2ZY3A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
510
structure length
510
Chain Sequence
ELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords L-aspartate beta-decarboxylase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
total genus 189
structure length 510
sequence length 510
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy3A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy3A01
1CL2A 5EUNA 4ADDA 1LKCA 4W1XA 3GR9A 4BA5A 3RUYA 1VP4A 3DYDA 4WYGA 1MLYA 1G4VA 4GRXA 4EB7A 4IW7A 2BWNA 4LW2A 5E5IA 2QBTA 4A6UA 4HF8A 4XJPA 2QB3A 3N75A 3LVMA 2W7EA 3VK2A 3AEMC 4BHDA 4MKKA 4TN4A 1ASNA 3T32A 3UWCA 4WD2A 5G09A 2W7DA 3ELEA 5G0AA 2R5CB 1E5EA 3L44A 3PDBB 2D64A 3ELPA 3EZSA 4N0WA 1SPAA 2VMVA 2GMSA 2CANA 1KL1A 2VMNA 1CS1A 4GE9A 1W7MA 1H0CA 1AKBA 3AEOA 2FYFA 1CZEA 4JF1A 1AMSA 3ZZJA 3B1DA 4Q75A 4WBTA 3GZDA 2VIBA 4IYOB 3E6GA 1S08A 2VYCA 1DFOA 1PFFA 1YOOA 3EUCA 3NU8A 3QN6A 1E5FA 1J04A 2W7IA 1M0PA 1UKJA 1VEFA 3Q8NA 1YNUA 4WYFA 3NTJA 3FCRA 1TOKA 2R5CA 4M2KA 4QGRA 3PDBA 1LW4A 4ZLVA 2G6WA 4F5LA 1WYVB 4MQPA 1O4SA 1M4NA 5E4ZA 3A9XA 1YIYA 2R0TA 3BV0A 4ZASA 1ARTA 1EG5A 3H7FA 3PA9A 4U1TA 2C7TA 1I29A 1TOGA 2GQNA 4R5ZA 3JTXA 5DJ9A 4K2IA 4Y0HA 3CQ4A 1AIAA 3PPLA 2ORDA 3LG0A 4IYOA 2HOYA 2EPJA 4KXKA 5I92A 3USFA 2Z1YA 4WYDA 4B98A 2BWPA 2DOUA 3FDBA 2W8TA 4R2NA 2JGTA 1Y4IA 1SZUA 4XQ2A 1WYVA 2W7KA 3FVUA 1O61A 4F5GA 4CXQA 1JS6A 1VJOA 5C6UA 4NOGA 4UOYA 3K40A 1X0MA 2QLRA 4BA4A 3B46A 4XK1A 3LVKA 3N5MA 3WX9A 4WXFA 1D7VA 2Z1ZA 4FL0A 4IY7A 4F5IA 1BQDA 3MADA 1OHWA 1S07A 2HOZA 1GBNA 4E3QA 4F4EA 4F5KA 4ZWVA 4XJMA 4XAUA 2AY8A 3UE8A 2W7MA 1WYTB 2JJGA 2CINA 1MAPA 4ADEA 3VAXA 4EMYA 2C81A 1EQBA 2ZP7A 3II0A 2DKBA 3E2FA 3QM2A 2OGAA 1AAWA 1B8GA 4P7YA 4E77A 2ZY3A 4MQQA 1ELUA 2VMOA 3EI8A 1SF2A 3PIUA 4F5MA 3A8UX 3RCHB 4A72A 1S0AA 1FG3A 3ECDA 2BYJA 2CJDA 1BQAA 2CH1A 2VGZA 3WZFA 1BJOB 3EIAA 4OT8A 4IXOA 1GC0A 1QGNA 1WYTA 4EU1A 4OCAA 2JG2A 1AY8A 1XI9A 2VMYA 4IXSA 4Q31A 3EIBA 2E54A 2NMPA 2D61A 2Z9UA 1X2AA 3LY1A 3NYUA 4BMKA 1M32A 1AJSB 3I5TA 5M46A 1LC5A 2ZC0A 4KYOA 3K7YA 3VK3A 1N2TA 3ISLA 1FG7A 2W7HA 2VMUA 2YRRA 1AKAA 1CQ7A 2ZJGA 1OXOA 1CQ6A 3AEJC 3COGA 2BI3A 1BJ4A 3DR4A 5BJ3A 3RCHA 1G4XA 3MAUA 3ZZKA 4Q76A 4AO4A 2YHKA 2BIGA 4PIWA 1H1CA 3PGYA 2CFBA 1P3WA 1BJOA 2ZUKA 3FQAA 3LVLB 2AY7A 1TATA 3ZRRA 3NUIA 2PB2A 2R2NA 3I4JA 3KGWA 4DBCA 1ASEA 1MDXA 2JJHA 1AJSA 3FSLA 4M2MA 2E7UA 4LC3A 3CBFA 2W7LA 3M5UA 3QGUA 4O6ZA 3TFUA 4RAEA 1S09A 1AMAA 1GEXA 3B1EA 3PD6B 1IBJA 3IHJA 2Z9VA 3AEPA 1ASBA 1KMKA 2O0RA 4CVQA 3D6KA 1IJIA 5FT6A 2AY4A 1KL2A 1JF9A 2ZYJA 3BCXA 4JEYA 2BI2A 3NYTA 2Z61A 4LNLA 2YCPA 3MC6A 4IXZA 5FT8A 2BI5A 2VLHA 3B8XA 4XJLA 5BJ4A 2EZ2A 4AZJA 2HP1A 2XBNA 4W5KA 1O69A 3EI9A 2W7GA 4W1VA 4ATQA 4JF0A 1TASA 2F8JA 4IX8A 1YJSA 2VGTA 3BWNA 2ZY2A 4OMAA 1D7UA 5JAYA 1I41A 3BS8A 3PD6A 4EFFA 1X28A 3LWSA 2HUFA 1MGVA 3ACZA 4K2BA 2DKJA 5DJ1A 1BT4A 1C9CA 1IX8A 5M49A 2CJGA 3TCMA 1X29A 2GSAA 1W3UA 2GMUA 4HVKA 2VI9A 1OATA 2D66A 1AHFA 3FQ8A 1GC4A 4EB5A 1AHYA 1KKPA 5M4DA 3NU7A 1BW0A 5HHYA 1BKGA 2W7JA 3TFTA 1D2FA 1TOJA 4JEZA 1WKGA 1ZOBA 1AAMA 2VMTA 2Z20A 3KKIA 1LK9A 4WYEA 1I43A 1YIZA 1V2FA 2YKXA 4MSOA 2Q7WA 3BC8A 1AICA 3F0HA 3ZRPA 1ASLA 1TPLA 3G7QA 3BWOA 1GEYA 3VOMA 4L0OA 2C0RA 1V2DA 3HMUA 1GCKA 3MAFB 1AMQA 3E2YA 4F5HA 1OHVA 4ADCA 3NRAA 1AHXA 3WGCA 4B9BA 4WXBA 4XJOA 2VMPA 1V2EA 3AOWA 4CXRA 1ASGA 3NDNA 3JWBA 4W91A 5DX5A 1AKCA 3DXVA 1M0OA 1DJEA 3WKRA 5HDMA 3QHXA 4BQ0A 1DTYA 1Z7DA 3GETA 3DC1A 1AHEA 1RV4A 4RJYA 2AY1A 5FT5A 4R5FA 2VI8A 2WK7A 3L8AA 4UHNA 4WLJA 3NYSA 4AH3A 2VGWA 1UU1A 3A9YA 1MDZA 3DODA 3MAFA 4K2MA 4MKJA 2EZ1A 2FQ6A 4WYCA 5E3KA 5HXXA 1UU2A 3QBOA 4I8AA 3QI6A 4DGTA 1C0NA 1SZKA 3F9TA 3GZDC 2DR1A 2AATA 5F9SA 4ADBA 1IAXA 1RVYA 3FVSA 2YKUA 1B4XA 1ASMA 2BYLA 3N0LA 2X5FA 2BWOA 1BS0A 1QJ3A 1RV3A 1T3IA 3AEMA 3DXWA 1U08A 4PVFA 3BB8A 4TMRA 4ZAHA 2QMAA 4WP0A 1ASDA 1I48A 1SZSA 3ZRQA 1OXPA 4GE7A 5G2PA 1GEWA 3WY7A 4ZSWA 1AIBA 1AHGA 4JEWA 2OATA 1MAQA 4A6TA 2EGYA 2WK9A 3RI6A 1LC8A 2VMWA 2CJHA 4ZWMA 1CQ8A 3NNKA 1GD9A 1B9IA 1YAAA 3WKSA 4AO9A 4AZKA 4Y0DA 2BI1A 2WKAA 3UAKA 4AOAA 1WYUB 2CSTA 1TOEA 4ISYA 2HOXA 4ZDPA 1CL1A 8AATA 1AY5A 5DB5A 2VMQA 1V72A 3TQXA 1ZC9A 2V1PA 1WSTA 1M0QA 2C44A 2W8WA 2AY3A 4J5UA 5EQCA 1DJ9A 4ZSYA 2VIAA 1YJZA 2AY6A 5EUDA 3FKDA 4UHOA 5EAAA 1BJWA 2D65A 3AENB 1MDOA 4PFFA 1DGDA 1Z3ZA 3EI5A 3FFRA 2GB3A 5AX8A 3CQ5A 1N8PA 4RKCA 1WYUA 4W8IA 2ZY5A 4OYTA 1YJYA 2YCNA 1IAYA 1M6SA 1QIRA 4MY5A 3EI6A 1D7RA 2O1BA 2YOBA 3FQ7A 1C4KA 1AMRA 1QJ5A 3BCAA 3GBXA 3CQ6A 3P6KA 4GDYA 3RBFA 7AATA 5EAVA 3PDXA 1B9HA 3HDOA 4A0FA 2VGVA 2ZY4A 3AENA 3FRKA 3E77A 4H51A 3WGBA 1ZODA 3MKJA 3B1CA 3HLMA 5EIGB 2W8VA 4KAMA 2X8UA 1JG8A 1GC3A 1M7YA 2CY8A 3F6TA 4OTLA 3A2BA 4P3MA 3BN1A 2Z9XA 1RVUA 1J32A 1QZ9A 2BIEA 3LV2A 1TOIA 1ASCA 1ECXA 4A0RA 4LW4A 3HL2A 2VMRA 1TARA 2D7YA 2HORA 5F8VA 3RQ1A 2YCTA 3FVXA 1AY4A 3PAAA 5M4BA 1GC2A 2R5EA 3JWAA 1KMJA 4ZDOA 4ATPA 5IWQA 2Z9WA 4A6RA 3FFHA 5EIGA 3E2ZB 3GZCA 2HZPA 1ASFA 1AX4A 2YRIA 3HQTA 4E1OA 2CB1A 2O7CA 2OQXA 1AJRA 4MQRA 1ORDA 4F5JA 3DRDA 3MBBA 3VK4A 1B5OA 2ZSLA 4ZM4A 2AY9A 2VMZA 4FFCA 1LW5A 5EUEA 3NX3A 1G7WA 2HUUA 3GJUA 2JJFA 3RBLA 2AY5A 4JEXA 1EJIA 4WXGA 1GDEA 3WLXA 2OGEA 1ARGA 4XEWA 1IVRA 3R9AA 3E2ZA 1W7LA 3OKSA 2VMXA 4E3RA 3FDDA 4W1WA 3AEJA 2AY2A 2JJEA 2VGSA 1WKHA 1C7OA 1IX7A 2ZSMA 3CAIA 1LS3A 1S06A 4WYAA 1W7NA 2XH1A 3MC6C 4UQVA 2W8UA 2W8JA 3OP7A 2FM1A 4ZDLA 2CTZA 3R4TA 4RKDA 2PO3A 1ARSA 3DU4A 3P1TA 4OC9A 3ASBA 3BWNC 2D5YA 4CBRA 3PJ0A 4A00A 1B5PA 3ATHA 4WLHA 1ARIA 4CBSA 1M0NA 5G2QA 1MLZA 2YKYA 1UU0A 2EH6A 3A9ZA 3KGXA 1N31A 3LVJA 1SFFA 3AV7A 3BCBA 1ARHA 1O62A 2HUIA 5G4IA 9AATA 2VLFA 4M2JA 1DKAA 2RFVA 3FTBA 4Y0IA 2BHXA 1ELQA 1IUGA 2X5DA 4LNMA 4R8DA 2VMSA 1LC7A 5D95A 2HP2A 1QITA 4GE4A 2D7ZA 3DZZA 2QA3A 3AELA 4WB0B 2FNIA 2QB2A 4ITXA 4U2HA 1PG8A 4ITGA 2CH2A 2VGUA 4DQ6A 1CJ0A 1KKJA 3MEBA 3GSBA 1DJUA 3DR7A 3E9KA 2E7IA 2BIAA 2FN6A 4A0GA 3ASAA 2D63A 5G4JA 3TATA 1C7GA 3KE3A 3QPGA 4F5FA 1SVVA 3JW9A 4A0HA 1G7XA 3K28A 5FT4A 4WB0A 2TPLA 1DGEA 1W23A 5TF5A 4GEBA 3NUBA 5J8QA 1C7NA 1D7SA 2BKWA 3EZ1A 5D5SA 4JEVA 2W7FA 1OHYA 3EI7A 2E7JA 1FC4A 5EFSA 1JS3A 2YKVA 1ASAA 3G8MA 4UHMA 4ZM3A 5K8BA 4GSAA 3AATA 1IX6A 2PB0A 2EO5A 2V0YA 3AOVA 4LNJA 4Q6RA 1QISA 2WK8A 2BI9A 1BJNA 1CZCA 2FNUA 4PFNA
chains in the Genus database with same CATH superfamily
2HIOC 4ADDA 4W1XA 4BA5A 2CV5A 5BNVB 1G4VA 3AZLA 3X1VA 4A6UA 4HF8A 1P3GD 3REIA 3AZNA 3UWCA 4WD2A 3LZ1B 2W7DA 3ELEA 2CV5D 3WKJB 3N7NA 3PDBB 3L44A 4N0WA 1SPAA 3X1VD 1KL1A 5CPJB 5BT1C 3REID 1HTAA 4JJNC 4JF1A 3AZND 1F1EA 3B1DA 4Q75A 3E6GA 1S08A 2VYCA 1YOOA 2W7IA 1YNUA 3LZ1A 1TOKA 4M2KA 3X1SC 3WKJA 3PDBA 3VP6A 1WYVB 4WU8C 5E4ZA 4WU9C 4ZASA 3BV0A 1EG5A 5CHLB 2C7TA 1I29A 1TOGA 5CPJA 1F66D 5B31B 3CQ4A 3LZ1D 3MGQC 3PPLA 2EPJA 5I92A 1KX5B 2BWPA 2W8TA 1WYVA 5CPJD 1VJOA 2DGLA 3K40A 5B31A 2Z1ZA 1KX5A 2HOZA 2HUEC 2AY8A 3UE8A 2JJGA 1HQ3C 3II0A 2AEVA 1KX5D 4G92C 4E77A 3PIUA 3A8UX 2BYMB 1FG3A 3WZFA 4IXOA 2JG2A 5F99B 1AY8A 2E54A 2Z9UA 1X2AA 4BMKA 5M46A 3VK3A 2Y2QA 1P3OC 2BI3A 5AV6B 3WA9C 5BJ3A 1ZLAB 2BYMA 1H1CA 3FQAA 3NQJB 3ZRRA 5F99A 5JA4B 3NUIA 2R2NA 5CPKC 4LC3A 3CBFA 3M5UA 3QGUA 3AV2C 5CP6B 4H9SA 5AV6A 4CVQA 2Y2MA 2O0RA 1ZLAA 5F99D 1IJIA 1P3PC 2AY4A 3A6ND 5DNNC 3NQJA 4JEYA 3NYTA 5JA4A 2YCPA 2FJ7C 3MC6A 4IXZA 4AZJA 3W1JA 1O69A 4JF0A 5AV6D 1ZLAD 1YJSA 2JISA 3AZHB 2VGTA 4K05A 1I41A 3BS8A 5CP6A 1P3BB 3TU4B 1MGVA 3C1BC 1M19B 4K2BA 5DJ1A 1IX8A 3TCMA 5B32C 2GMUA 1EQZB 5CP6D 1AHYA 2RVQD 3AZHA 4JEZA 3B0BA 1WKGA 1ZOBA 2VMTA 3AZFD 3KKIA 1P3BA 1I43A 3TU4A 1YIZA 2YKXA 3ZRPA 3F0HA 1ASLA 1M19A 5B2IB 1GEYA 4H9OB 3LZ0C 1EQZA 3MAFB 1AMQA 4ADCA 3NRAA 1P3BD 4WXBA 3TU4D 4H9PB 4XJOA 3B0DB 4XUJC 1M19D 5DX5A 1AKCA 3DXVA 1DJEA 3I16A 5HDMA 1P3IB 1DTYA 1EQZD 3GETA 1KAFA 5B2IA 1AHEA 5G49B 1P3AB 4H9OA 2AY1A 4WLJA 4AH3A 1UU1A 3A9YA 3MAFA 5HXXA 4WYCA 4G91C 4Z5TC 4DGTA 1C0NA 1SZKA 4H9PA 3AN2B 5B2ID 1ASMA 2KFPA 1P3IA 2X5FA 2BWOA 4PVFA 4ZAHA 5G49A 1P3AA 1OXPA 3WY7A 4ZSWA 1AOID 2OATA 1MAQA 2EGYA 2WK9A 3AN2A 1LC8A 1P3LC 2VMWA 2CJHA 4J8VC 1P3AD 5C3IC 4Y0DA 2BI1A 2HOXA 1B6WA 4ZBJB 2LY8A 1V72A 3AN2D 2WB6A 1ZC9A 1PZRA 1P3FC 2V1PA 1WSTA 2C44A 2AY3A 3W98B 1YJZA 2OKJA 3FZ8A 3W1HA 5AX8A 3CQ5A 3NQUB 1YJYA 3FD0A 1M6SA 4WJ3C 3MGRC 3FQ7A 1C4KA 3P6KA 3HDOA 3W98A 3FRKA 3WGBA 3A1IA 4EO5C 3O62C 3HBXA 1N1JB 3HLMA 3NQUA 2G7JA 4Z66B 4YM6B 2CY8A 3A2BA 3H9XA 5GSUC 3W98D 1TOIA 4LW4A 2D7YA 5F8VA 3RQ1A 3FVXA 5M4BA 5B31G 4YS3C 1N1JA 1AX4A 2YRIA 4E1OA 2OQXA 2O7CA 1AJRA 4Z66A 4YM6A 3DRDA 1B5OA 4KGCD 4WV4B 5EUEA 5AVCB 4HGAB 4NE6A 5KDMA 3GJUA 4WNNB 2W8SA 2AY5A 4Z66D 4YM6D 