A;  3AZE B;  2W8J A;  2BYK B;  4WNN A;  1R4V A;  3NYU A;  2OAT A;  2DKB A;  1WKG A;  3E2Z B;  4J8U A;  4WU9 B;  4H9R B;  4JEY A;  1EG5 A;  4KXK A;  4XUJ A;  4K05 A;  5C3I B;  2VMU A;  3ZRP A;  3QN6 A;  1BJO A;  1M32 A;  3AZJ B;  3FTB A;  3PJ0 A;  5FT5 A;  1RV4 A;  5F99 C;  3C1C B;  3G7Q A;  5GT0 B;  4AWL B;  3B6G D;  2VGT A;  2DGL A;  5B33 A;  5E5I A;  4F5J A;  1QIR A;  1J32 A;  5B2J B;  3I4J A;  3KFU G;  1MAP A;  3N0L A;  4ZWM A;  2D66 A;  3LZ0 B;  4ZM4 A;  3FQ8 A;  5BNX A;  3TAT A;  5AV6 C;  3W97 C;  3AZH C;  1M0O A;  4ZDP A;  1TPL A;  4YS3 A;  2ARO A;  3WKJ C;  3MGQ A;  5E3K A;  5B1L C;  2R5C B;  3WAA C;  1ASF A;  3EPH A;  4KGC D;  1D7V A;  2CWE A;  4E77 A;  2JG2 A;  1AKA A;  3LVL B;  3LJA D;  1CL2 A;  4MKJ A;  2EGY A;  2JJH A;  2VI9 A;  5FUG B;  2XD1 A;  4XZQ D;  3NU7 A;  5BNV B;  1GC0 A;  4GEB A;  4F5I A;  2WB6 A;  1Q9C A;  4PFN A;  3MC6 A;  1KKP A;  1SZK A;  1EQZ B;  2CV5 D;  2W7M A;  1P3K D;  3TCM A;  4RKD A;  3II0 A;  3PA9 A;  3N4X A;  2F8N A;  3DOD A;  3MVD B;  1P3A C;  1ORD A;  1LS3 A;  1KX4 D;  3QPG A;  3M5U A;  1P3P C;  3CQ4 A;  3CAI A;  3AZI D;  5BO0 A;  1TAS A;  2QBT A;  2BIE A;  3AFA D;  2RVQ C;  3C1B D;  2V1P A;  5GXQ C;  3AV2 A;  1KX5 B;  3B6G B;  5DJ9 A;  2XH1 A;  1QIS A;  3BCB A;  3V9R A;  5B0Y D;  2BYK A;  2ZJG A;  3E2Z A;  4WU9 A;  4H9R A;  4KYO A;  3WKJ D;  1TOE A;  4N0W A;  3LVJ A;  3L44 A;  4R2N A;  1G7X A;  2W7K A;  2TPL A;  3W1I A;  3VOM A;  2EH6 A;  3C1C A;  5GT0 A;  3WLX A;  4WJ3 C;  4G91 B;  5AVB A;  2HP2 A;  2E54 A;  3VH6 A;  4J8W A;  2W7J A;  3MNN B;  1G7W A;  5AV8 A;  3EPL A;  3NQU A;  3MGR A;  3CQ5 A;  3DR4 A;  2HUF A;  3EPJ A;  4RKC A;  1OXP A;  4AZJ A;  1TAF A;  1GC3 A;  3FSL A;  4P3M A;  2XD5 A;  2AAT A;  5EUD A;  2NQB D;  3AZN B;  1MDX A;  2RFV A;  3DU4 A;  1Z3Z A;  5AVC A;  5FUG A;  5CPI C;  3R4T A;  5B0Z B;  1M1A C;  2W7I A;  4J8X C;  1IBJ A;  3PDB B;  5BT1 C;  1BH8 A;  4Z5T D;  1YNU A;  3TU4 C;  1MGV A;  1EQZ A;  1ASB A;  3JTX A;  2HOR A;  5E5A C;  1OHW A;  3KXB A;  1H1C A;  1IX7 A;  1MLZ A;  2Y2K A;  3WY7 A;  3A6N D;  1KX5 A;  5DB5 A;  3BS8 A;  3LEL D;  3DXW A;  2X8U A;  