3UTAB 1ARGA 3R9AA 4H9NB 1W7LA 1U35B 2VMXA 3GWPA 5AY8B 1ID3B 3AV1C 3AEJA 2VGSA 2AY2A 1IX7A 2W8JA 4J8WD 4ZDLA 3MNNC 1TZYC 5AVCA 2PO3A 5AV5C 3LELD 5E5AC 4WNNA 4E45A 1M0NA 2YKYA 1UU0A 3UTAA 3A9ZA 3KGXA 4H9NA 1U35A 1SFFA 5G4IA 5AY8A 1ID3A 2HUIA 9AATA 1R4VA 4Y0IA 5AVCD 2X5DA 4J8UB 3UTAD 3MGRA 3DZZA 2IO5C 3AELA 1U35D 2QB2A 1S32D 5AY8D 1ID3D 1PG8A 5B2JC 1KKJA 3MEBA 4XZQB 2F8NB 3TATA 1C7GA 4F5FA 1KX4C 4J8UA 3K28A 2TPLA 1TAFB 5TF5A 5J8QA 1C7NA 1OHYA 4XZQA 3X1UC 2YKVA 3AFAD 2F8NA 1JS3A 3VH5T 5BS7A 3AATA 4LNJA 4Q6RA 3REKC 4J5UA 3V9RB 4PFNA 5FT5A 5EUNA 3MNNB 1VP4A 4WYGA 4XZQD 1TAFA 5AV8B 4EB7A 4LW2A 4XJPA 3AZGC 4ZUXB 3AEMC 4BHDA 4MKKA 4TN4A 1JFIB 2R5CB 1E5EA 3V9RA 3ELPA 5GT3D 1P3MC 2VMVA 3MNNA 1KX3D 1CS1A 3KWQD 1H0CA 3AEOA 5AV8A 4WBTA 3GZDA 3X1TB 2VIBA 4X23B 4ZUXA 1DFOA 3NU8A 3QN6A 1UKJA 1VEFA 3REJC 3NTJA 3FCRA 4QLCC 1JFIA 2R5CA 4QGRA 2G6WA 5B0YC 5AV8D 1M4NA 1ARTA 4ZUXD 5B33C 2GQNA 4R5ZA 3JTXA 3AYWC 4K2IA 4Y0HA 1AIAA 3X1TA 4KXKA 4X23A 2NQBC 3USFA 4B98A 4M6BA 4XQ2A 2W7KA 4CXQA 3FVUA 1O61A 5C6UA 4NOGA 4UOYA 3X1TD 2DQNC 4BA4A 3B46A 3MVDC 3WTPD 3LVKA 3N5MA 5GT0B 1D7VA 4FL0A 4IY7A 4KUDB 4LD9C 3MADA 1P3KC 4F4EA 1GBNA 4E3QA 2Y2IA 4F5KA 3AZJB 1WYTB 1MAPA 3AZED 3VAXA 2ZP7A 2EYQA 3QM2A 5GT0A 1M18B 1B8GA 4MQQA 4KUDA 2PYOB 3RELB 4A72A 2CJDA 2DGMA 3REJB 3AZJA 1BJOB 4OT8A 1GC0A 1WYTA 5GT0D 2VMYA 4Q31A 4IXSA 2D61A 3IP4C 2G5HC 4KUDD 3LJAC 1LC5A 2ZC0A 3K7YA 1N2TA 1M18A 5AVBB 1FG7A 1CQ7A 3AZJD 2PYOA 3DR4A 3RELA 1G4XA 4Q76A 2YHKA 3UT9C 3PGYA 2CFBA 1A7WA 3REJA 1BJOA 4QLCA 1P34B 2PB2A 3I4JA 3KGWA 3FSLA 2JJHA 4M2MA 2PYOD 3RELD 4O6ZA 3TFUA 5AVBA 1S09A 1AMAA 1GEXA 3B1EA 3AEPA 1ASBA 5B24C 1M1AB 1KMKA 3D6KA 1KL2A 3BCXA 1P34A 4LNLA 3UTBB 3AZLD 5AVBD 5FT8A 2BI5A 3B8XA 5BJ4A 4R8PB 4W1VA 4IX8A 3BWNA 2ZY2A 2NZDC 3P5JB 1X28A 3LWSA 3MGSB 1M1AA 1P34D 3ACZA 2DF4C 1C9CA 5JRGB 2CJGA 3UTBA 2GSAA 2Y2GA 4HVKA 2VQRA 1OATA 2D66A 1AHFA 4R8PA 5M4DA 1M1AD 2W7JA 3TFTA 1TOJA 2Z20A 1AAMA 3WKJD 3MGSA 1LK9A 4R8PD 3BWOA 5JRGA 4J8XB 2C0RA 3A6NC 2HIOB 2VMPA 1V2EA 1BH9B 3NDNA 2AROC 1M0OA 3WKRA 5B1LC 3DC1A 1RV4A 4J8XA 5B31D 4UHNA 2HIOA 2EZ1A 1UU2A 3FZ6A 2BYKB 2RVQC 5F9SA 1BH9A 1IAXA 1RVYA 4JJNB 2YKUA 5B1MC 2F8NG 4J8XD 2BYLA 3AZFC 4TMRA 2HIOD 1ASDA 3X1SB 5DNMC 1AHGA 2JE5A 4WU8B 4WU9B 2BYKA 1PMOA 3G0TA 4JJNA 3NNKA 3VH6T 3MGQB 3UAKA 4AOAA 1TOEA 3JZLA 4ZDPA 1CL1A 8AATA 1AY5A 2VMQA 3X1SA 4WU8A 4WU9A 4Z2MG 4PFFA 3EI5A 2GB3A 3MGQA 4W8IA 3X1SD 4WU8D 4MY5A 4WU9D 2HUEB 4H9QB 4GDYA 1AMRA 5EAVA 2ZM5A 1B9HA 1HQ3B 4A0FA 3MGQD 3E77A 3KSYA 4G92B 3MKJA 2W8VA 3B0CW 1GC3A 3F6TA 4P3MA 3LV2A 4RJ0A 4H9QA 4A0RA 2VMRA 1TARA 2HORA 2FFFB 4RIZA 1HQ3A 3PAAA 3JWAA 4ZDOA 5IWQA 3E2ZB 2HZPA 3EPKA 1ASFA 3H0LC 1P3OB 2Y2LA 2CB1A 3MGPC 1ORDA 3WA9B 1HQ3D 3VK4A 2ZSLA 2VMZA 3AZHD 4FFCA 3NX3A 3WCNA 4KHAB 2HUUA 5CPKB 4JEXA 4WXGA 1GDEA 3E2ZA 4E3RA 3AV2B 1P3OA 2JJEA 1WKHA 1C7OA 3WA9A 1S06A 5BO0B 1W7NA 4UQVA 2W8UA 1P3PB 2FM1A 5DNNB 1ARSA 3P1TA 4KHAA 2FJ7B 2D5YA 5CPKA 3ATHA 3W96C 5BNXB 3WA9D 1N31A 3LVJA 5B40C 3AV2A 1O62A 4H9RB 3B6FC 2RFVA 3FTBA 5BO0A 1P3PA 5CPKD 3C1BB 2HP2A 5DNNA 4RITA 3KXBC 1W2EA 4KGCC 2FJ7A 4WB0B 5B32B 4ITXA 3AV2D 5CPIC 1P3ID 2CH2A 2VGUA 5BNXA 1P3PD 1DJUA 4H9RA 3DR7A 2E7IA 5DNND 2FN6A 4A0GA 3ASAA 2FJ7D 1SVVA 3WAAC 3C1BA 3AZIC 4AWLC 4J8WC 4WB0A 5B32A 3LZ0B 4GEBA 4XUJB 3G8MA 3C1BD 2JSSA 1IX6A 3WTPE 1BJNA 5B32D 1CZCA 2FNUA 5G0AA 1LKCA 3GR9A 3DYDA 3LZ0A 4GRXA 4G91B 4Z5TB 4IW7A 1S32C 2QB3A 3N75A 2W7EA 3VK2A 4XUJA 3KUYC 1ASNA 5G09A 3LZ0D 4GE9A 1W7MA 5KDMB 4XUJD 1AKBA 4Z5TA 1AMSA 1P3LB 4J8VB 3EUCA 1M0PA 3Q8NA 4WYFA 5C3IB 3AFAC 1O4SA 2J8PA 3A9XA 1YIYA 2R0TA 4U1TA 5GXQC 1P3FB 3W97C 2ORDA 3LG0A 1PMMA 1P3LA 4J8VA 2Z1YA 4WYDA 2DOUA 3FDBA 1Y4IA 1SZUA 4F5GA 5GT3C 3MGRB 1P3LD 1P3FA 4J8VD 4XK1A 3AZMC 4F5IA 1BQDA 4EO5B 3O62B 1OHWA 4ZWVA 4XJMA 4XAUA 1P3FD 5GSUB 4EMYA 2C81A 4WZSB 3REHC 2DKBA 2OGAA 1AAWA 4YS3B 3B6GC 1ELUA 2VMOA 3EI8A 3O62A 3RCHB 1S0AA 3MGRD 2BYJA 1BQAA 3EIAA 1QGNA 4OCAA 5GSUA 3NYUA 4DRBA 3AZKC 2Y2KA 1M32A 1AJSB 3I5TA 4KYOA 3O62D 5GXQB 2W7HA 3WTPC 2YRRA 4YS3A 1OXOA 1CQ6A 3COGA 3RCHA 3W1IA 4J8UD 3ZZKA 5GSUD 4AO4A 1P3WA 4NFTA 3AV1B 2ZUKA 2Y2OA 4YS3D 4DBCA 1TZYB 3W99C 1AJSA 2E7UA 5AV5B 2F8ND 5GXQA 5E5AB 2Z9VA 3AZMB 1JF9A 2ZYJA 3AV1A 4OBUA 2BI2A 4J8LA 2EZ2A 2XBNA 1TZYA 4W5KA 3C1CC 4ATQA 5AV5A 2F8JA 2IO5B 5E5AA 5B0ZC 1D7UA 5JAYA 2AEUA 5AV9C 5B2JB 3AZMA 3HVYA 3B6GB 3MNND 2DKJA 1TZYD 5AV5D 1X29A 2VI9A 1KX4B 3FQ8A 4EB5A 1KKPA 1WWSA 3NU7A 1BW0A 1D2FA 5B2JA 1P3GC 3B6GA 4MSOA 3X1UB 2Q7WA 3BC8A 3G7QA 4L0OA 1V2DA 2CV5C 3REKB 3HMUA 5FUGB 3E2YA 1KX4A 3H0RC 4X23D 1OHVA 3AZLC 3X1VC 3WGCA 4B9BA 5B2JD 3AOWA 3REIC 4CXRA 1ASGA 3JWBA 3AZNC 3AZGB 4BQ0A 3X1UA 1KX4D 4R5FA 3REKA 3KFUG 3NYSA 2VGWA 4MKJA 1MDZA 4K2MA 5FUGA 1P3MB 5B32G 3F9TA 2DR1A 2AATA 3X1UD 4ADBA 3VH6A 1F66C 3FVSA 4NE3A 3LZ1C 3REKD 3AZGA 3WKJC 1T3IA 3AEMA 3DXWA 1U08A 2QMAA 4WP0A 4QLCB 4GE7A 5G2PA 1GEWA 3EPHA 5CPJC 5B0YB 1P3MA 4A6TA 5B33B 4ZWMA 3AYWB 1YAAA 1B9IA 4AO9A 4CSRB 2WKAA 2CSTA 2NQBB 5AV9A 1P3MD 3EPLA 3TQXA 1M18D 5B0YA 5B31C 5EQCA 2AY6A 3FKDA 5B33A 5EAAA 1BJWA 1T3UA 3MVDB 1KX5C 1BH8B 3AYWA 1Z3ZA 3REJD 3FFRA 4QLCD 4CSRA 1N8PA 2NQBA 4LD9B 5B0YD 4OYTA 2YCNA 1IAYA 1QIRA 1P3KB 2YOBA 5B33D 1QJ5A 3BCAA 3CQ6A 3AYWD 3PDXA 2NQBD 2VGVA 4H51A 3MVDA 1BH8A 3B1CA 1F66B 4LD9A 1JG8A 1P3KA 1RVUA 1J32A 2BIEA 1ASCA 1ECXA 3MVDD 3FZ7A 5BNVA 1GC2A 2R5EA 4LD9D 3LJAB 2Z9WA 3FFHA 1P3KD 3EPJA 3GZCA 1H3OB 1F66A 3UTBD 4MQRA 5F99C 3EG5B 3UT9B 2AY9A 1LW5A 3A1KA 1G7WA 2OKKA 3MGSD 4E44A 3VH5W 4H9SC 1EJIA 3LJAA 4UUZB 2OGEA 5AV6C 3WLXA 4XEWA 1ZLAC 1H3OA 5JRGD 3OKSA 1XEYA 2ZSMA 5B24B 3MC6C 3OP7A 3UT9A 2CTZA 3R4TA 4RKDA 3LJAD 3DU4A 4NE5A 4CBRA 4A00A 5CP6C 1ARIA 3N4SA 1MLZA 4UUZA 1ARHA 3UT9D 2NZDB 2VLFA 4M2JA 5B24A 1IUGA 4R8DA 4LNMA 2VMSA 2L5AA 2D7ZA 3AZHC 2FNIA 1P3BC 4DQ6A 5B24D 3TU4C 1CJ0A 1M19C 2NZDA 2BIAA 2F8NK 3HT4A 2RIQA 3KE3A 1EQZC 5BT1D 3A6NB 4JJND 1DGEA 1W23A 2NZDD 3NUBA 1D7SA 2BKWA 4H63Q 2E7JA 1FC4A 4ZM3A 5B2IC 2AROB 2Y2JA 2PB0A 2EO5A 2V0YA 1QISA 2BI9A 5B1LB 1CL2A 2Y2PA 3RUYA 1B67A 3A6NA 3B0DC 1MLYA 1AOIC 5E5IA 2BWNA 2QBTA 1P3IC 3LVMA 2XD1A 3T32A 2AROA 5B1MB 1P3AC 3AZFB 5B1LA 2D64A 3EZSA 3H0MC 2GMSA 2CANA 2YFVB 2VMNA 3AN2C 5DNMB 2FYFA 1CZEA 3ZZJA 2AROD 4IYOB 5B1LD 1PFFA 1E5FA 1J04A 5B1MA 3AZFA 4F5LA 1LW4A 4ZLVA 4MQPA 2G5IC 2YFVA 3H7FA 3PA9A 5DNMA 5DJ9A 2F8NH 5B1MD 4IYOA 2HOYA 4ZBJC 4DQYB 4R2NA 2JGTA 5DNMD 1JS6A 4RLGA 3W98C 1X0MA 2QLRA 1P3OD 3WX9A 4WXFA 1AOIB 1BFMA 1S07A 2Y2NA 2W7MA 2CINA 4ADEA 4Z2MH 2JCHA 1EQBA 3E2FA 4P7YA 1AOIA 2ZY3A 2A1VA 3VH5A 1SF2A 4Z66C 4YM6C 2X3LA 4F5MA 3ECDA 2VGZA 2CH1A 3MGPB 4EU1A 1XI9A 3EIBA 2Y2HA 2NMPA 3LY1A 3ISLA 3LELC 2VMUA 2BG1A 2UWXA 1ULYA 1AKAA 2ZJGA 3AEJC 1BJ4A 3MAUA 4PIWA 2BIGA 3MGPA 5AVCC 3LVLB 4HGAC 2AY7A 1TATA 5KTBA 4CAYB 1ASEA 1MDXA 2W7LA 3UTAC 4RAEA 1U35C 5AY8C 1ID3C 3PD6B 1IBJA 3IHJA 3MGPD 3W96B 2CWEA 3AL0C 5B40B 5FT6A 3B6FB 2Z61A 2VLHA 4XJLA 4CAYA 2HP1A 3EI9A 2W7GA 3KXBB 1TASA 4KGCB 4OMAA 4OBVA 5CPIB 3PD6A 4EFFA 3W96A 2HUFA 5B40A 3B6FA 4J8UC 1BT4A 5M49A 4Z5TD 1W3UA 3WAAB 1GC4A 3VH6W 3AZIB 4AWLB 4J8WB 3KXBA 3W96D 5HHYA 1BKGA 4KGCA 5B40D 4XZQC 5CPIA 3B6FD 5BS7C 3LELB 4WYEA 1V2FA 1AICA 1TPLA 3VOMA 3KXBD 1GCKA 4F5HA 3WAAA 5CPID 1AHXA 3AZIA 4J8WA 1KX3C 3KWQC 4W91A 3LELA 1WWIA 1S32B 3QHXA 1Z7DA 3WAAD 3KUYB 4RJYA 3AZID 2VI8A 2WK7A 3L8AA 1Q9CA 3DODA 5E3KA 5AV8C 2FQ6A 3QBOA 4I8AA 3QI6A 4DRAA 3GZDC 4ZUXC 1B4XA 1S32A 3N0LA 1BS0A 1QJ3A 1RV3A 3BB8A 3KUYA 1I48A 1SZSA 3AFAB 3ZRQA 1AIBA 4JEWA 3RI6A 3X1TC 4X23C 1CQ8A 3W97B 3KUYD 1GD9A 3WKSA 1WYUB 4ISYA 5DB5A 3AFAA 1M0QA 2W8WA 3AZEC 1DJ9A 4ZSYA 2VIAA 5EUDA 5GT3B 4UHOA 3AENB 2D65A 1MDOA 3W97A 1KX3B 1DGDA 3KWQB 4RKCA 1WYUA 2F2AC 2XD5A 2ZY5A 2YFWB 3EI6A 1D7RA 2O1BA 5GXQD 3RBFA 3GBXA 7AATA 3W97D 5GT0C 5GT3A 2ZY4A 3AENA 3REHB 4KUDC 1KX3A 1ZODA 4UPKA 5EIGB 3KWQA 3AV1D 4KAMA 2X8UA 3AZJC 1M7YA 4OTLA 2YFWA 3BN1A 2Z9XA 1QZ9A 3HL2A 5E5AD 1M18C 2YCTA 1AY4A 3AZMD 3AZKB 1KMJA 3REHA 4ATPA 3R45B 2PYOC 4A6RA 3RELC 5EIGA 3WTPB 3HQTA 4F5JA 3MBBA 4ZM4A 3REHD 5AVBC 2JJFA 3RBLA 3N4RA 3AZKA 3B6GD 3WCOA 3AZEB 3W99B 3R45A 1IVRA 3WTPA 3FDDA 4W1WA 3CAIA 4WYAA 1P34C 1LS3A 2XH1A 3AZKD 4OC9A 3ASBA 3BWNC 3PJ0A 1B5PA 4WLHA 3AZEA 1Z2CB 4CBSA 3W99A 5G2QA 3C1CB 2FKIA 2EH6A 1M1AC 3AV7A 5B0ZB 3BCBA 2QSRA 1DKAA 5AV9B 2BHXA 1ELQA 3UTBC 4R8PC 3B0CT 1LC7A 5D95A 3W99D 1QITA 4GE4A 2QA3A 3N4XA 4U2HA 3AZGD 4ITGA 3C1CA 3MGSC 5B0ZA 3GSBA 3E9KA 5JRGC 1P3GB 2D63A 5G4JA 3QPGA 3JW9A 4A0HA 1G7XA 3C1CD 2DGKA 5FT4A 2CV5B 1KU5A 5B0ZD 3AZLB 3X1VB 5AV9D 5D5SA 3EZ1A 4JEVA 2W7FA 3EI7A 5EFSA 5K8BA 3REIB 1ASAA 4UHMA 3AZNB 4RM1A 4GSAA 4J8XC 1P3GA 3AOVA 2WK8A 4AZKA
chains in the Genus database with same CATH topology
2HIOC 4ADDA 4W1XA 4BA5A 2CV5A 5BNVB 1G4VA 3AZLA 3X1VA 4A6UA 4HF8A 1P3GD 3REIA 3AZNA 3UWCA 4WD2A 3LZ1B 2W7DA 3ELEA 2CV5D 3WKJB 3N7NA 3PDBB 3L44A 4N0WA 1SPAA 3X1VD 1KL1A 5CPJB 5BT1C 3REID 1HTAA 4JJNC 4JF1A 3AZND 1F1EA 3B1DA 4Q75A 3E6GA 1S08A 2VYCA 1YOOA 2W7IA 1YNUA 3LZ1A 1TOKA 4M2KA 3X1SC 3WKJA 3PDBA 3VP6A 1WYVB 4WU8C 5E4ZA 4WU9C 4ZASA 3BV0A 1EG5A 5CHLB 2C7TA 1I29A 1TOGA 5CPJA 1F66D 5B31B 3CQ4A 3LZ1D 3MGQC 3PPLA 2EPJA 5I92A 1KX5B 2BWPA 2W8TA 1WYVA 5CPJD 1VJOA 2DGLA 3K40A 5B31A 2Z1ZA 1KX5A 2HOZA 2HUEC 2AY8A 3UE8A 2JJGA 1HQ3C 3II0A 2AEVA 1KX5D 4G92C 4E77A 3PIUA 3A8UX 2BYMB 1FG3A 3WZFA 4IXOA 2JG2A 5F99B 1AY8A 2E54A 2Z9UA 1X2AA 4BMKA 5M46A 3VK3A 2Y2QA 1P3OC 2BI3A 5AV6B 3WA9C 5BJ3A 1ZLAB 2BYMA 1H1CA 3FQAA 3NQJB 3ZRRA 5F99A 5JA4B 3NUIA 2R2NA 5CPKC 4LC3A 3CBFA 3M5UA 3QGUA 3AV2C 5CP6B 4H9SA 5AV6A 4CVQA 2Y2MA 2O0RA 1ZLAA 5F99D 1IJIA 1P3PC 2AY4A 3A6ND 5DNNC 3NQJA 4JEYA 3NYTA 5JA4A 2YCPA 2FJ7C 3MC6A 4IXZA 4AZJA 3W1JA 1O69A 4JF0A 5AV6D 1ZLAD 1YJSA 2JISA 3AZHB 2VGTA 4K05A 1I41A 3BS8A 5CP6A 1P3BB 3TU4B 1MGVA 3C1BC 1M19B 4K2BA 5DJ1A 1IX8A 3TCMA 5B32C 2GMUA 1EQZB 5CP6D 1AHYA 2RVQD 3AZHA 4JEZA 3B0BA 1WKGA 1ZOBA 2VMTA 3AZFD 3KKIA 1P3BA 1I43A 3TU4A 1YIZA 2YKXA 3ZRPA 3F0HA 1ASLA 1M19A 5B2IB 1GEYA 4H9OB 3LZ0C 1EQZA 3MAFB 1AMQA 4ADCA 3NRAA 1P3BD 4WXBA 3TU4D 4H9PB 4XJOA 3B0DB 4XUJC 1M19D 5DX5A 1AKCA 3DXVA 1DJEA 3I16A 5HDMA 1P3IB 1DTYA 1EQZD 3GETA 5B2IA 1AHEA 5G49B 1P3AB 4H9OA 2AY1A 4WLJA 4AH3A 1UU1A 3A9YA 3MAFA 5HXXA 4WYCA 4G91C 4Z5TC 4DGTA 1C0NA 1SZKA 4H9PA 3AN2B 5B2ID 1ASMA 2KFPA 1P3IA 2X5FA 2BWOA 4PVFA 4ZAHA 5G49A 1P3AA 1OXPA 3WY7A 4ZSWA 1AOID 2OATA 1MAQA 2EGYA 2WK9A 3AN2A 1LC8A 1P3LC 2VMWA 2CJHA 4J8VC 1P3AD 5C3IC 4Y0DA 2BI1A 2HOXA 1B6WA 4ZBJB 2LY8A 1V72A 3AN2D 2WB6A 1ZC9A 1PZRA 1P3FC 2V1PA 1WSTA 2C44A 2AY3A 3W98B 1YJZA 2OKJA 3FZ8A 3W1HA 5AX8A 3CQ5A 3NQUB 1YJYA 3FD0A 1M6SA 4WJ3C 3MGRC 3FQ7A 1C4KA 3P6KA 3HDOA 3W98A 3FRKA 3WGBA 3A1IA 4EO5C 3O62C 3HBXA 1N1JB 3HLMA 3NQUA 2G7JA 4Z66B 4YM6B 2CY8A 3A2BA 3H9XA 5GSUC 3W98D 1TOIA 4LW4A 2D7YA 5F8VA 3RQ1A 3FVXA 5M4BA 5B31G 4YS3C 1N1JA 1AX4A 2YRIA 4E1OA 2OQXA 2O7CA 1AJRA 4Z66A 4YM6A 3DRDA 1B5OA 4KGCD 4WV4B 5EUEA 5AVCB 4HGAB 4NE6A 5KDMA 3GJUA 4WNNB 2W8SA 2AY5A 4Z66D 4YM6D 3UTAB 1ARGA 3R9AA 4H9NB 1W7LA 1U35B 2VMXA 3GWPA 5AY8B 1ID3B 3AV1C 3AEJA 2VGSA 2AY2A 1IX7A 2W8JA 4J8WD 4ZDLA 3MNNC 1TZYC 5AVCA 2PO3A 5AV5C 3LELD 5E5AC 4WNNA 4E45A 1M0NA 2YKYA 1UU0A 3UTAA 3A9ZA 3KGXA 4H9NA 1U35A 1SFFA 5G4IA 5AY8A 1ID3A 2HUIA 9AATA 1R4VA 4Y0IA 5AVCD 2X5DA 4J8UB 3UTAD 3MGRA 3DZZA 2IO5C 3AELA 1U35D 2QB2A 1S32D 5AY8D 1ID3D 1PG8A 5B2JC 1KKJA 3MEBA 4XZQB 2F8NB 3TATA 1C7GA 4F5FA 1KX4C 4J8UA 3K28A 2TPLA 1TAFB 5TF5A 5J8QA 1C7NA 1OHYA 4XZQA 3X1UC 2YKVA 3AFAD 2F8NA 1JS3A 3VH5T 5BS7A 3AATA 4LNJA 4Q6RA 3REKC 4J5UA 3V9RB 4PFNA 5FT5A 5EUNA 3MNNB 1VP4A 4WYGA 4XZQD 1TAFA 5AV8B 4EB7A 4LW2A 4XJPA 3AZGC 4ZUXB 3AEMC 4BHDA 4MKKA 4TN4A 1JFIB 2R5CB 1E5EA 3V9RA 3ELPA 5GT3D 1P3MC 2VMVA 3MNNA 1KX3D 1CS1A 3KWQD 1H0CA 3AEOA 5AV8A 4WBTA 3GZDA 3X1TB 2VIBA 4X23B 4ZUXA 1DFOA 3NU8A 3QN6A 1UKJA 1VEFA 3REJC 3NTJA 3FCRA 4QLCC 1JFIA 2R5CA 4QGRA 2G6WA 5B0YC 5AV8D 1M4NA 1ARTA 4ZUXD 5B33C 2GQNA 4R5ZA 3JTXA 3AYWC 4K2IA 4Y0HA 1AIAA 3X1TA 4KXKA 4X23A 2NQBC 3USFA 4B98A 4M6BA 4XQ2A 2W7KA 4CXQA 3FVUA 1O61A 5C6UA 4NOGA 4UOYA 3X1TD 2DQNC 4BA4A 3B46A 3MVDC 3WTPD 3LVKA 3N5MA 5GT0B 1D7VA 4FL0A 4IY7A 4KUDB 4LD9C 3MADA 1P3KC 4F4EA 1GBNA 4E3QA 2Y2IA 4F5KA 3AZJB 1WYTB 1MAPA 3AZED 3VAXA 2ZP7A 2EYQA 3QM2A 5GT0A 1M18B 1B8GA 4MQQA 4KUDA 2PYOB 3RELB 4A72A 2CJDA 2DGMA 3REJB 3AZJA 1BJOB 4OT8A 1GC0A 1WYTA 5GT0D 2VMYA 4Q31A 4IXSA 2D61A 3IP4C 2G5HC 4KUDD 3LJAC 1LC5A 2ZC0A 3K7YA 1N2TA 1M18A 5AVBB 1FG7A 1CQ7A 3AZJD 2PYOA 3DR4A 3RELA 1G4XA 4Q76A 2YHKA 3UT9C 3PGYA 2CFBA 1A7WA 3REJA 1BJOA 4QLCA 1P34B 2PB2A 3I4JA 3KGWA 3FSLA 2JJHA 4M2MA 2PYOD 3RELD 4O6ZA 3TFUA 5AVBA 1S09A 1AMAA 1GEXA 3B1EA 3AEPA 1ASBA 5B24C 1M1AB 1KMKA 3D6KA 1KL2A 3BCXA 1P34A 4LNLA 3UTBB 3AZLD 5AVBD 5FT8A 2BI5A 3B8XA 5BJ4A 4R8PB 4W1VA 4IX8A 3BWNA 2ZY2A 2NZDC 3P5JB 1X28A 3LWSA 3MGSB 1M1AA 1P34D 3ACZA 2DF4C 1C9CA 5JRGB 2CJGA 3UTBA 2GSAA 2Y2GA 4HVKA 2VQRA 1OATA 2D66A 1AHFA 4R8PA 5M4DA 1M1AD 2W7JA 3TFTA 1TOJA 2Z20A 1AAMA 3WKJD 3MGSA 1LK9A 4R8PD 3BWOA 5JRGA 4J8XB 2C0RA 3A6NC 2HIOB 2VMPA 1V2EA 1BH9B 3NDNA 2AROC 1M0OA 3WKRA 5B1LC 3DC1A 1RV4A 4J8XA 5B31D 4UHNA 2HIOA 2EZ1A 1UU2A 3FZ6A 2BYKB 2RVQC 5F9SA 1BH9A 1IAXA 1RVYA 4JJNB 2YKUA 5B1MC 2F8NG 4J8XD 2BYLA 3AZFC 4TMRA 2HIOD 1ASDA 3X1SB 5DNMC 1AHGA 2JE5A 4WU8B 4WU9B 2BYKA 1PMOA 3G0TA 4JJNA 3NNKA 3VH6T 3MGQB 3UAKA 4AOAA 1TOEA 3JZLA 4ZDPA 1CL1A 8AATA 1AY5A 2VMQA 3X1SA 4WU8A 4WU9A 4Z2MG 4PFFA 3EI5A 2GB3A 3MGQA 4W8IA 3X1SD 4WU8D 4MY5A 4WU9D 2HUEB 4H9QB 4GDYA 1AMRA 5EAVA 2ZM5A 1B9HA 1HQ3B 4A0FA 3MGQD 3E77A 3KSYA 4G92B 3MKJA 2W8VA 3B0CW 1GC3A 3F6TA 4P3MA 3LV2A 4RJ0A 4H9QA 4A0RA 2VMRA 1TARA 2HORA 2FFFB 4RIZA 1HQ3A 3PAAA 3JWAA 4ZDOA 5IWQA 3E2ZB 2HZPA 3EPKA 1ASFA 3H0LC 1P3OB 2Y2LA 2CB1A 3MGPC 1ORDA 3WA9B 1HQ3D 3VK4A 2ZSLA 2VMZA 3AZHD 4FFCA 3NX3A 3WCNA 4KHAB 2HUUA 5CPKB 4JEXA 4WXGA 1GDEA 3E2ZA 4E3RA 3AV2B 1P3OA 2JJEA 1WKHA 1C7OA 3WA9A 1S06A 5BO0B 1W7NA 4UQVA 2W8UA 1P3PB 2FM1A 5DNNB 1ARSA 3P1TA 4KHAA 2FJ7B 2D5YA 5CPKA 3ATHA 3W96C 5BNXB 3WA9D 1N31A 3LVJA 5B40C 3AV2A 1O62A 4H9RB 3B6FC 2RFVA 3FTBA 5BO0A 1P3PA 5CPKD 3C1BB 2HP2A 5DNNA 4RITA 3KXBC 1W2EA 4KGCC 2FJ7A 4WB0B 5B32B 4ITXA 3AV2D 5CPIC 1P3ID 2CH2A 2VGUA 5BNXA 1P3PD 1DJUA 4H9RA 3DR7A 2E7IA 5DNND 2FN6A 4A0GA 3ASAA 2FJ7D 1SVVA 3WAAC 3C1BA 3AZIC 4AWLC 4J8WC 4WB0A 5B32A 3LZ0B 4GEBA 4XUJB 3G8MA 3C1BD 2JSSA 1IX6A 3WTPE 1BJNA 5B32D 1CZCA 2FNUA 5G0AA 1LKCA 3GR9A 3DYDA 3LZ0A 4GRXA 4G91B 4Z5TB 4IW7A 1S32C 2QB3A 3N75A 2W7EA 3VK2A 4XUJA 3KUYC 1ASNA 5G09A 3LZ0D 4GE9A 1W7MA 5KDMB 4XUJD 1AKBA 4Z5TA 1AMSA 1P3LB 4J8VB 3EUCA 1M0PA 3Q8NA 4WYFA 5C3IB 3AFAC 1O4SA 2J8PA 3A9XA 1YIYA 2R0TA 4U1TA 5GXQC 1P3FB 3W97C 2ORDA 3LG0A 1PMMA 1P3LA 4J8VA 2Z1YA 4WYDA 2DOUA 3FDBA 1Y4IA 1SZUA 4F5GA 5GT3C 3MGRB 1P3LD 1P3FA 4J8VD 4XK1A 3AZMC 4F5IA 1BQDA 4EO5B 3O62B 1OHWA 4ZWVA 4XJMA 4XAUA 1P3FD 5GSUB 4EMYA 2C81A 4WZSB 3REHC 2DKBA 2OGAA 1AAWA 4YS3B 3B6GC 1ELUA 2VMOA 3EI8A 3O62A 3RCHB 1S0AA 3MGRD 2BYJA 1BQAA 3EIAA 1QGNA 4OCAA 5GSUA 3NYUA 4DRBA 3AZKC 2Y2KA 1M32A 1AJSB 3I5TA 4KYOA 3O62D 5GXQB 2W7HA 3WTPC 2YRRA 4YS3A 1OXOA 1CQ6A 3COGA 3RCHA 3W1IA 4J8UD 3ZZKA 5GSUD 4AO4A 1P3WA 4NFTA 3AV1B 2ZUKA 2Y2OA 4YS3D 4DBCA 1TZYB 3W99C 1AJSA 2E7UA 5AV5B 2F8ND 5GXQA 5E5AB 2Z9VA 3AZMB 1JF9A 2ZYJA 3AV1A 4OBUA 2BI2A 4J8LA 2EZ2A 2XBNA 1TZYA 4W5KA 3C1CC 4ATQA 5AV5A 2F8JA 2IO5B 5E5AA 5B0ZC 1D7UA 5JAYA 2AEUA 5AV9C 5B2JB 3AZMA 3HVYA 3B6GB 3MNND 2DKJA 1TZYD 5AV5D 1X29A 2VI9A 1KX4B 3FQ8A 4EB5A 1KKPA 1WWSA 3NU7A 1BW0A 1D2FA 5B2JA 1P3GC 3B6GA 4MSOA 3X1UB 2Q7WA 3BC8A 3G7QA 4L0OA 1V2DA 2CV5C 3REKB 3HMUA 5FUGB 3E2YA 1KX4A 3H0RC 4X23D 1OHVA 3AZLC 3X1VC 3WGCA 4B9BA 5B2JD 3AOWA 3REIC 4CXRA 1ASGA 3JWBA 3AZNC 3AZGB 4BQ0A 3X1UA 1KX4D 4R5FA 3REKA 3KFUG 3NYSA 2VGWA 4MKJA 1MDZA 4K2MA 5FUGA 1P3MB 5B32G 3F9TA 2DR1A 2AATA 3X1UD 4ADBA 3VH6A 1F66C 3FVSA 4NE3A 3LZ1C 3REKD 3AZGA 3WKJC 1T3IA 3AEMA 3DXWA 1U08A 2QMAA 4WP0A 4QLCB 4GE7A 5G2PA 1GEWA 3EPHA 5CPJC 5B0YB 1P3MA 4A6TA 5B33B 4ZWMA 3AYWB 1YAAA 1B9IA 4AO9A 4CSRB 2WKAA 2CSTA 2NQBB 5AV9A 1P3MD 3EPLA 3TQXA 1M18D 5B0YA 5B31C 5EQCA 2AY6A 3FKDA 5B33A 5EAAA 1BJWA 1T3UA 3MVDB 1KX5C 1BH8B 3AYWA 1Z3ZA 3REJD 3FFRA 4QLCD 4CSRA 1N8PA 2NQBA 4LD9B 5B0YD 4OYTA 2YCNA 1IAYA 1QIRA 1P3KB 2YOBA 5B33D 1QJ5A 3BCAA 3CQ6A 3AYWD 3PDXA 2NQBD 2VGVA 4H51A 3MVDA 1BH8A 3B1CA 1F66B 4LD9A 1JG8A 1P3KA 1RVUA 1J32A 2BIEA 1ASCA 1ECXA 3MVDD 3FZ7A 5BNVA 1GC2A 2R5EA 4LD9D 3LJAB 2Z9WA 3FFHA 1P3KD 3EPJA 3GZCA 1H3OB 1F66A 3UTBD 4MQRA 5F99C 3EG5B 3UT9B 2AY9A 1LW5A 3A1KA 1G7WA 2OKKA 3MGSD 4E44A 3VH5W 4H9SC 1EJIA 3LJAA 4UUZB 2OGEA 5AV6C 3WLXA 4XEWA 1ZLAC 1H3OA 5JRGD 3OKSA 1XEYA 2ZSMA 5B24B 3MC6C 3OP7A 3UT9A 2CTZA 3R4TA 4RKDA 3LJAD 3DU4A 4NE5A 4CBRA 4A00A 5CP6C 1ARIA 3N4SA 1MLZA 4UUZA 1ARHA 3UT9D 2NZDB 2VLFA 4M2JA 5B24A 1IUGA 4R8DA 4LNMA 2VMSA 2L5AA 2D7ZA 3AZHC 2FNIA 1P3BC 4DQ6A 5B24D 3TU4C 1CJ0A 1M19C 2NZDA 2BIAA 2F8NK 3HT4A 2RIQA 3KE3A 1EQZC 5BT1D 3A6NB 4JJND 1DGEA 1W23A 2NZDD 3NUBA 1D7SA 2BKWA 4H63Q 2E7JA 1FC4A 4ZM3A 5B2IC 2AROB 2Y2JA 2PB0A 2EO5A 2V0YA 1QISA 2BI9A 5B1LB 1CL2A 2Y2PA 3RUYA 1B67A 3A6NA 3B0DC 1MLYA 1AOIC 5E5IA 2BWNA 2QBTA 1P3IC 3LVMA 2XD1A 3T32A 2AROA 5B1MB 1P3AC 3AZFB 5B1LA 2D64A 3EZSA 3H0MC 2GMSA 2CANA 2YFVB 2VMNA 3AN2C 5DNMB 2FYFA 