4G92 C;  4ZUX D;  3OKS A;  3NUB A;  3UTB C;  3EIB A;  3CQ6 A;  3VAX A;  4JF1 A;  4UHO A;  2AY1 A;  1XI9 A;  4KUD C;  1TOK A;  1EJI A;  3FDD A;  5DNM D;  3K7Y A;  4XQ2 A;  3WZF A;  2HIO B;  2C7T A;  3PAA A;  1E5E A;  5CPI D;  1P3M D;  3USF A;  1C7G A;  3MNN A;  2D65 A;  1QJ3 A;  1TAT A;  5CP6 C;  3KWQ C;  2YRI A;  1AOI A;  4OYT A;  2FJ7 C;  1M4N A;  5G2Q A;  3MAF B;  5E5A D;  4E44 A;  1SZU A;  1S06 A;  3EI5 A;  1S32 A;  5CPJ C;  2GQN A;  1H0C A;  1P3B C;  4M2J A;  4DQ6 A;  4J8L A;  3AZN A;  4EFF A;  4M2M A;  4WV4 B;  3EZS A;  3A2B A;  5BJ4 A;  3E2Y A;  3FQA A;  4R5Z A;  1JFI B;  1RVY A;  5EUN A;  2GMU A;  3PDB A;  3EI8 A;  3MAD A;  5DJ1 A;  3WTP E;  1W23 A;  4CBR A;  3AAT A;  3W99 B;  1F66 B;  2Y2P A;  1W7N A;  3WTP B;  3WCN A;  2DGK A;  2HUE C;  5B31 A;  4WB0 A;  4JEZ A;  1KL1 A;  3BWN A;  4EMY A;  5G49 B;  3REL B;  1BFM A;  1CJ0 A;  3VK3 A;  2DQN C;  1LW4 A;  4MKK A;  3UT9 D;  2FJ7 D;  5B1L A;  3X1T C;  1AHY A;  2ZY2 A;  2F8J A;  5AV5 D;  1M0N A;  3R45 A;  5JAY A;  2VQR A;  4M6B A;  2HOY A;  2ZY3 A;  3GWP A;  4W8I A;  1W7L A;  3KKI A;  2JIS A;  4XJM A;  3MGP C;  2OGE A;  1WYV A;  3E6G A;  1P3L B;  3AZK D;  1ASM A;  1AKB A;  4ZSW A;  3NTJ A;  2DF4 C;  1U35 A;  4WU8 A;  1P3A A;  4WLH A;  1IX6 A;  3VH5 A;  3WKR A;  1P3P A;  4WYC A;  2CJH A;  3MAF A;  4MSO A;  1CQ7 A;  2JGT A;  5CPK C;  2FYF A;  4H9P B;  1F1E A;  1N2T A;  3FZ7 A;  1D7R A;  9AAT A;  5JA4 A;  5GSU D;  3MGS C;  1JFI A;  5AY8 B;  1AMS A;  3O62 C;  1CZC A;  3AZL D;  2AY3 A;  5B2I B;  1QZ9 A;  4AZK A;  3X1S D;  1M18 B;  1ZOD A;  4H9Q B;  3W96 C;  4H51 A;  1ART A;  3X1U C;  3AN2 C;  4J8U D;  2W7G A;  5G4I A;  2GSA A;  4X23 D;  2EZ1 A;  1F66 A;  4Z2M G;  3H0R C;  4XUJ D;  3FZ8 A;  5F8V A;  5B40 D;  5B32 B;  1LC7 A;  4YM6 C;  5DNN A;  2BHX A;  4J8V B;  2Z1Y A;  2VGS A;  2ORD A;  1B9H A;  3UTA D;  2DOU A;  3AYW B;  1O4S A;  3W98 B;  2HUI A;  3NYT A;  3REL A;  2IO5 B;  2BI5 A;  1T3I A;  3AZG B;  3AZE C;  5JRG B;  3RCH B;  5B1M C;  3WA9 B;  1DTY A;  4ZAH A;  2PYO C;  3DRD A;  2F8N G;  3MGQ D;  4WYE A;  2R2N A;  5EIG A;  1TZY D;  5BS7 C;  1M1A A;  3JW9 A;  3REH