1CZEA 3ZZJA 2AROD 4IYOB 5B1LD 1PFFA 1E5FA 1J04A 5B1MA 3AZFA 4F5LA 1LW4A 4ZLVA 4MQPA 2G5IC 2YFVA 3H7FA 3PA9A 5DNMA 5DJ9A 2F8NH 5B1MD 4IYOA 2HOYA 4ZBJC 4DQYB 4R2NA 2JGTA 5DNMD 1JS6A 4RLGA 3W98C 1X0MA 2QLRA 1P3OD 3WX9A 4WXFA 1AOIB 1BFMA 1S07A 2Y2NA 2W7MA 2CINA 4ADEA 4Z2MH 2JCHA 1EQBA 3E2FA 4P7YA 1AOIA 2ZY3A 2A1VA 3VH5A 1SF2A 4Z66C 4YM6C 2X3LA 4F5MA 3ECDA 2VGZA 2CH1A 3MGPB 4EU1A 1XI9A 3EIBA 2Y2HA 2NMPA 3LY1A 3ISLA 3LELC 2VMUA 2BG1A 2UWXA 1ULYA 1AKAA 2ZJGA 3AEJC 1BJ4A 3MAUA 4PIWA 2BIGA 3MGPA 5AVCC 3LVLB 4HGAC 2AY7A 1TATA 5KTBA 4CAYB 1ASEA 1MDXA 2W7LA 3UTAC 4RAEA 1U35C 5AY8C 1ID3C 3PD6B 1IBJA 3IHJA 3MGPD 3W96B 2CWEA 3AL0C 5B40B 5FT6A 3B6FB 2Z61A 2VLHA 4XJLA 4CAYA 2HP1A 3EI9A 2W7GA 3KXBB 1TASA 4KGCB 4OMAA 4OBVA 5CPIB 3PD6A 4EFFA 3W96A 2HUFA 5B40A 3B6FA 4J8UC 1BT4A 5M49A 4Z5TD 1W3UA 3WAAB 1GC4A 3VH6W 3AZIB 4AWLB 4J8WB 3KXBA 3W96D 5HHYA 1BKGA 4KGCA 5B40D 4XZQC 5CPIA 3B6FD 5BS7C 3LELB 4WYEA 1V2FA 1AICA 1TPLA 3VOMA 3KXBD 1GCKA 4F5HA 3WAAA 5CPID 1AHXA 3AZIA 4J8WA 1KX3C 3KWQC 4W91A 3LELA 1WWIA 1S32B 3QHXA 1Z7DA 3WAAD 3KUYB 4RJYA 3AZID 2VI8A 2WK7A 3L8AA 1Q9CA 3DODA 5E3KA 5AV8C 2FQ6A 3QBOA 4I8AA 3QI6A 4DRAA 3GZDC 4ZUXC 1B4XA 1S32A 3N0LA 1BS0A 1QJ3A 1RV3A 3BB8A 3KUYA 1I48A 1SZSA 3AFAB 3ZRQA 1AIBA 4JEWA 3RI6A 3X1TC 4X23C 1CQ8A 3W97B 3KUYD 1GD9A 3WKSA 1WYUB 4ISYA 5DB5A 3AFAA 1M0QA 2W8WA 3AZEC 1DJ9A 4ZSYA 2VIAA 5EUDA 5GT3B 4UHOA 3AENB 2D65A 1MDOA 3W97A 1KX3B 1DGDA 3KWQB 4RKCA 1WYUA 2F2AC 2XD5A 2ZY5A 2YFWB 3EI6A 1D7RA 2O1BA 5GXQD 3RBFA 3GBXA 7AATA 3W97D 5GT0C 5GT3A 2ZY4A 3AENA 3REHB 4KUDC 1KX3A 1ZODA 4UPKA 5EIGB 3KWQA 3AV1D 4KAMA 2X8UA 3AZJC 1M7YA 4OTLA 2YFWA 3BN1A 2Z9XA 1QZ9A 3HL2A 5E5AD 1M18C 2YCTA 1AY4A 3AZMD 3AZKB 1KMJA 3REHA 4ATPA 3R45B 2PYOC 4A6RA 3RELC 5EIGA 3WTPB 3HQTA 4F5JA 3MBBA 4ZM4A 3REHD 5AVBC 2JJFA 3RBLA 3N4RA 3AZKA 3B6GD 3WCOA 3AZEB 3W99B 3R45A 1IVRA 3WTPA 3FDDA 4W1WA 3CAIA 4WYAA 1P34C 1LS3A 2XH1A 3AZKD 4OC9A 3ASBA 3BWNC 3PJ0A 1B5PA 4WLHA 3AZEA 1Z2CB 4CBSA 3W99A 5G2QA 3C1CB 2FKIA 2EH6A 1M1AC 3AV7A 5B0ZB 3BCBA 2QSRA 1DKAA 5AV9B 2BHXA 1ELQA 3UTBC 4R8PC 3B0CT 1LC7A 5D95A 3W99D 1QITA 4GE4A 2QA3A 3N4XA 4U2HA 3AZGD 4ITGA 3C1CA 3MGSC 5B0ZA 3GSBA 3E9KA 5JRGC 1P3GB 2D63A 5G4JA 3QPGA 3JW9A 4A0HA 1G7XA 3C1CD 2DGKA 5FT4A 2CV5B 1KU5A 5B0ZD 3AZLB 3X1VB 5AV9D 5D5SA 3EZ1A 4JEVA 2W7FA 3EI7A 5EFSA 5K8BA 3REIB 1ASAA 4UHMA 3AZNB 4RM1A 4GSAA 4J8XC 1P3GA 3AOVA 2WK8A 4AZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CL2 A;  5EUN A;  4ADD A;  1LKC A;  4W1X A;  3GR9 A;  4BA5 A;  3RUY A;  1VP4 A;  3DYD A;  4WYG A;  1MLY A;  1G4V A;  4GRX A;  4EB7 A;  4IW7 A;  2BWN A;  4LW2 A;  5E5I A;  2QBT A;  4A6U A;  4HF8 A;  4XJP A;  2QB3 A;  3N75 A;  3LVM A;  2W7E A;  3VK2 A;  3AEM C;  4BHD A;  4MKK A;  4TN4 A;  1ASN A;  3T32 A;  3UWC A;  4WD2 A;  5G09 A;  2W7D A;  3ELE A;  5G0A A;  2R5C B;  1E5E A;  3L44 A;  3PDB B;  2D64 A;  3ELP A;  3EZS A;  4N0W A;  1SPA A;  2VMV A;  2GMS A;  2CAN A;  1KL1 A;  2VMN A;  1CS1 A;  4GE9 A;  1W7M A;  1H0C A;  1AKB A;  3AEO A;  2FYF A;  1CZE A;  4JF1 A;  1AMS A;  3ZZJ A;  3B1D A;  4Q75 A;  4WBT A;  3GZD A;  2VIB A;  4IYO B;  3E6G A;  1S08 A;  2VYC A;  1DFO A;  1PFF A;  1YOO A;  3EUC A;  3NU8 A;  3QN6 A;  1E5F A;  1J04 A;  2W7I A;  1M0P A;  1UKJ A;  1VEF A;  3Q8N A;  1YNU A;  4WYF A;  3NTJ A;  3FCR A;  1TOK A;  2R5C A;  4M2K A;  4QGR A;  3PDB A;  1LW4 A;  4ZLV A;  2G6W A;  4F5L A;  1WYV B;  4MQP A;  1O4S A;  1M4N A;  5E4Z A;  3A9X A;  1YIY A;  2R0T A;  3BV0 A;  4ZAS A;  1ART A;  1EG5 A;  3H7F A;  3PA9 A;  4U1T A;  2C7T A;  1I29 A;  1TOG A;  2GQN A;  4R5Z A;  3JTX A;  5DJ9 A;  4K2I A;  4Y0H A;  3CQ4 A;  1AIA A;  3PPL A;  2ORD A;  3LG0 A;  4IYO A;  2HOY A;  2EPJ A;  4KXK A;  5I92 A;  3USF A;  2Z1Y A;  4WYD A;  4B98 A;  2BWP A;  2DOU A;  3FDB A;  2W8T A;  4R2N A;  2JGT A;  1Y4I A;  1SZU A;  4XQ2 A;  1WYV A;  2W7K A;  3FVU A;  1O61 A;  4F5G A;  4CXQ A;  1JS6 A;  1VJO A;  5C6U A;  4NOG A;  4UOY A;  3K40 A;  1X0M A;  2QLR A;  4BA4 A;  3B46 A;  4XK1 A;  3LVK A;  3N5M A;  3WX9 A;  4WXF A;  1D7V A;  2Z1Z A;  4FL0 A;  4IY7 A;  4F5I A;  1BQD A;  3MAD A;  1OHW A;  1S07 A;  2HOZ A;  1GBN A;  4E3Q A;  4F4E A;  4F5K A;  4ZWV A;  4XJM A;  4XAU A;  2AY8 A;  3UE8 A;  2W7M A;  1WYT B;  2JJG A;  2CIN A;  1MAP A;  4ADE A;  3VAX A;  4EMY A;  2C81 A;  1EQB A;  2ZP7 A;  3II0 A;  2DKB A;  3E2F A;  3QM2 A;  2OGA A;  1AAW A;  1B8G A;  4P7Y A;  4E77 A;  2ZY3 A;  4MQQ A;  1ELU A;  2VMO A;  3EI8 A;  1SF2 A;  3PIU A;  4F5M A;  3A8U X;  3RCH B;  4A72 A;  1S0A A;  1FG3 A;  3ECD A;  2BYJ A;  2CJD A;  1BQA A;  2CH1 A;  2VGZ A;  3WZF A;  1BJO B;  3EIA A;  4OT8 A;  4IXO A;  1GC0 A;  1QGN A;  1WYT A;  4EU1 A;  4OCA A;  2JG2 A;  1AY8 A;  1XI9 A;  2VMY A;  4IXS A;  4Q31 A;  3EIB A;  2E54 A;  2NMP A;  2D61 A;  2Z9U A;  1X2A A;  3LY1 A;  3NYU A;  4BMK A;  1M32 A;  1AJS B;  3I5T A;  5M46 A;  1LC5 A;  2ZC0 A;  4KYO A;  3K7Y A;  3VK3 A;  1N2T A;  3ISL A;  1FG7 A;  2W7H A;  2VMU A;  2YRR A;  1AKA A;  1CQ7 A;  2ZJG A;  1OXO A;  1CQ6 A;  3AEJ C;  3COG A;  2BI3 A;  1BJ4 A;  3DR4 A;  5BJ3 A;  3RCH A;  1G4X A;  3MAU A;  3ZZK A;  4Q76 A;  4AO4 A;  2YHK A;  2BIG A;  4PIW A;  1H1C A;  3PGY A;  2CFB A;  1P3W A;  1BJO A;  2ZUK A;  3FQA A;  3LVL B;  2AY7 A;  1TAT A;  3ZRR A;  3NUI A;  2PB2 A;  2R2N A;  3I4J A;  3KGW A;  4DBC A;  1ASE A;  1MDX A;  2JJH A;  1AJS A;  3FSL A;  4M2M A;  2E7U A;  4LC3 A;  3CBF A;  2W7L A;  3M5U A;  3QGU A;  4O6Z A;  3TFU A;  4RAE A;  1S09 A;  1AMA A;  1GEX A;  3B1E A;  3PD6 B;  1IBJ A;  3IHJ A;  2Z9V A;  3AEP A;  1ASB A;  1KMK A;  2O0R A;  4CVQ A;  3D6K A;  1IJI A;  5FT6 A;  2AY4 A;  1KL2 A;  1JF9 A;  2ZYJ A;  3BCX A;  4JEY A;  2BI2 A;  3NYT A;  2Z61 A;  4LNL A;  2YCP A;  3MC6 A;  4IXZ A;  5FT8 A;  2BI5 A;  2VLH A;  3B8X A;  4XJL A;  5BJ4 A;  2EZ2 A;  4AZJ A;  2HP1 A;  2XBN A;  4W5K A;  1O69 A;  3EI9 A;  2W7G A;  4W1V A;  4ATQ A;  4JF0 A;  1TAS A;  2F8J A;  4IX8 A;  1YJS A;  2VGT A;  3BWN A;  2ZY2 A;  4OMA A;  1D7U A;  5JAY A;  1I41 A;  3BS8 A;  3PD6 A;  4EFF A;  1X28 A;  3LWS A;  2HUF A;  1MGV A;  3ACZ A;  4K2B A;  2DKJ A;  5DJ1 A;  1BT4 A;  1C9C A;  1IX8 A;  5M49 A;  2CJG A;  3TCM A;  1X29 A;  2GSA A;  1W3U A;  2GMU A;  4HVK A;  2VI9 A;  1OAT A;  2D66 A;  1AHF A;  3FQ8 A;  1GC4 A;  4EB5 A;  1AHY A;  1KKP A;  5M4D A;  3NU7 A;  1BW0 A;  5HHY A;  1BKG A;  2W7J A;  3TFT A;  1D2F A;  1TOJ A;  4JEZ A;  1WKG A;  1ZOB A;  1AAM A;  2VMT A;  2Z20 A;  3KKI A;  1LK9 A;  4WYE A;  1I43 A;  1YIZ A;  1V2F A;  2YKX A;  4MSO A;  2Q7W A;  3BC8 A;  1AIC A;  3F0H A;  3ZRP A;  1ASL A;  1TPL A;  3G7Q A;  3BWO A;  1GEY A;  3VOM A;  4L0O A;  2C0R A;  1V2D A;  3HMU A;  1GCK A;  3MAF B;  1AMQ A;  3E2Y A;  4F5H A;  1OHV A;  4ADC A;  3NRA A;  1AHX A;  3WGC A;  4B9B A;  4WXB A;  4XJO A;  2VMP A;  1V2E A;  3AOW A;  4CXR A;  1ASG A;  3NDN A;  3JWB A;  4W91 A;  5DX5 A;  1AKC A;  3DXV A;  1M0O A;  1DJE A;  3WKR A;  5HDM A;  3QHX A;  4BQ0 A;  1DTY A;  1Z7D A;  3GET A;  3DC1 A;  1AHE A;  1RV4 A;  4RJY A;  2AY1 A;  5FT5 A;  4R5F A;  2VI8 A;  2WK7 A;  3L8A A;  4UHN A;  4WLJ A;  3NYS A;  4AH3 A;  2VGW A;  1UU1 A;  3A9Y A;  1MDZ A;  3DOD A;  3MAF A;  4K2M A;  4MKJ A;  2EZ1 A;  2FQ6 A;  4WYC A;  5E3K A;  5HXX A;  1UU2 A;  3QBO A;  4I8A A;  3QI6 A;  4DGT A;  1C0N A;  1SZK A;  3F9T A;  3GZD C;  2DR1 A;  2AAT A;  5F9S A;  4ADB A;  1IAX A;  1RVY A;  3FVS A;  2YKU A;  1B4X A;  1ASM A;  2BYL A;  3N0L A;  2X5F A;  2BWO A;  1BS0 A;  1QJ3 A;  1RV3 A;  1T3I A;  3AEM A;  3DXW A;  1U08 A;  4PVF A;  3BB8 A;  4TMR A;  4ZAH A;  2QMA A;  4WP0 A;  1ASD A;  1I48 A;  1SZS A;  3ZRQ A;  1OXP A;  4GE7 A;  5G2P A;  1GEW A;  3WY7 A;  4ZSW A;  1AIB A;  1AHG A;  4JEW A;  2OAT A;  1MAQ A;  4A6T A;  2EGY A;  2WK9 A;  3RI6 A;  1LC8 A;  2VMW A;  2CJH A;  4ZWM A;  1CQ8 A;  3NNK A;  1GD9 A;  1B9I A;  1YAA A;  3WKS A;  4AO9 A;  4AZK A;  4Y0D A;  2BI1 A;  2WKA A;  3UAK A;  4AOA A;  1WYU B;  2CST A;  1TOE A;  4ISY A;  2HOX A;  4ZDP A;  1CL1 A;  8AAT A;  1AY5 A;  5DB5 A;  2VMQ A;  1V72 A;  3TQX A;  1ZC9 A;  2V1P A;  1WST A;  1M0Q A;  2C44 A;  2W8W A;  2AY3 A;  4J5U A;  5EQC A;  1DJ9 A;  4ZSY A;  2VIA A;  1YJZ A;  2AY6 A;  5EUD A;  3FKD A;  4UHO A;  5EAA A;  1BJW A;  2D65 A;  3AEN B;  1MDO A;  4PFF A;  1DGD A;  1Z3Z A;  3EI5 A;  3FFR A;  2GB3 A;  5AX8 A;  3CQ5 A;  1N8P A;  4RKC A;  1WYU A;  4W8I A;  2ZY5 A;  4OYT A;  1YJY A;  2YCN A;  1IAY A;  1M6S A;  1QIR A;  4MY5 A;  3EI6 A;  1D7R A;  2O1B A;  2YOB A;  3FQ7 A;  1C4K A;  1AMR A;  1QJ5 A;  3BCA A;  3GBX A;  