A;  3AV1 C;  4F4E A;  3OP7 A;  2PB0 A;  4AWL C;  3TU4 A;  4W1V A;  4DRA A;  4R8P D;  1AHF A;  4WP0 A;  5B2J C;  1V2F A;  4K2B A;  4A6R A;  2YHK A;  4ITX A;  2VMZ A;  2NZD C;  3B6F C;  2YFV B;  4WNN B;  2ZSL A;  2F8N D;  4LNL A;  1BW0 A;  2ZYJ A;  3AZF C;  1BJO B;  1TOI A;  4ZDL A;  2YKX A;  1ZLA C;  4JJN D;  3REJ A;  7AAT A;  5B2I A;  3AV2 D;  1P3W A;  3CBF A;  3AZM C;  3AZE D;  4WXB A;  1KX3 B;  2VLH A;  5B33 B;  3HVY A;  4H9Q A;  5GT3 B;  4Z66 C;  4KUD A;  4ZDO A;  4WU9 D;  4PIW A;  3BC8 A;  4J5U A;  1P3O B;  2WK9 A;  3N75 A;  2VMO A;  5EFS A;  1UU2 A;  5G2P A;  3AZJ D;  3MVD C;  4LD9 B;  4TMR A;  3ZRR A;  4IXO A;  4JEV A;  4YS3 B;  2NMP A;  2ARO B;  2BYL A;  4J8V A;  4XJP A;  3RUY A;  3C1C D;  5GT0 D;  2D7Z A;  2VMS A;  4CVQ A;  3KWQ A;  1HQ3 B;  3BN1 A;  5B2J D;  1P3F B;  3AOW A;  3AZG A;  4UHN A;  1CZE A;  3B6G C;  3LZ0 D;  5B24 B;  5JRG A;  3RCH A;  2FN6 A;  1U08 A;  4PVF A;  1DKA A;  4IXZ A;  4UOY A;  4A0F A;  3A1K A;  1BJW A;  2BYM A;  1D7S A;  3AEN B;  3G0T A;  4EB5 A;  4UHM A;  5D95 A;  4CSR B;  4KGC C;  4G91 C;  1MLY A;  4ZLV A;  3LJA C;  1C0N A;  4NFT A;  1P34 A;  4XZQ C;  1EQZ D;  3V9R B;  2YFV A;  1MDO A;  1AHE A;  3MVD D;  1Z7D A;  3FQ7 A;  2CV5 C;  1CQ8 A;  3LZ1 B;  1P3K C;  1B5P A;  3WX9 A;  4ADB A;  1KX4 C;  4MQQ A;  4UUZ A;  3I5T A;  4FL0 A;  3AZI C;  1KX5 D;  1RVU A;  5B0Z C;  3X1T A;  1KX3 A;  3AFA C;  1LC8 A;  3C1B C;  2VGU A;  5AVB B;  5GT3 A;  3L8A A;  3BWO A;  1O62 A;  4J8W B;  2VGZ A;  4XEW A;  4EO5 B;  1P3O A;  4RAE A;  3B0C W;  5AV8 B;  5B0Y C;  4WXG A;  3NQU B;  1N8P A;  3REK B;  4LD9 A;  3MGR B;  4EB7 A;  2BIG A;  2F2A C;  2BKW A;  2FKI A;  1TAF B;  4WYD A;  4LNJ A;  1C4K A;  1PZR A;  2O0R A;  1HQ3 A;  4BMK A;  1LK9 A;  1P3F A;  1ID3 B;  2JJE A;  2QA3 A;  5B24 A;  5AVC B;  3MNN D;  1PMO A;  1YJY A;  1AMA A;  2QMA A;  1BH8 B;  5AV9 B;  5EQC A;  3AEN A;  2AY6 A;  3KUY A;  4DRB A;  1M19 A;  3COG A;  1JS6 A;  2Z9V A;  3O62 A;  1OXO A;  4H9O B;  4IX8 A;  3AZN D;  4CSR A;  5FT8 A;  2HIO C;  2WK7 A;  1P3I B;  3KXB B;  2CH1 A;  5B0Z D;  2FM1 A;  3DYD A;  2Y2Q A;  3X1U A;  2LY8 A;  2NQB C;  1B4X A;  2Y2I A;  4QLC B;  4RLG A;  4Q76 A;  3VH6 W;  4Z5T C;  1AHX A;  3LZ1 A;  4KHA A;  2Z9U A;  1AKC A;  5IWQ A;  4ADC A;  3GR9 A;  3FCR A;  1C9C A;  2Z61 A;  5B1M A;  3A8U X;  2VGV A;  1N1J B;  2PYO A;  1AJS B;  3A6N C;  2Y2N A;  1ECX A;  1M0Q A;  1X0M A;  2O1B A;  1A7W A;  3LEL C;  3A1I A;  1YIZ A;  1S09 A;  4AO4 A;  3REK A;  3AV1 A;  4ZUX C;  1AOI B;  2G6W A;  3WTP C;  1GEY A;  3E77 A;  1P3G B;  3LG0 A;  2HIO D;  1ULY A;  1S32 B;  1LC5 A;  5DNM C;  1ID3 A;  3RI6 A;  2ZY4 A;  3B6F A;  2W8T A;  3AEM A;  2Y2H A;  3P5J B;  1P3M C;  5AV9 A;  3UAK A;  1BQD A;  2CAN A;  4CXQ A;  2QSR A;  1VP4 A;  1KKJ A;  1X2A A;  2J8P A;  3QM2 A;  4ATP A;  3X1V A;  3AEJ A;  1ZLA A;  3H0M C;  1B6W A;  4E45 A;  5F99 B;  1BKG A;  4H9O A;  2BI2 A;  1P3I A;  1AAW A;  1AY5 A;  4Z66 A;  2CFB A;  5B31 B;  4WB0 B;  3G8M A;  3UE8 A;  1P3L C;  3I16 A;  3WCO A;  4ADE A;  2G5H C;  1GEW A;  5AV6 B;  4UQV A;  3AZH B;  4QLC A;  4WYA A;  4IXS A;  2XBN A;  3W99 D;  1F66 D;  2E7J A;  3GZC A;  5B1L B;  3WTP D;  3FZ6 A;  3WAA B;  3REI A;  3FD0 A;  2EPJ A;  4A00 A;  3LWS A;  3R45 B;  1WKH A;  1MAQ A;  2W7L A;  3PD6 B;  2Y2L A;  5AX8 A;  1ZC9 A;  3REL D;  1N1J A;  1AJS A;  1WYV B;  2Z20 A;  4IYO B;  1M18 C;  3GET A;  4W91 A;  2BG1 A;  1U35 B;  4WU8 B;  1X29 A;  1P3A B;  1ASL A;  3EI7 A;  4K2M A;  2R0T A;  3UT9 C;  1P3P B;  3QI6 A;  1P3G A;  5B32 C;  4H9S A;  4OMA A;  5AV5 C;  1AIB A;  4ADD A;  4BA4 A;  3NYS A;  5GXQ B;  2VMR A;  3D6K A;  1P3L D;  4GSA A;  1W3U A;  5JA4 B;  1QJ5 A;  4NE6 A;  2IO5 C;  1AIA A;  3NDN A;  3AZK C;  1V2E A;  2CV5 A;  2QLR A;  4ISY A;  3B0C T;  3WA9 C;  5HXX A;  5B32 G;  4Y0H A;  1KX4 A;  4E1O A;  3FRK A;  5F99 A;  1N31 A;  3C1B A;  5DNN B;  3PGY A;  5AY8 D;  5K8B A;  2W8V A;  5B2I D;  2RIQ A;  1YIY A;  2AY4 A;  1I29 A;  2KFP A;  2YOB A;  5GSU C;  3W97 A;  5AV6 A;  3AZH A;  1M18 D;  3EI9 A;  3TFU A;  1V2D A;  3AZL C;  1AAM A;  3WKJ A;  1OAT A;  3X1S C;  2W8S A;  2YKU A;  3WAA A;  5B32 D;  4J8U C;  4X23 C;  3W1H A;  4HGA B;  4XUJ C;  3VH5 W;  4J8V D;  5B40 C;  4FFC A;  5EIG B;  3PD6 A;  3AYW D;  1M1A B;  4JEW A;  1SZS A;  3W98 