3CQ6 A;  3P6K A;  4GDY A;  3RBF A;  7AAT A;  5EAV A;  3PDX A;  1B9H A;  3HDO A;  4A0F A;  2VGV A;  2ZY4 A;  3AEN A;  3FRK A;  3E77 A;  4H51 A;  3WGB A;  1ZOD A;  3MKJ A;  3B1C A;  3HLM A;  5EIG B;  2W8V A;  4KAM A;  2X8U A;  1JG8 A;  1GC3 A;  1M7Y A;  2CY8 A;  3F6T A;  4OTL A;  3A2B A;  4P3M A;  3BN1 A;  2Z9X A;  1RVU A;  1J32 A;  1QZ9 A;  2BIE A;  3LV2 A;  1TOI A;  1ASC A;  1ECX A;  4A0R A;  4LW4 A;  3HL2 A;  2VMR A;  1TAR A;  2D7Y A;  2HOR A;  5F8V A;  3RQ1 A;  2YCT A;  3FVX A;  1AY4 A;  3PAA A;  5M4B A;  1GC2 A;  2R5E A;  3JWA A;  1KMJ A;  4ZDO A;  4ATP A;  5IWQ A;  2Z9W A;  4A6R A;  3FFH A;  5EIG A;  3E2Z B;  3GZC A;  2HZP A;  1ASF A;  1AX4 A;  2YRI A;  3HQT A;  4E1O A;  2CB1 A;  2O7C A;  2OQX A;  1AJR A;  4MQR A;  1ORD A;  4F5J A;  3DRD A;  3MBB A;  3VK4 A;  1B5O A;  2ZSL A;  4ZM4 A;  2AY9 A;  2VMZ A;  4FFC A;  1LW5 A;  5EUE A;  3NX3 A;  1G7W A;  2HUU A;  3GJU A;  2JJF A;  3RBL A;  2AY5 A;  4JEX A;  1EJI A;  4WXG A;  1GDE A;  3WLX A;  2OGE A;  1ARG A;  4XEW A;  1IVR A;  3R9A A;  3E2Z A;  1W7L A;  3OKS A;  2VMX A;  4E3R A;  3FDD A;  4W1W A;  3AEJ A;  2AY2 A;  2JJE A;  2VGS A;  1WKH A;  1C7O A;  1IX7 A;  2ZSM A;  3CAI A;  1LS3 A;  1S06 A;  4WYA A;  1W7N A;  2XH1 A;  3MC6 C;  4UQV A;  2W8U A;  2W8J A;  3OP7 A;  2FM1 A;  4ZDL A;  2CTZ A;  3R4T A;  4RKD A;  2PO3 A;  1ARS A;  3DU4 A;  3P1T A;  4OC9 A;  3ASB A;  3BWN C;  2D5Y A;  4CBR A;  3PJ0 A;  4A00 A;  1B5P A;  3ATH A;  4WLH A;  1ARI A;  4CBS A;  1M0N A;  5G2Q A;  1MLZ A;  2YKY A;  1UU0 A;  2EH6 A;  3A9Z A;  3KGX A;  1N31 A;  3LVJ A;  1SFF A;  3AV7 A;  3BCB A;  1ARH A;  1O62 A;  2HUI A;  5G4I A;  9AAT A;  2VLF A;  4M2J A;  1DKA A;  2RFV A;  3FTB A;  4Y0I A;  2BHX A;  1ELQ A;  1IUG A;  2X5D A;  4LNM A;  4R8D A;  2VMS A;  1LC7 A;  5D95 A;  2HP2 A;  1QIT A;  4GE4 A;  2D7Z A;  3DZZ A;  2QA3 A;  3AEL A;  4WB0 B;  2FNI A;  2QB2 A;  4ITX A;  4U2H A;  1PG8 A;  4ITG A;  2CH2 A;  2VGU A;  4DQ6 A;  1CJ0 A;  1KKJ A;  3MEB A;  3GSB A;  1DJU A;  3DR7 A;  3E9K A;  2E7I A;  2BIA A;  2FN6 A;  4A0G A;  3ASA A;  2D63 A;  5G4J A;  3TAT A;  1C7G A;  3KE3 A;  3QPG A;  4F5F A;  1SVV A;  3JW9 A;  4A0H A;  1G7X A;  3K28 A;  5FT4 A;  4WB0 A;  2TPL A;  1DGE A;  1W23 A;  5TF5 A;  4GEB A;  3NUB A;  5J8Q A;  1C7N A;  1D7S A;  2BKW A;  3EZ1 A;  5D5S A;  4JEV A;  2W7F A;  1OHY A;  3EI7 A;  2E7J A;  1FC4 A;  5EFS A;  1JS3 A;  2YKV A;  1ASA A;  3G8M A;  4UHM A;  4ZM3 A;  5K8B A;  4GSA A;  3AAT A;  1IX6 A;  2PB0 A;  2EO5 A;  2V0Y A;  3AOV A;  4LNJ A;  4Q6R A;  1QIS A;  2WK8 A;  2BI9 A;  1BJN A;  1CZC A;  2FNU A;  4PFN A; 
#chains in the Genus database with same CATH topology
 2HIO C;  4ADD A;  4W1X A;  4BA5 A;  2CV5 A;  5BNV B;  1G4V A;  3AZL A;  3X1V A;  4A6U A;  4HF8 A;  1P3G D;  3REI A;  3AZN A;  3UWC A;  4WD2 A;  3LZ1 B;  2W7D A;  3ELE A;  2CV5 D;  3WKJ B;  3N7N A;  3PDB B;  3L44 A;  4N0W A;  1SPA A;  3X1V D;  1KL1 A;  5CPJ B;  5BT1 C;  3REI D;  1HTA A;  4JJN C;  4JF1 A;  3AZN D;  1F1E A;  3B1D A;  4Q75 A;  3E6G A;  1S08 A;  2VYC A;  1YOO A;  2W7I A;  1YNU A;  3LZ1 A;  1TOK A;  4M2K A;  3X1S C;  3WKJ A;  3PDB A;  3VP6 A;  1WYV B;  4WU8 C;  5E4Z A;  4WU9 C;  4ZAS A;  3BV0 A;  1EG5 A;  5CHL B;  2C7T A;  1I29 A;  1TOG A;  5CPJ A;  1F66 D;  5B31 B;  3CQ4 A;  3LZ1 D;  3MGQ C;  3PPL A;  2EPJ A;  5I92 A;  1KX5 B;  2BWP A;  2W8T A;  1WYV A;  5CPJ D;  1VJO A;  2DGL A;  3K40 A;  5B31 A;  2Z1Z A;  1KX5 A;  2HOZ A;  2HUE C;  2AY8 A;  3UE8 A;  2JJG A;  1HQ3 C;  3II0 A;  2AEV A;  1KX5 D;  4G92 C;  4E77 A;  3PIU A;  3A8U X;  2BYM B;  1FG3 A;  3WZF A;  4IXO A;  2JG2 A;  5F99 B;  1AY8 A;  2E54 A;  2Z9U A;  1X2A A;  4BMK A;  5M46 A;  3VK3 A;  2Y2Q A;  1P3O C;  2BI3 A;  5AV6 B;  3WA9 C;  5BJ3 A;  1ZLA B;  2BYM A;  1H1C A;  3FQA A;  3NQJ B;  3ZRR A;  5F99 A;  5JA4 B;  3NUI A;  2R2N A;  5CPK C;  4LC3 A;  3CBF A;  3M5U A;  3QGU A;  3AV2 C;  5CP6 B;  4H9S A;  5AV6 A;  4CVQ A;  2Y2M A;  2O0R A;  1ZLA A;  5F99 D;  1IJI A;  1P3P C;  2AY4 A;  3A6N D;  5DNN C;  3NQJ A;  4JEY A;  3NYT A;  5JA4 A;  2YCP A;  2FJ7 C;  3MC6 A;  4IXZ A;  4AZJ A;  3W1J A;  1O69 A;  4JF0 A;  5AV6 D;  1ZLA D;  1YJS A;  2JIS A;  3AZH B;  2VGT A;  4K05 A;  1I41 A;  3BS8 A;  5CP6 A;  1P3B B;  3TU4 B;  1MGV A;  3C1B C;  1M19 B;  4K2B A;  5DJ1 A;  1IX8 A;  3TCM A;  5B32 C;  2GMU A;  1EQZ B;  5CP6 D;  1AHY A;  2RVQ D;  3AZH A;  4JEZ A;  3B0B A;  1WKG A;  1ZOB A;  2VMT A;  3AZF D;  3KKI A;  1P3B A;  1I43 A;  3TU4 A;  1YIZ A;  2YKX A;  3ZRP A;  3F0H A;  1ASL A;  1M19 A;  5B2I B;  1GEY A;  4H9O B;  3LZ0 C;  1EQZ A;  3MAF B;  1AMQ A;  4ADC A;  3NRA A;  1P3B D;  4WXB A;  3TU4 D;  4H9P B;  4XJO A;  3B0D B;  4XUJ C;  1M19 D;  5DX5 A;  1AKC A;  3DXV A;  1DJE A;  3I16 A;  5HDM A;  1P3I B;  1DTY A;  1EQZ D;  3GET A;  1KAF A;  5B2I A;  1AHE A;  5G49 B;  1P3A B;  4H9O A;  2AY1 A;  4WLJ A;  4AH3 A;  1UU1 A;  3A9Y A;  3MAF A;  5HXX A;  4WYC A;  4G91 C;  4Z5T C;  4DGT A;  1C0N A;  1SZK A;  4H9P A;  3AN2 B;  5B2I D;  1ASM A;  2KFP A;  1P3I A;  2X5F A;  2BWO A;  4PVF A;  4ZAH A;  5G49 A;  1P3A A;  1OXP A;  3WY7 A;  4ZSW A;  1AOI D;  2OAT A;  1MAQ A;  2EGY A;  2WK9 A;  3AN2 A;  1LC8 A;  1P3L C;  2VMW A;  2CJH A;  4J8V C;  1P3A D;  5C3I C;  4Y0D A;  2BI1 A;  2HOX A;  1B6W A;  4ZBJ B;  2LY8 A;  1V72 A;  3AN2 D;  2WB6 A;  1ZC9 A;  1PZR A;  1P3F C;  2V1P A;  1WST A;  2C44 A;  2AY3 A;  3W98 B;  1YJZ A;  2OKJ A;  3FZ8 A;  3W1H A;  5AX8 A;  3CQ5 A;  3NQU B;  1YJY A;  3FD0 A;  1M6S A;  4WJ3 C;  3MGR C;  3FQ7 A;  1C4K A;  3P6K A;  3HDO A;  3W98 A;  3FRK A;  3WGB A;  3A1I A;  4EO5 C;  3O62 C;  3HBX A;  1N1J B;  3HLM A;  3NQU A;  2G7J A;  4Z66 B;  4YM6 B;  2CY8 A;  3A2B A;  3H9X A;  5GSU C;  3W98 D;  1TOI A;  4LW4 A;  2D7Y A;  5F8V A;  3RQ1 A;  3FVX A;  5M4B A;  5B31 G;  4YS3 C;  1N1J A;  1AX4 A;  2YRI A;  4E1O A;  2OQX A;  2O7C A;  1AJR A;  4Z66 A;  4YM6 A;  3DRD A;  1B5O A;  4KGC D;  4WV4 B;  5EUE A;  5AVC B;  4HGA B;  4NE6 A;  5KDM A;  3GJU A;  4WNN B;  2W8S A;  2AY5 A;  4Z66 D;  4YM6 D;  3UTA B;  1ARG A;  3R9A A;  4H9N B;  1W7L A;  1U35 B;  2VMX A;  3GWP A;  5AY8 B;  1ID3 B;  3AV1 C;  3AEJ A;  2VGS A;  2AY2 A;  1IX7 A;  2W8J A;  4J8W D;  4ZDL A;  3MNN C;  1TZY C;  5AVC A;  2PO3 A;  5AV5 C;  3LEL D;  5E5A C;  4WNN A;  4E45 A;  1M0N A;  2YKY A;  1UU0 A;  3UTA A;  3A9Z A;  3KGX A;  4H9N A;  1U35 A;  1SFF A;  5G4I A;  5AY8 A;  1ID3 A;  2HUI A;  9AAT A;  1R4V A;  4Y0I A;  5AVC D;  2X5D A;  4J8U B;  3UTA D;  3MGR A;  3DZZ A;  2IO5 C;  3AEL A;  1U35 D;  2QB2 A;  1S32 D;  5AY8 D;  1ID3 D;  1PG8 A;  5B2J C;  1KKJ A;  3MEB A;  4XZQ B;  2F8N B;  3TAT A;  1C7G A;  4F5F A;  1KX4 C;  4J8U A;  3K28 A;  2TPL A;  1TAF B;  5TF5 A;  5J8Q A;  1C7N A;  1OHY A;  4XZQ A;  3X1U C;  2YKV A;  3AFA D;  2F8N A;  1JS3 A;  3VH5 T;  5BS7 A;  3AAT A;  4LNJ A;  4Q6R A;  3REK C;  4J5U A;  3V9R B;  4PFN A;  5FT5 A;  5EUN A;  3MNN B;  1VP4 A;  4WYG A;  4XZQ D;  1TAF A;  5AV8 B;  4EB7 A;  4LW2 A;  4XJP A;  3AZG C;  4ZUX B;  3AEM C;  4BHD A;  4MKK A;  4TN4 A;  1JFI B;  2R5C B;  1E5E A;  3V9R A;  3ELP A;  5GT3 D;  1P3M C;  2VMV A;  3MNN A;  1KX3 D;  1CS1 A;  3KWQ D;  1H0C A;  3AEO A;  5AV8 A;  4WBT A;  3GZD A;  3X1T B;  2VIB A;  4X23 B;  4ZUX A;  1DFO A;  3NU8 A;  3QN6 A;  1UKJ A;  1VEF A;  3REJ C;  3NTJ A;  3FCR A;  4QLC C;  1JFI A;  2R5C A;  4QGR A;  2G6W A;  5B0Y C;  5AV8 D;  1M4N A;  1ART A;  4ZUX D;  5B33 C;  2GQN A;  4R5Z A;  3JTX A;  3AYW C;  4K2I A;  4Y0H A;  1AIA A;  3X1T A;  4KXK A;  4X23 A;  2NQB C;  3USF A;  4B98 A;  4M6B A;  4XQ2 A;  2W7K A;  4CXQ A;  3FVU A;  1O61 A;  5C6U A;  4NOG A;  4UOY A;  3X1T D;  2DQN C;  4BA4 A;  3B46 A;  3MVD C;  3WTP D;  3LVK A;  3N5M A;  5GT0 B;  1D7V A;  4FL0 A;  4IY7 A;  4KUD B;  4LD9 C;  3MAD A;  1P3K C;  4F4E A;  1GBN A;  4E3Q A;  2Y2I A;  4F5K A;  3AZJ B;  1WYT B;  1MAP A;  3AZE D;  3VAX A;  2ZP7 A;  2EYQ A;  3QM2 A;  5GT0 A;  1M18 B;  1B8G A;  4MQQ A;  4KUD A;  2PYO B;  3REL B;  4A72 A;  2CJD A;  2DGM A;  3REJ B;  3AZJ A;  1BJO B;  4OT8 A;  1GC0 A;  1WYT A;  5GT0 D;  2VMY A;  4Q31 A;  4IXS A;  2D61 A;  3IP4 C;  2G5H C;  4KUD D;  3LJA C;  1LC5 A;  2ZC0 A;  3K7Y A;  1N2T A;  1M18 A;  5AVB B;  1FG7 A;  1CQ7 A;  3AZJ D;  2PYO A;  3DR4 A;  3REL A;  1G4X A;  4Q76 A;  2YHK A;  3UT9 C;  3PGY A;  2CFB A;  1A7W A;  3REJ A;  1BJO A;  4QLC A;  1P34 B;  2PB2 A;  3I4J A;  3KGW A;  3FSL A;  2JJH A;  4M2M A;  2PYO D;  3REL D;  4O6Z A;  3TFU A;  5AVB A;  1S09 A;  1AMA A;  1GEX A;  3B1E A;  3AEP A;  1ASB A;  5B24 C;  