D;  3ECD A;  4J8X B;  3REH B;  1AX4 A;  4R5F A;  2AEU A;  3AZG D;  3HT4 A;  3TU4 B;  3UTA C;  5JRG D;  4IYO A;  5D5S A;  2VIB A;  4OBU A;  3WA9 D;  5FT4 A;  3A9Y A;  3VH6 T;  3B1D A;  2W7H A;  2BYJ A;  3B0D C;  3MGQ C;  3ELP A;  1PFF A;  3GBX A;  4XAU A;  5GXQ A;  1TZY C;  3Q8N A;  3BCA A;  2DGM A;  2JJG A;  1O69 A;  4F5M A;  2CH2 A;  1FC4 A;  4G92 B;  1QIT A;  3REJ B;  4OBV A;  3UTB B;  1AIC A;  2VMX A;  4R8P C;  1AMR A;  4XJO A;  3FVU A;  2ZM5 A;  4KUD B;  4BHD A;  3KGW A;  3MC6 C;  5HHY A;  1ARH A;  1SF2 A;  3VK4 A;  3AEP A;  3NUI A;  1B9I A;  2W7F A;  1W2E A;  3MKJ A;  5C6U A;  3IHJ A;  4B98 A;  3HMU A;  4GDY A;  2ZP7 A;  5F9S A;  4JEX A;  1KX3 D;  2W7E A;  5CP6 B;  5B33 D;  3KWQ B;  1FG7 A;  4JJN C;  5GT3 D;  4ZUX A;  4HF8 A;  3AV2 C;  2Z1Z A;  2BWO A;  1P3O D;  3ZZJ A;  5EUE A;  1G4X A;  4A72 A;  5CPJ B;  1D7U A;  4LD9 D;  1WST A;  4WU9 C;  1P3B B;  4YS3 D;  2ARO D;  2BYM B;  1WYT A;  5C3I C;  5E4Z A;  4GE4 A;  5CPI A;  1SPA A;  2VMY A;  3AZJ C;  1AY8 A;  3DR7 A;  4B9B A;  4J8X A;  1HQ3 D;  5M4D A;  3LVK A;  2O7C A;  1P3F D;  3C1C C;  5GT0 C;  1BS0 A;  1X28 A;  3IP4 C;  1ELU A;  5B24 D;  2AY7 A;  2ZY5 A;  5AVB C;  4WZS B;  3HBX A;  4R8D A;  1IX8 A;  4DQY B;  4J8W C;  1SVV A;  3LZ0 C;  2Z9W A;  5E5A A;  1P34 B;  4BA5 A;  5AV8 C;  3HL2 A;  1VEF A;  2JCH A;  4ZSY A;  2HUE B;  3MGR C;  4WD2 A;  3ACZ A;  1G4V A;  3LVM A;  3B1E A;  4Y0I A;  3MEB A;  3GZD C;  4CAY A;  1DGE A;  4UUZ B;  3BV0 A;  3AL0 C;  3A9X A;  3UTB A;  3AEL A;  3X1T B;  1TAR A;  2VMQ A;  4AOA A;  3T32 A;  1EQZ C;  3LZ1 D;  4ZBJ B;  1BH9 A;  3BCX A;  1ASE A;  3FFR A;  3MGP B;  3P1T A;  3KXB C;  5TF5 A;  5CP6 A;  5AVB D;  4RJ0 A;  4A0H A;  2FJ7 A;  4J8W D;  1KX5 C;  4A6U A;  5AV8 D;  3QHX A;  5CPK B;  1AJR A;  5AV5 A;  5CPJ A;  3REK D;  3MGR D;  1P3B A;  4LC3 A;  4JF0 A;  1AHG A;  1ASD A;  3KUY B;  2EZ2 A;  1M19 B;  3MGS B;  3B1C A;  4Q31 A;  2CB1 A;  3O62 B;  4W5K A;  1ID3 D;  2OQX A;  5AVC D;  4WYG A;  3X1U B;  3AN2 B;  4F5F A;  5AV9 D;  2VMV A;  3WKS A;  1QGN A;  3MNN C;  1WWI A;  4HVK A;  4YM6 B;  1AOI C;  2BI1 A;  3VH5 T;  4UPK A;  1UU1 A;  1P3I D;  1S32 C;  4KHA B;  1S0A A;  3KXB D;  5G4J A;  3AZL A;  4OTL A;  3AZN C;  1BT4 A;  3LV2 A;  3X1S A;  4QLC D;  5B1M B;  4F5G A;  4X23 A;  2PYO B;  5M4B A;  2GB3 A;  2Y2M A;  1DJ9 A;  5B40 A;  4OT8 A;  2X5D A;  3REI D;  3AV1 B;  3ZRQ A;  3MGP A;  4ZAS A;  1C7N A;  3UTA A;  1WYU B;  3WGC A;  2G5I C;  3HLM A;  1PG8 A;  2X3L A;  5B31 C;  2CY8 A;  3BWN C;  2NZD B;  3B6F B;  4PFF A;  4DBC A;  5CPK A;  2QB2 A;  2ZC0 A;  3VP6 A;  1AOI D;  1Y4I A;  4IY7 A;  1P3G D;  1TZY A;  3AZF B;  3EUC A;  4A6T A;  2YCT A;  3MGS A;  1S32 D;  1J04 A;  3X1V B;  1ZLA B;  5I92 A;  2BI9 A;  4W1W A;  5B31 G;  3N5M A;  3NRA A;  3AZM B;  1LKC A;  4R8P A;  3EPK A;  2VGW A;  1ASG A;  2EYQ A;  4K2I A;  4XJL A;  4Z66 B;  3W96 A;  3AN2 A;  2L5A A;  1U35 C;  1MDZ A;  4WU8 C;  4F5H A;  4M2K A;  4YM6 A;  1IUG A;  1S08 A;  5F99 D;  2D5Y A;  1AMQ A;  2FFF B;  3REI B;  4JJN A;  5B31 D;  5M46 A;  3AZE A;  4I8A A;  1H3O B;  5AV6 D;  3W97 D;  2W8U A;  3AZH D;  4AO9 A;  1ARG A;  4E3Q A;  1DFO A;  2DR1 A;  3EIA A;  2VMP A;  4BQ0 A;  3AOV A;  2YCN A;  5G0A A;  5B1L D;  1C7O A;  3PPL A;  3WAA D;  5BS7 A;  3AZJ A;  3DXV A;  2W8W A;  1V72 A;  3W99 C;  4RM1 A;  1F66 C;  1BJ4 A;  1FG3 A;  1WYU A;  3FKD A;  1TOJ A;  4KGC B;  5DNN C;  1T3U A;  4NOG A;  5B2J A;  1OHY A;  3LJA B;  2C44 A;  1Z2C B;  3KSY A;  3LZ0 A;  4XZQ B;  3LY1 A;  1HTA A;  2NZD A;  3REL C;  1I41 A;  1U35 D;  3JWA A;  3FDB A;  4WU8 D;  4LW4 A;  1P3A D;  2CJD A;  3MBB A;  2F8N K;  1P3P D;  2R5C A;  2CV5 B;  3AZF A;  1P3K B;  4MQP A;  2RVQ D;  1KX4 B;  2FQ6 A;  4HGA C;  3GZD A;  1GD9 A;  3AZI B;  5GXQ D;  3AZM A;  3JZL A;  3AFA B;  5BNV A;  3C1B B;  3REH C;  3MAU A;  1ZOB A;  1GEX A;  2VLF A;  4LNM A;  2BWP A;  2AY5 A;  1E5F A;  2ZSM A;  5B0Y B;  3W97 B;  3GJU A;  3MVD A;  5KDM B;  5HDM A;  3WKJ B;  3H0L C;  1VJO A;  1M0P A;  2VMT A;  5DNN D;  2VYC A;  2Y2G A;  1GBN A;  3B6G A;  2YKV A;  2D7Y A;  1H3O A;  4E3R A;  1GDE A;  5AY8 C;  1JS3 A;  3REJ C;  5B2I C;  2AY9 A;  1CL1 A;  2E7U A;  2HUU A;  4WXF A;  4KGC A;  1AY4 A;  1M1A D;  3KGX A;  1D2F A;  4NE5 A;  4J8X D;  2NQB B;  5BT1 D;  3LJA A;  