1M1A B;  1KMK A;  3D6K A;  1KL2 A;  3BCX A;  1P34 A;  4LNL A;  3UTB B;  3AZL D;  5AVB D;  5FT8 A;  2BI5 A;  3B8X A;  5BJ4 A;  4R8P B;  4W1V A;  4IX8 A;  3BWN A;  2ZY2 A;  2NZD C;  3P5J B;  1X28 A;  3LWS A;  3MGS B;  1M1A A;  1P34 D;  3ACZ A;  2DF4 C;  1C9C A;  5JRG B;  2CJG A;  3UTB A;  2GSA A;  2Y2G A;  4HVK A;  2VQR A;  1OAT A;  2D66 A;  1AHF A;  4R8P A;  5M4D A;  1M1A D;  2W7J A;  3TFT A;  1TOJ A;  2Z20 A;  1AAM A;  3WKJ D;  3MGS A;  1LK9 A;  4R8P D;  3BWO A;  5JRG A;  4J8X B;  2C0R A;  3A6N C;  2HIO B;  2VMP A;  1V2E A;  1BH9 B;  3NDN A;  2ARO C;  1M0O A;  3WKR A;  5B1L C;  3DC1 A;  1RV4 A;  4J8X A;  5B31 D;  4UHN A;  2HIO A;  2EZ1 A;  1UU2 A;  3FZ6 A;  2BYK B;  2RVQ C;  5F9S A;  1BH9 A;  1IAX A;  1RVY A;  4JJN B;  2YKU A;  5B1M C;  2F8N G;  4J8X D;  2BYL A;  3AZF C;  4TMR A;  2HIO D;  1ASD A;  3X1S B;  5DNM C;  1AHG A;  2JE5 A;  4WU8 B;  4WU9 B;  2BYK A;  1PMO A;  3G0T A;  4JJN A;  3NNK A;  3VH6 T;  3MGQ B;  3UAK A;  4AOA A;  1TOE A;  3JZL A;  4ZDP A;  1CL1 A;  8AAT A;  1AY5 A;  2VMQ A;  3X1S A;  4WU8 A;  4WU9 A;  4Z2M G;  4PFF A;  3EI5 A;  2GB3 A;  3MGQ A;  4W8I A;  3X1S D;  4WU8 D;  4MY5 A;  4WU9 D;  2HUE B;  4H9Q B;  4GDY A;  1AMR A;  5EAV A;  2ZM5 A;  1B9H A;  1HQ3 B;  4A0F A;  3MGQ D;  3E77 A;  3KSY A;  4G92 B;  3MKJ A;  2W8V A;  3B0C W;  1GC3 A;  3F6T A;  4P3M A;  3LV2 A;  4RJ0 A;  4H9Q A;  4A0R A;  2VMR A;  1TAR A;  2HOR A;  2FFF B;  4RIZ A;  1HQ3 A;  3PAA A;  3JWA A;  4ZDO A;  5IWQ A;  3E2Z B;  2HZP A;  3EPK A;  1ASF A;  3H0L C;  1P3O B;  2Y2L A;  2CB1 A;  3MGP C;  1ORD A;  3WA9 B;  1HQ3 D;  3VK4 A;  2ZSL A;  2VMZ A;  3AZH D;  4FFC A;  3NX3 A;  3WCN A;  4KHA B;  2HUU A;  5CPK B;  4JEX A;  4WXG A;  1GDE A;  3E2Z A;  4E3R A;  3AV2 B;  1P3O A;  2JJE A;  1WKH A;  1C7O A;  3WA9 A;  1S06 A;  5BO0 B;  1W7N A;  4UQV A;  2W8U A;  1P3P B;  2FM1 A;  5DNN B;  1ARS A;  3P1T A;  4KHA A;  2FJ7 B;  2D5Y A;  5CPK A;  3ATH A;  3W96 C;  5BNX B;  3WA9 D;  1N31 A;  3LVJ A;  5B40 C;  3AV2 A;  1O62 A;  4H9R B;  3B6F C;  2RFV A;  3FTB A;  5BO0 A;  1P3P A;  5CPK D;  3C1B B;  2HP2 A;  5DNN A;  4RIT A;  3KXB C;  1W2E A;  4KGC C;  2FJ7 A;  4WB0 B;  5B32 B;  4ITX A;  3AV2 D;  5CPI C;  1P3I D;  2CH2 A;  2VGU A;  5BNX A;  1P3P D;  1DJU A;  4H9R A;  3DR7 A;  2E7I A;  5DNN D;  2FN6 A;  4A0G A;  3ASA A;  2FJ7 D;  1SVV A;  3WAA C;  3C1B A;  3AZI C;  4AWL C;  4J8W C;  4WB0 A;  5B32 A;  3LZ0 B;  4GEB A;  4XUJ B;  3G8M A;  3C1B D;  2JSS A;  1IX6 A;  3WTP E;  1BJN A;  5B32 D;  1CZC A;  2FNU A;  5G0A A;  1LKC A;  3GR9 A;  3DYD A;  3LZ0 A;  4GRX A;  4G91 B;  4Z5T B;  4IW7 A;  1S32 C;  2QB3 A;  3N75 A;  2W7E A;  3VK2 A;  4XUJ A;  3KUY C;  1ASN A;  5G09 A;  3LZ0 D;  4GE9 A;  1W7M A;  5KDM B;  4XUJ D;  1AKB A;  4Z5T A;  1AMS A;  1P3L B;  4J8V B;  3EUC A;  1M0P A;  3Q8N A;  4WYF A;  5C3I B;  3AFA C;  1O4S A;  2J8P A;  3A9X A;  1YIY A;  2R0T A;  4U1T A;  5GXQ C;  1P3F B;  3W97 C;  2ORD A;  3LG0 A;  1PMM A;  1P3L A;  4J8V A;  2Z1Y A;  4WYD A;  2DOU A;  3FDB A;  1Y4I A;  1SZU A;  4F5G A;  5GT3 C;  3MGR B;  1P3L D;  1P3F A;  4J8V D;  4XK1 A;  3AZM C;  4F5I A;  1BQD A;  4EO5 B;  3O62 B;  1OHW A;  4ZWV A;  4XJM A;  4XAU A;  1P3F D;  5GSU B;  4EMY A;  2C81 A;  4WZS B;  3REH C;  2DKB A;  2OGA A;  1AAW A;  4YS3 B;  3B6G C;  1ELU A;  2VMO A;  3EI8 A;  3O62 A;  3RCH B;  1S0A A;  3MGR D;  2BYJ A;  1BQA A;  3EIA A;  1QGN A;  4OCA A;  5GSU A;  3NYU A;  4DRB A;  3AZK C;  2Y2K A;  1M32 A;  1AJS B;  3I5T A;  4KYO A;  3O62 D;  5GXQ B;  2W7H A;  3WTP C;  2YRR A;  4YS3 A;  1OXO A;  1CQ6 A;  3COG A;  3RCH A;  3W1I A;  4J8U D;  3ZZK A;  5GSU D;  4AO4 A;  1P3W A;  4NFT A;  3AV1 B;  2ZUK A;  2Y2O A;  4YS3 D;  4DBC A;  1TZY B;  3W99 C;  1AJS A;  2E7U A;  5AV5 B;  2F8N D;  5GXQ A;  5E5A B;  2Z9V A;  3AZM B;  1JF9 A;  2ZYJ A;  3AV1 A;  4OBU A;  2BI2 A;  4J8L A;  2EZ2 A;  2XBN A;  1TZY A;  4W5K A;  3C1C C;  4ATQ A;  5AV5 A;  2F8J A;  2IO5 B;  5E5A A;  5B0Z C;  1D7U A;  5JAY A;  2AEU A;  5AV9 C;  5B2J B;  3AZM A;  3HVY A;  3B6G B;  3MNN D;  2DKJ A;  1TZY D;  5AV5 D;  1X29 A;  2VI9 A;  1KX4 B;  3FQ8 A;  4EB5 A;  1KKP A;  1WWS A;  3NU7 A;  1BW0 A;  1D2F A;  5B2J A;  1P3G C;  3B6G A;  4MSO A;  3X1U B;  2Q7W A;  3BC8 A;  3G7Q A;  4L0O A;  1V2D A;  2CV5 C;  3REK B;  3HMU A;  5FUG B;  3E2Y A;  1KX4 A;  3H0R C;  4X23 D;  1OHV A;  3AZL C;  3X1V C;  3WGC A;  4B9B A;  5B2J D;  3AOW A;  3REI C;  4CXR A;  1ASG A;  3JWB A;  3AZN C;  3AZG B;  4BQ0 A;  3X1U A;  1KX4 D;  4R5F A;  3REK A;  3KFU G;  3NYS A;  2VGW A;  4MKJ A;  1MDZ A;  4K2M A;  5FUG A;  1P3M B;  5B32 G;  3F9T A;  2DR1 A;  2AAT A;  3X1U D;  4ADB A;  3VH6 A;  1F66 C;  3FVS A;  4NE3 A;  3LZ1 C;  3REK D;  3AZG A;  3WKJ C;  1T3I A;  3AEM A;  3DXW A;  1U08 A;  2QMA A;  4WP0 A;  4QLC B;  4GE7 A;  5G2P A;  1GEW A;  3EPH A;  5CPJ C;  5B0Y B;  1P3M A;  4A6T A;  5B33 B;  4ZWM A;  3AYW B;  1YAA A;  1B9I A;  4AO9 A;  4CSR B;  2WKA A;  2CST A;  2NQB B;  5AV9 A;  1P3M D;  3EPL A;  3TQX A;  1M18 D;  5B0Y A;  5B31 C;  5EQC A;  2AY6 A;  3FKD A;  5B33 A;  5EAA A;  1BJW A;  1T3U A;  3MVD B;  1KX5 C;  1BH8 B;  3AYW A;  1Z3Z A;  3REJ D;  3FFR A;  4QLC D;  4CSR A;  1N8P A;  2NQB A;  4LD9 B;  5B0Y D;  4OYT A;  2YCN A;  1IAY A;  1QIR A;  1P3K B;  2YOB A;  5B33 D;  1QJ5 A;  3BCA A;  3CQ6 A;  3AYW D;  3PDX A;  2NQB D;  2VGV A;  4H51 A;  3MVD A;  1BH8 A;  3B1C A;  1F66 B;  4LD9 A;  1JG8 A;  1P3K A;  1RVU A;  1J32 A;  2BIE A;  1ASC A;  1ECX A;  3MVD D;  3FZ7 A;  5BNV A;  1GC2 A;  2R5E A;  4LD9 D;  3LJA B;  2Z9W A;  3FFH A;  1P3K D;  3EPJ A;  3GZC A;  1H3O B;  1F66 A;  3UTB D;  4MQR A;  5F99 C;  3EG5 B;  3UT9 B;  2AY9 A;  1LW5 A;  3A1K A;  1G7W A;  2OKK A;  3MGS D;  4E44 A;  3VH5 W;  4H9S C;  1EJI A;  3LJA A;  4UUZ B;  2OGE A;  5AV6 C;  3WLX A;  4XEW A;  1ZLA C;  1H3O A;  5JRG D;  3OKS A;  1XEY A;  2ZSM A;  5B24 B;  3MC6 C;  3OP7 A;  3UT9 A;  2CTZ A;  3R4T A;  4RKD A;  3LJA D;  3DU4 A;  4NE5 A;  4CBR A;  4A00 A;  5CP6 C;  1ARI A;  3N4S A;  1MLZ A;  4UUZ A;  1ARH A;  3UT9 D;  2NZD B;  2VLF A;  4M2J A;  5B24 A;  1IUG A;  4R8D A;  4LNM A;  2VMS A;  2L5A A;  2D7Z A;  3AZH C;  2FNI A;  1P3B C;  4DQ6 A;  5B24 D;  3TU4 C;  1CJ0 A;  1M19 C;  2NZD A;  2BIA A;  2F8N K;  3HT4 A;  2RIQ A;  3KE3 A;  1EQZ C;  5BT1 D;  3A6N B;  4JJN D;  1DGE A;  1W23 A;  2NZD D;  3NUB A;  1D7S A;  2BKW A;  4H63 Q;  2E7J A;  1FC4 A;  4ZM3 A;  5B2I C;  2ARO B;  2Y2J A;  2PB0 A;  2EO5 A;  2V0Y A;  1QIS A;  2BI9 A;  5B1L B;  1CL2 A;  2Y2P A;  3RUY A;  1B67 A;  3A6N A;  3B0D C;  1MLY A;  1AOI C;  5E5I A;  2BWN A;  2QBT A;  1P3I C;  3LVM A;  2XD1 A;  3T32 A;  2ARO A;  5B1M B;  1P3A C;  3AZF B;  5B1L A;  2D64 A;  3EZS A;  3H0M C;  2GMS A;  2CAN A;  2YFV B;  2VMN A;  3AN2 C;  5DNM B;  2FYF A;  1CZE A;  3ZZJ A;  2ARO D;  4IYO B;  5B1L D;  1PFF A;  1E5F A;  1J04 A;  5B1M A;  3AZF A;  4F5L A;  1LW4 A;  4ZLV A;  4MQP A;  2G5I C;  2YFV A;  3H7F A;  3PA9 A;  5DNM A;  5DJ9 A;  2F8N H;  5B1M D;  4IYO A;  2HOY A;  4ZBJ C;  4DQY B;  4R2N A;  2JGT A;  5DNM D;  1JS6 A;  4RLG A;  3W98 C;  1X0M A;  2QLR A;  1P3O D;  3WX9 A;  4WXF A;  1AOI B;  1BFM A;  1S07 A;  2Y2N A;  2W7M A;  2CIN A;  4ADE A;  4Z2M H;  2JCH A;  1EQB A;  3E2F A;  4P7Y A;  1AOI A;  2ZY3 A;  2A1V A;  3VH5 A;  1SF2 A;  4Z66 C;  4YM6 C;  2X3L A;  4F5M A;  3ECD A;  2VGZ A;  2CH1 A;  3MGP B;  4EU1 A;  1XI9 A;  3EIB A;  2Y2H A;  2NMP A;  3LY1 A;  3ISL A;  3LEL C;  2VMU A;  2BG1 A;  2UWX A;  1ULY A;  1AKA A;  2ZJG A;  3AEJ C;  1BJ4 A;  3MAU A;  4PIW A;  2BIG A;  3MGP A;  5AVC C;  3LVL B;  4HGA C;  2AY7 A;  1TAT A;  5KTB A;  4CAY B;  1ASE A;  1MDX A;  2W7L A;  3UTA C;  4RAE A;  1U35 C;  5AY8 C;  1ID3 C;  3PD6 B;  1IBJ A;  3IHJ A;  3MGP D;  3W96 B;  2CWE A;  3AL0 C;  5B40 B;  5FT6 A;  3B6F B;  2Z61 A;  2VLH A;  4XJL A;  4CAY A;  2HP1 A;  3EI9 A;  2W7G A;  3KXB B;  1TAS A;  4KGC B;  4OMA A;  4OBV A;  5CPI B;  3PD6 A;  4EFF A;  3W96 A;  2HUF A;  5B40 A;  3B6F A;  4J8U C;  1BT4 A;  5M49 A;  4Z5T D;  1W3U A;  3WAA B;  1GC4 A;  3VH6 W;  3AZI B;  4AWL B;  4J8W B;  3KXB A;  3W96 D;  5HHY A;  1BKG A;  4KGC A;  5B40 D;  4XZQ C;  5CPI A;  3B6F D;  5BS7 C;  3LEL B;  4WYE A;  1V2F A;  1AIC A;  1TPL A;  3VOM A;  3KXB D;  1GCK A;  4F5H A;  3WAA A;  5CPI D;  1AHX A;  3AZI A;  4J8W A;  1KX3 C;  3KWQ C;  4W91 A;  3LEL A;  1WWI A;  1S32 B;  3QHX A;  1Z7D A;  3WAA D;  3KUY B;  4RJY A;  3AZI D;  2VI8 A;  2WK7 A;  3L8A A;  1Q9C A;  3DOD A;  5E3K A;  5AV8 C;  2FQ6 A;  3QBO A;  4I8A A;  3QI6 A;  4DRA A;  3GZD C;  4ZUX C;  1B4X A;  1S32 A;  3N0L A;  1BS0 A;  1QJ3 A;  1RV3 A;  3BB8 A;  3KUY A;  1I48 A;  1SZS A;  3AFA B;  3ZRQ A;  1AIB A;  4JEW A;  3RI6 A;  3X1T C;  4X23 C;  1CQ8 A;  3W97 B;  3KUY D;  1GD9 A;  3WKS A;  1WYU B;  4ISY A;  5DB5 A;  3AFA A;  1M0Q A;  2W8W A;  3AZE C;  1DJ9 A;  4ZSY A;  2VIA A;  5EUD A;  5GT3 B;  4UHO A;  3AEN B;  2D65 A;  1MDO A;  3W97 A;  1KX3 B;  1DGD A;  3KWQ B;  4RKC A;  1WYU A;  2F2A C;  2XD5 A;  2ZY5 A;  2YFW B;  3EI6 A;  1D7R A;  2O1B A;  5GXQ D;  3RBF A;  3GBX A;  7AAT A;  3W97 D;  5GT0 C;  5GT3 A;  2ZY4 A;  3AEN A;  3REH B;  4KUD C;  1KX3 A;  1ZOD A;  4UPK A;  5EIG B;  3KWQ A;  3AV1 D;  4KAM A;  2X8U A;  3AZJ C;  1M7Y A;  4OTL A;  2YFW A;  3BN1 A;  2Z9X A;  1QZ9 A;  3HL2 A;  5E5A D;  1M18 C;  2YCT A;  1AY4 A;  3AZM D;  3AZK B;  1KMJ A;  3REH A;  4ATP A;  3R45 B;  2PYO C;  4A6R A;  3REL C;  5EIG A;  3WTP B;  3HQT A;  4F5J A;  3MBB A;  4ZM4 A;  3REH D;  5AVB C;  2JJF A;  3RBL A;  3N4R A;  3AZK A;  3B6G D;  3WCO A;  3AZE B;  3W99 B;  3R45 A;  1IVR A;  3WTP A;  3FDD A;  4W1W A;  3CAI A;  4WYA A;  1P34 C;  1LS3 A;  2XH1 A;  3AZK D;  4OC9 A;  3ASB A;  3BWN C;  3PJ0 A;  1B5P A;  4WLH A;  3AZE A;  1Z2C B;  4CBS A;  3W99 A;  5G2Q A;  3C1C B;  2FKI A;  2EH6 A;  1M1A C;  3AV7 A;  5B0Z B;  3BCB A;  2QSR A;  1DKA A;  5AV9 B;  2BHX A;  1ELQ A;  3UTB C;  4R8P C;  3B0C T;  1LC7 A;  5D95 A;  3W99 D;  1QIT A;  4GE4 A;  2QA3 A;  3N4X A;  4U2H A;  3AZG D;  4ITG A;  3C1C A;  3MGS C;  5B0Z A;  3GSB A;  3E9K A;  5JRG C;  1P3G B;  2D63 A;  5G4J A;  3QPG A;  3JW9 A;  4A0H A;  1G7X A;  3C1C D;  2DGK A;  5FT4 A;  2CV5 B;  1KU5 A;  5B0Z D;  3AZL B;  3X1V B;  5AV9 D;  5D5S A;  3EZ1 A;  4JEV A;  2W7F A;  3EI7 A;  5EFS A;  5K8B A;  3REI B;  1ASA A;  4UHM A;  3AZN B;  4RM1 A;  4GSA A;  4J8X C;  1P3G A;  3AOV A;  2WK8 A;  4AZK A; 
#chains in the Genus database with same CATH homology
 2HIO C;  4ADD A;  4W1X A;  4BA5 A;  2CV5 A;  5BNV B;  1G4V A;  3AZL A;  3X1V A;  4A6U A;  4HF8 A;  1P3G D;  3REI A;  3AZN A;  3UWC A;  4WD2 A;  3LZ1 B;  2W7D A;  3ELE A;  2CV5 D;  3WKJ B;  3N7N A;  3PDB B;  3L44 A;  4N0W A;  1SPA A;  3X1V D;  1KL1 A;  5CPJ B;  5BT1 C;  3REI D;  1HTA A;  4JJN C;  4JF1 A;  3AZN D;  1F1E A;  3B1D A;  4Q75 A;  3E6G A;  1S08 A;  2VYC A;  1YOO A;  2W7I A;  1YNU A;  3LZ1 A;  1TOK A;  4M2K A;  3X1S C;  3WKJ A;  3PDB A;  3VP6 A;  1WYV B;  4WU8 C;  5E4Z A;  4WU9 C;  4ZAS A;  3BV0 A;  1EG5 A;  5CHL B;  2C7T A;  1I29 A;  1TOG A;  5CPJ A;  1F66 D;  5B31 B;  3CQ4 A;  3LZ1 D;  3MGQ C;  3PPL A;  2EPJ A;  5I92 A;  1KX5 B;  2BWP A;  2W8T A;  1WYV A;  5CPJ D;  1VJO A;  2DGL A;  3K40 A;  5B31 A;  2Z1Z A;  1KX5 A;  2HOZ A;  2HUE C;  2AY8 A;  3UE8 A;  2JJG A;  1HQ3 C;  3II0 A;  2AEV A;  1KX5 D;  4G92 C;  4E77 A;  3PIU A;  3A8U X;  2BYM B;  1FG3 A;  3WZF A;  4IXO A;  2JG2 A;  5F99 B;  1AY8 A;  2E54 A;  2Z9U A;  1X2A A;  4BMK A;  5M46 A;  3VK3 A;  2Y2Q A;  1P3O C;  2BI3 A;  5AV6 B;  3WA9 C;  5BJ3 A;  1ZLA B;  2BYM A;  1H1C A;  3FQA A;  3NQJ B;  3ZRR A;  5F99 A;  5JA4 B;  3NUI A;  2R2N A;  5CPK C;  4LC3 A;  3CBF A;  3M5U A;  3QGU A;  3AV2 C;  5CP6 B;  4H9S A;  5AV6 A;  4CVQ A;  2Y2M A;  2O0R A;  1ZLA A;  5F99 D;  1IJI A;  1P3P C;  2AY4 A;  3A6N D;  5DNN C;  3NQJ A;  4JEY A;  3NYT A;  5JA4 A;  2YCP A;  2FJ7 C;  3MC6 A;  4IXZ A;  4AZJ A;  3W1J A;  1O69 A;  4JF0 A;  5AV6 D;  1ZLA D;  1YJS A;  2JIS A;  3AZH B;  2VGT A;  4K05 A;  1I41 A;  3BS8 A;  5CP6 A;  1P3B B;  3TU4 B;  1MGV A;  3C1B C;  1M19 B;  4K2B A;  5DJ1 A;  1IX8 A;  3TCM A;  5B32 C;  2GMU A;  1EQZ B;  5CP6 D;  1AHY A;  2RVQ D;  3AZH A;  4JEZ A;  3B0B A;  1WKG A;  1ZOB A;  2VMT A;  3AZF D;  3KKI A;  1P3B A;  1I43 A;  3TU4 A;  1YIZ A;  2YKX A;  3ZRP A;  3F0H A;  1ASL A;  1M19 A;  5B2I B;  1GEY A;  4H9O B;  3LZ0 C;  1EQZ A;  3MAF B;  1AMQ A;  4ADC A;  3NRA A;  1P3B D;  4WXB A;  3TU4 D;  4H9P B;  4XJO A;  3B0D B;  4XUJ C;  1M19 D;  5DX5 A;  1AKC A;  3DXV A;  1DJE A;  3I16 A;  5HDM A;  1P3I B;  1DTY A;  1EQZ D;  3GET A;  5B2I A;  1AHE A;  5G49 B;  1P3A B;  4H9O A;  2AY1 A;  4WLJ A;  4AH3 A;  1UU1 A;  3A9Y A;  3MAF A;  5HXX A;  4WYC A;  4G91 C;  4Z5T C;  4DGT A;  1C0N A;  1SZK A;  4H9P A;  3AN2 B;  5B2I D;  1ASM A;  2KFP A;  1P3I A;  2X5F A;  2BWO A;  4PVF A;  4ZAH A;  5G49 A;  1P3A A;  1OXP A;  3WY7 A;  4ZSW A;  1AOI D;  2OAT A;  1MAQ A;  2EGY A;  2WK9 A;  3AN2 A;  1LC8 A;  1P3L C;  2VMW A;  2CJH A;  4J8V C;  1P3A D;  5C3I C;  4Y0D A;  2BI1 A;  2HOX A;  1B6W A;  4ZBJ B;  2LY8 A;  1V72 A;  3AN2 D;  2WB6 A;  1ZC9 A;  1PZR A;  1P3F C;  2V1P A;  1WST A;  2C44 A;  2AY3 A;  3W98 B;  1YJZ A;  2OKJ A;  3FZ8 A;  3W1H A;  5AX8 A;  3CQ5 A;  3NQU B;  1YJY A;  3FD0 A;  1M6S A;  4WJ3 C;  3MGR C;  3FQ7 A;  1C4K A;  3P6K A;  3HDO A;  3W98 A;  3FRK A;  3WGB A;  3A1I A;  4EO5 C;  3O62 C;  3HBX A;  1N1J B;  3HLM A;  3NQU A;  2G7J A;  4Z66 B;  4YM6 B;  2CY8 A;  3A2B A;  3H9X A;  5GSU C;  3W98 D;  1TOI A;  4LW4 A;  2D7Y A;  5F8V A;  3RQ1 A;  3FVX A;  5M4B A;  5B31 G;  4YS3 C;  1N1J A;  1AX4 A;  2YRI A;  4E1O A;  2OQX A;  2O7C A;  1AJR A;  4Z66 A;  4YM6 A;  3DRD A;  1B5O A;  4KGC D;  4WV4 B;  5EUE A;  5AVC B;  4HGA B;  4NE6 A;  5KDM A;  3GJU A;  4WNN B;  2W8S A;  2AY5 A;  4Z66 D;  4YM6 D;  3UTA B;  1ARG A;  3R9A A;  4H9N B;  1W7L A;  1U35 B;  2VMX A;  3GWP A;  5AY8 B;  1ID3 B;  3AV1 C;  3AEJ A;  2VGS A;  2AY2 A;  1IX7 A;  2W8J A;  4J8W D;  4ZDL A;  3MNN C;  1TZY C;  5AVC A;  2PO3 A;  5AV5 C;  3LEL D;  5E5A C;  4WNN A;  4E45 A;  1M0N A;  2YKY A;  1UU0 A;  3UTA A;  3A9Z A;  3KGX A;  4H9N A;  1U35 A;  1SFF A;  5G4I A;  5AY8 A;  1ID3 A;  2HUI A;  9AAT A;  1R4V A;  4Y0I A;  5AVC D;  2X5D A;  4J8U B;  3UTA D;  3MGR A;  3DZZ A;  2IO5 C;  3AEL A;  1U35 D;  2QB2 A;  1S32 D;  5AY8 D;  1ID3 D;  1PG8 A;  5B2J C;  1KKJ A;  3MEB A;  4XZQ B;  2F8N B;  3TAT A;  1C7G A;  4F5F A;  1KX4 C;  4J8U A;  3K28 A;  2TPL A;  1TAF B;  5TF5 A;  5J8Q A;  1C7N A;  1OHY A;  4XZQ A;  3X1U C;  2YKV A;  3AFA D;  2F8N A;  1JS3 A;  3VH5 T;  5BS7 A;  3AAT A;  4LNJ A;  4Q6R A;  3REK C;  4J5U A;  3V9R B;  4PFN A;  5FT5 A;  5EUN A;  3MNN B;  1VP4 A;  4WYG A;  4XZQ D;  1TAF A;  5AV8 B;  4EB7 A;  4LW2 A;  4XJP A;  3AZG C;  4ZUX B;  3AEM C;  4BHD A;  4MKK A;  4TN4 A;  1JFI B;  2R5C B;  1E5E A;  3V9R A;  3ELP A;  5GT3 D;  1P3M C;  2VMV A;  3MNN A;  1KX3 D;  1CS1 A;  3KWQ D;  1H0C A;  3AEO A;  5AV8 A;  4WBT A;  3GZD A;  3X1T B;  2VIB A;  4X23 B;  4ZUX A;  1DFO A;  3NU8 A;  3QN6 A;  1UKJ A;  1VEF A;  3REJ C;  3NTJ A;  3FCR A;  4QLC C;  1JFI A;  2R5C A;  4QGR A;  2G6W A;  5B0Y C;  5AV8 D;  1M4N A;  1ART A;  4ZUX D;  5B33 C;  2GQN A;  4R5Z A;  3JTX A;  3AYW C;  4K2I A;  4Y0H A;  1AIA A;  3X1T A;  4KXK A;  4X23 A;  2NQB C;  3USF A;  4B98 A;  4M6B A;  4XQ2 A;  2W7K A;  4CXQ A;  3FVU A;  1O61 A;  5C6U A;  4NOG A;  4UOY A;  3X1T D;  2DQN C;  4BA4 A;  3B46 A;  3MVD C;  3WTP D;  3LVK A;  3N5M A;  5GT0 B;  1D7V A;  4FL0 A;  4IY7 A;  4KUD B;  4LD9 C;  3MAD A;  1P3K C;  4F4E A;  1GBN A;  4E3Q A;  2Y2I A;  4F5K A;  3AZJ B;  1WYT B;  1MAP A;  3AZE D;  3VAX A;  2ZP7 A;  2EYQ A;  3QM2 A;  5GT0 A;  1M18 B;  1B8G A;  4MQQ A;  4KUD A;  2PYO B;  3REL B;  4A72 A;  2CJD A;  2DGM A;  3REJ B;  3AZJ A;  1BJO B;  4OT8 A;  1GC0 A;  1WYT A;  5GT0 D;  2VMY A;  4Q31 A;  4IXS A;  2D61 A;  3IP4 C;  2G5H C;  4KUD D;  3LJA C;  1LC5 A;  2ZC0 A;  3K7Y A;  1N2T A;  1M18 A;  5AVB B;  1FG7 A;  1CQ7 A;  3AZJ D;  2PYO A;  3DR4 A;  3REL A;  1G4X A;  4Q76 A;  2YHK A;  3UT9 C;  3PGY A;  2CFB A;  1A7W A;  3REJ A;  1BJO A;  4QLC A;  1P34 B;  2PB2 A;  3I4J A;  3KGW A;  3FSL A;  2JJH A;  4M2M A;  2PYO D;  3REL D;  4O6Z A;  3TFU A;  5AVB A;  1S09 A;  1AMA A;  1GEX A;  3B1E A;  3AEP A;  1ASB A;  5B24 C;  1M1A B;  1KMK A;  3D6K A;  1KL2 A;  3BCX A;  1P34 A;  4LNL A;  3UTB B;  3AZL D;  5AVB D;  5FT8 A;  2BI5 A;  3B8X A;  5BJ4 A;  4R8P B;  4W1V A;  4IX8 A;  3BWN A;  2ZY2 A;  2NZD C;  3P5J B;  1X28 A;  3LWS A;  3MGS B;  1M1A A;  1P34 D;  3ACZ A;  2DF4 C;  1C9C A;  5JRG B;  2CJG A;  3UTB A;  2GSA A;  2Y2G A;  4HVK A;  2VQR A;  1OAT A;  2D66 A;  1AHF A;  4R8P A;  5M4D A;  1M1A D;  2W7J A;  3TFT A;  1TOJ A;  2Z20 A;  1AAM A;  3WKJ D;  3MGS A;  1LK9 A;  4R8P D;  3BWO A;  5JRG A;  4J8X B;  2C0R A;  3A6N C;  2HIO B;  2VMP A;  1V2E A;  1BH9 B;  3NDN A;  2ARO C;  1M0O A;  3WKR A;  5B1L C;  3DC1 A;  1RV4 A;  4J8X A;  5B31 D;  4UHN A;  2HIO A;  2EZ1 A;  1UU2 A;  3FZ6 A;  2BYK B;  2RVQ C;  5F9S A;  1BH9 A;  1IAX A;  1RVY A;  4JJN B;  