3REH D;  1KU5 A;  4Q75 A;  3AV7 A;  4J8V C;  4L0O A;  4RIZ A;  3ATH A;  3TU4 D;  4XZQ A;  1TOG A;  8AAT A;  3AYW C;  4QGR A;  3W98 C;  2C81 A;  3H9X A;  4CXR A;  3AZG C;  1LW5 A;  2FNI A;  4Z5T B;  5JRG C;  2D63 A;  3EI6 A;  1P3K A;  4ZWV A;  4MQR A;  3ELE A;  3PIU A;  4Q6R A;  3AZI A;  3EG5 B;  2W7D A;  1ASC A;  1XEY A;  5B0Z A;  3AFA A;  4WBT A;  1ASN A;  3A6N B;  3REJ D;  3UTB D;  3UWC A;  3LEL B;  5B0Y A;  5KDM A;  1YJZ A;  4ZUX B;  4KAM A;  4KUD D;  2CST A;  3F6T A;  1P34 C;  2AEV A;  1BQA A;  4F5K A;  4A0G A;  2WKA A;  2Y2J A;  5DNM B;  1WWS A;  2YRR A;  3ZZK A;  1WYT B;  5EAV A;  2BWN A;  1GCK A;  5CPI B;  1O61 A;  3E2F A;  1KMK A;  1M6S A;  1SFF A;  1P3M B;  5CP6 D;  1GC4 A;  3KWQ D;  4DGT A;  4WLJ A;  3FVS A;  1KX3 C;  2PB2 A;  2HP1 A;  5B33 C;  5GT3 C;  5CPJ D;  1ASA A;  4LW2 A;  1P3B D;  2EO5 A;  2HIO A;  5E5A B;  1P3O C;  2GMS A;  4A0R A;  2AY8 A;  2PO3 A;  4ZBJ C;  2D64 A;  4LD9 C;  4YS3 C;  2ARO C;  2E7I A;  2NQB A;  1W7M A;  3B8X A;  2R5E A;  4EU1 A;  1OHV A;  3HQT A;  2VI8 A;  2YKY A;  3E9K A;  1HQ3 C;  2D61 A;  2HZP A;  1P3F C;  3NU8 A;  4CAY B;  3NQJ B;  2Q7W A;  4Z5T A;  4Y0D A;  4CBS A;  5B24 C;  1P34 D;  1YJS A;  2CTZ A;  1DGD A;  1KL2 A;  2HOX A;  2V0Y A;  3EZ1 A;  1IAX A;  4OC9 A;  2OGA A;  3FVX A;  1PMM A;  3NX3 A;  3PDX A;  1ARI A;  3KUY C;  2AY2 A;  3F0H A;  1M19 C;  4IW7 A;  3W1J A;  1BH9 B;  3DC1 A;  4H9N B;  2A1V A;  3HDO A;  3A6N A;  2DKJ A;  1KMJ A;  1M7Y A;  3AEO A;  5BJ3 A;  1UU0 A;  3LEL A;  3X1T D;  3KE3 A;  5M49 A;  3W99 A;  3UT9 B;  2FJ7 B;  3WTP A;  2ZUK A;  1JF9 A;  5CHL B;  4RIT A;  4MY5 A;  4RJY A;  5AV5 B;  4U1T A;  1S07 A;  3MGP D;  5DNM A;  1YOO A;  2YCP A;  2JE5 A;  3LZ1 C;  3FFH A;  5G49 A;  1GC2 A;  2G7J A;  2YFW B;  1P3M A;  1CQ6 A;  2OKJ A;  1CS1 A;  3AZK B;  5FT6 A;  4GE9 A;  4ITG A;  5CPK D;  3B0B A;  2C0R A;  5KTB A;  1DJU A;  4NE3 A;  2VMN A;  3K40 A;  4P7Y A;  4EO5 C;  4OCA A;  3KUY D;  3RBF A;  1M19 D;  3MGS D;  2VIA A;  3REK C;  3N4S A;  3O62 D;  1P3L A;  1ELQ A;  2JJF A;  5DX5 A;  2UWX A;  1JG8 A;  5GSU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...