2YKU A;  5B1M C;  2F8N G;  4J8X D;  2BYL A;  3AZF C;  4TMR A;  2HIO D;  1ASD A;  3X1S B;  5DNM C;  1AHG A;  2JE5 A;  4WU8 B;  4WU9 B;  2BYK A;  1PMO A;  3G0T A;  4JJN A;  3NNK A;  3VH6 T;  3MGQ B;  3UAK A;  4AOA A;  1TOE A;  3JZL A;  4ZDP A;  1CL1 A;  8AAT A;  1AY5 A;  2VMQ A;  3X1S A;  4WU8 A;  4WU9 A;  4Z2M G;  4PFF A;  3EI5 A;  2GB3 A;  3MGQ A;  4W8I A;  3X1S D;  4WU8 D;  4MY5 A;  4WU9 D;  2HUE B;  4H9Q B;  4GDY A;  1AMR A;  5EAV A;  2ZM5 A;  1B9H A;  1HQ3 B;  4A0F A;  3MGQ D;  3E77 A;  3KSY A;  4G92 B;  3MKJ A;  2W8V A;  3B0C W;  1GC3 A;  3F6T A;  4P3M A;  3LV2 A;  4RJ0 A;  4H9Q A;  4A0R A;  2VMR A;  1TAR A;  2HOR A;  2FFF B;  4RIZ A;  1HQ3 A;  3PAA A;  3JWA A;  4ZDO A;  5IWQ A;  3E2Z B;  2HZP A;  3EPK A;  1ASF A;  3H0L C;  1P3O B;  2Y2L A;  2CB1 A;  3MGP C;  1ORD A;  3WA9 B;  1HQ3 D;  3VK4 A;  2ZSL A;  2VMZ A;  3AZH D;  4FFC A;  3NX3 A;  3WCN A;  4KHA B;  2HUU A;  5CPK B;  4JEX A;  4WXG A;  1GDE A;  3E2Z A;  4E3R A;  3AV2 B;  1P3O A;  2JJE A;  1WKH A;  1C7O A;  3WA9 A;  1S06 A;  5BO0 B;  1W7N A;  4UQV A;  2W8U A;  1P3P B;  2FM1 A;  5DNN B;  1ARS A;  3P1T A;  4KHA A;  2FJ7 B;  2D5Y A;  5CPK A;  3ATH A;  3W96 C;  5BNX B;  3WA9 D;  1N31 A;  3LVJ A;  5B40 C;  3AV2 A;  1O62 A;  4H9R B;  3B6F C;  2RFV A;  3FTB A;  5BO0 A;  1P3P A;  5CPK D;  3C1B B;  2HP2 A;  5DNN A;  4RIT A;  3KXB C;  1W2E A;  4KGC C;  2FJ7 A;  4WB0 B;  5B32 B;  4ITX A;  3AV2 D;  5CPI C;  1P3I D;  2CH2 A;  2VGU A;  5BNX A;  1P3P D;  1DJU A;  4H9R A;  3DR7 A;  2E7I A;  5DNN D;  2FN6 A;  4A0G A;  3ASA A;  2FJ7 D;  1SVV A;  3WAA C;  3C1B A;  3AZI C;  4AWL C;  4J8W C;  4WB0 A;  5B32 A;  3LZ0 B;  4GEB A;  4XUJ B;  3G8M A;  3C1B D;  2JSS A;  1IX6 A;  3WTP E;  1BJN A;  5B32 D;  1CZC A;  2FNU A;  5G0A A;  1LKC A;  3GR9 A;  3DYD A;  3LZ0 A;  4GRX A;  4G91 B;  4Z5T B;  4IW7 A;  1S32 C;  2QB3 A;  3N75 A;  2W7E A;  3VK2 A;  4XUJ A;  3KUY C;  1ASN A;  5G09 A;  3LZ0 D;  4GE9 A;  1W7M A;  5KDM B;  4XUJ D;  1AKB A;  4Z5T A;  1AMS A;  1P3L B;  4J8V B;  3EUC A;  1M0P A;  3Q8N A;  4WYF A;  5C3I B;  3AFA C;  1O4S A;  2J8P A;  3A9X A;  1YIY A;  2R0T A;  4U1T A;  5GXQ C;  1P3F B;  3W97 C;  2ORD A;  3LG0 A;  1PMM A;  1P3L A;  4J8V A;  2Z1Y A;  4WYD A;  2DOU A;  3FDB A;  1Y4I A;  1SZU A;  4F5G A;  5GT3 C;  3MGR B;  1P3L D;  1P3F A;  4J8V D;  4XK1 A;  3AZM C;  4F5I A;  1BQD A;  4EO5 B;  3O62 B;  1OHW A;  4ZWV A;  4XJM A;  4XAU A;  1P3F D;  5GSU B;  4EMY A;  2C81 A;  4WZS B;  3REH C;  2DKB A;  2OGA A;  1AAW A;  4YS3 B;  3B6G C;  1ELU A;  2VMO A;  3EI8 A;  3O62 A;  3RCH B;  1S0A A;  3MGR D;  2BYJ A;  1BQA A;  3EIA A;  1QGN A;  4OCA A;  5GSU A;  3NYU A;  4DRB A;  3AZK C;  2Y2K A;  1M32 A;  1AJS B;  3I5T A;  4KYO A;  3O62 D;  5GXQ B;  2W7H A;  3WTP C;  2YRR A;  4YS3 A;  1OXO A;  1CQ6 A;  3COG A;  3RCH A;  3W1I A;  4J8U D;  3ZZK A;  5GSU D;  4AO4 A;  1P3W A;  4NFT A;  3AV1 B;  2ZUK A;  2Y2O A;  4YS3 D;  4DBC A;  1TZY B;  3W99 C;  1AJS A;  2E7U A;  5AV5 B;  2F8N D;  5GXQ A;  5E5A B;  2Z9V A;  3AZM B;  1JF9 A;  2ZYJ A;  3AV1 A;  4OBU A;  2BI2 A;  4J8L A;  2EZ2 A;  2XBN A;  1TZY A;  4W5K A;  3C1C C;  4ATQ A;  5AV5 A;  2F8J A;  2IO5 B;  5E5A A;  5B0Z C;  1D7U A;  5JAY A;  2AEU A;  5AV9 C;  5B2J B;  3AZM A;  3HVY A;  3B6G B;  3MNN D;  2DKJ A;  1TZY D;  5AV5 D;  1X29 A;  2VI9 A;  1KX4 B;  3FQ8 A;  4EB5 A;  1KKP A;  1WWS A;  3NU7 A;  1BW0 A;  1D2F A;  5B2J A;  1P3G C;  3B6G A;  4MSO A;  3X1U B;  2Q7W A;  3BC8 A;  3G7Q A;  4L0O A;  1V2D A;  2CV5 C;  3REK B;  3HMU A;  5FUG B;  3E2Y A;  1KX4 A;  3H0R C;  4X23 D;  1OHV A;  3AZL C;  3X1V C;  3WGC A;  4B9B A;  5B2J D;  3AOW A;  3REI C;  4CXR A;  1ASG A;  3JWB A;  3AZN C;  3AZG B;  4BQ0 A;  3X1U A;  1KX4 D;  4R5F A;  3REK A;  3KFU G;  3NYS A;  2VGW A;  4MKJ A;  1MDZ A;  4K2M A;  5FUG A;  1P3M B;  5B32 G;  3F9T A;  2DR1 A;  2AAT A;  3X1U D;  4ADB A;  3VH6 A;  1F66 C;  3FVS A;  4NE3 A;  3LZ1 C;  3REK D;  3AZG A;  3WKJ C;  1T3I A;  3AEM A;  3DXW A;  1U08 A;  2QMA A;  4WP0 A;  4QLC B;  4GE7 A;  5G2P A;  1GEW A;  3EPH A;  5CPJ C;  5B0Y B;  1P3M A;  4A6T A;  5B33 B;  4ZWM A;  3AYW B;  1YAA A;  1B9I A;  4AO9 A;  4CSR B;  2WKA A;  2CST A;  2NQB B;  5AV9 A;  1P3M D;  3EPL A;  3TQX A;  1M18 D;  5B0Y A;  5B31 C;  5EQC A;  2AY6 A;  3FKD A;  5B33 A;  5EAA A;  1BJW A;  1T3U A;  3MVD B;  1KX5 C;  1BH8 B;  3AYW A;  1Z3Z A;  3REJ D;  3FFR A;  4QLC D;  4CSR A;  1N8P A;  2NQB A;  4LD9 B;  5B0Y D;  4OYT A;  2YCN A;  1IAY A;  1QIR A;  1P3K B;  2YOB A;  5B33 D;  1QJ5 A;  3BCA A;  3CQ6 A;  3AYW D;  3PDX A;  2NQB D;  2VGV A;  4H51 A;  3MVD A;  1BH8 A;  3B1C A;  1F66 B;  4LD9 A;  1JG8 A;  1P3K A;  1RVU A;  1J32 A;  2BIE A;  1ASC A;  1ECX A;  3MVD D;  3FZ7 A;  5BNV A;  1GC2 A;  2R5E A;  4LD9 D;  3LJA B;  2Z9W A;  3FFH A;  1P3K D;  3EPJ A;  3GZC A;  1H3O B;  1F66 A;  3UTB D;  4MQR A;  5F99 C;  3EG5 B;  3UT9 B;  2AY9 A;  1LW5 A;  3A1K A;  1G7W A;  2OKK A;  3MGS D;  4E44 A;  3VH5 W;  4H9S C;  1EJI A;  3LJA A;  4UUZ B;  2OGE A;  5AV6 C;  3WLX A;  4XEW A;  1ZLA C;  1H3O A;  5JRG D;  3OKS A;  1XEY A;  2ZSM A;  5B24 B;  3MC6 C;  3OP7 A;  3UT9 A;  2CTZ A;  3R4T A;  4RKD A;  3LJA D;  3DU4 A;  4NE5 A;  4CBR A;  4A00 A;  5CP6 C;  1ARI A;  3N4S A;  1MLZ A;  4UUZ A;  1ARH A;  3UT9 D;  2NZD B;  2VLF A;  4M2J A;  5B24 A;  1IUG A;  4R8D A;  4LNM A;  2VMS A;  2L5A A;  2D7Z A;  3AZH C;  2FNI A;  1P3B C;  4DQ6 A;  5B24 D;  3TU4 C;  1CJ0 A;  1M19 C;  2NZD A;  2BIA A;  2F8N K;  3HT4 A;  2RIQ A;  3KE3 A;  1EQZ C;  5BT1 D;  3A6N B;  4JJN D;  1DGE A;  1W23 A;  2NZD D;  3NUB A;  1D7S A;  2BKW A;  4H63 Q;  2E7J A;  1FC4 A;  4ZM3 A;  5B2I C;  2ARO B;  2Y2J A;  2PB0 A;  2EO5 A;  2V0Y A;  1QIS A;  2BI9 A;  5B1L B;  1CL2 A;  2Y2P A;  3RUY A;  1B67 A;  3A6N A;  3B0D C;  1MLY A;  1AOI C;  5E5I A;  2BWN A;  2QBT A;  1P3I C;  3LVM A;  2XD1 A;  3T32 A;  2ARO A;  5B1M B;  1P3A C;  3AZF B;  5B1L A;  2D64 A;  3EZS A;  3H0M C;  2GMS A;  2CAN A;  2YFV B;  2VMN A;  3AN2 C;  5DNM B;  2FYF A;  1CZE A;  3ZZJ A;  2ARO D;  4IYO B;  5B1L D;  1PFF A;  1E5F A;  1J04 A;  5B1M A;  3AZF A;  4F5L A;  1LW4 A;  4ZLV A;  4MQP A;  2G5I C;  2YFV A;  3H7F A;  3PA9 A;  5DNM A;  5DJ9 A;  2F8N H;  5B1M D;  4IYO A;  2HOY A;  4ZBJ C;  4DQY B;  4R2N A;  2JGT A;  5DNM D;  1JS6 A;  4RLG A;  3W98 C;  1X0M A;  2QLR A;  1P3O D;  3WX9 A;  4WXF A;  1AOI B;  1BFM A;  1S07 A;  2Y2N A;  2W7M A;  2CIN A;  4ADE A;  4Z2M H;  2JCH A;  1EQB A;  3E2F A;  4P7Y A;  1AOI A;  2ZY3 A;  2A1V A;  3VH5 A;  1SF2 A;  4Z66 C;  4YM6 C;  2X3L A;  4F5M A;  3ECD A;  2VGZ A;  2CH1 A;  3MGP B;  4EU1 A;  1XI9 A;  3EIB A;  2Y2H A;  2NMP A;  3LY1 A;  3ISL A;  3LEL C;  2VMU A;  2BG1 A;  2UWX A;  1ULY A;  1AKA A;  2ZJG A;  3AEJ C;  1BJ4 A;  3MAU A;  4PIW A;  2BIG A;  3MGP A;  5AVC C;  3LVL B;  4HGA C;  2AY7 A;  1TAT A;  5KTB A;  4CAY B;  1ASE A;  1MDX A;  2W7L A;  3UTA C;  4RAE A;  1U35 C;  5AY8 C;  1ID3 C;  3PD6 B;  1IBJ A;  3IHJ A;  3MGP D;  3W96 B;  2CWE A;  3AL0 C;  5B40 B;  5FT6 A;  3B6F B;  2Z61 A;  2VLH A;  4XJL A;  4CAY A;  2HP1 A;  3EI9 A;  2W7G A;  3KXB B;  1TAS A;  4KGC B;  4OMA A;  4OBV A;  5CPI B;  3PD6 A;  4EFF A;  3W96 A;  2HUF A;  5B40 A;  3B6F A;  4J8U C;  1BT4 A;  5M49 A;  4Z5T D;  1W3U A;  3WAA B;  1GC4 A;  3VH6 W;  3AZI B;  4AWL B;  4J8W B;  3KXB A;  3W96 D;  5HHY A;  1BKG A;  4KGC A;  5B40 D;  4XZQ C;  5CPI A;  3B6F D;  5BS7 C;  3LEL B;  4WYE A;  1V2F A;  1AIC A;  1TPL A;  3VOM A;  3KXB D;  1GCK A;  4F5H A;  3WAA A;  5CPI D;  1AHX A;  3AZI A;  4J8W A;  1KX3 C;  3KWQ C;  4W91 A;  3LEL A;  1WWI A;  1S32 B;  3QHX A;  1Z7D A;  3WAA D;  3KUY B;  4RJY A;  3AZI D;  2VI8 A;  2WK7 A;  3L8A A;  1Q9C A;  3DOD A;  5E3K A;  5AV8 C;  2FQ6 A;  3QBO A;  4I8A A;  3QI6 A;  4DRA A;  3GZD C;  4ZUX C;  1B4X A;  1S32 A;  3N0L A;  1BS0 A;  1QJ3 A;  1RV3 A;  3BB8 A;  3KUY A;  1I48 A;  1SZS A;  3AFA B;  3ZRQ A;  1AIB A;  4JEW A;  3RI6 A;  3X1T C;  4X23 C;  1CQ8 A;  3W97 B;  3KUY D;  1GD9 A;  3WKS A;  1WYU B;  4ISY A;  5DB5 A;  3AFA A;  1M0Q A;  2W8W A;  3AZE C;  1DJ9 A;  4ZSY A;  2VIA A;  5EUD A;  5GT3 B;  4UHO A;  3AEN B;  2D65 A;  1MDO A;  3W97 A;  1KX3 B;  1DGD A;  3KWQ B;  4RKC A;  1WYU A;  2F2A C;  2XD5 A;  2ZY5 A;  2YFW B;  3EI6 A;  1D7R A;  2O1B A;  5GXQ D;  3RBF A;  3GBX A;  7AAT A;  3W97 D;  5GT0 C;  5GT3 A;  2ZY4 A;  3AEN A;  3REH B;  4KUD C;  1KX3 A;  1ZOD A;  4UPK A;  5EIG B;  3KWQ A;  3AV1 D;  4KAM A;  2X8U A;  3AZJ C;  1M7Y A;  4OTL A;  2YFW A;  3BN1 A;  2Z9X A;  1QZ9 A;  3HL2 A;  5E5A D;  1M18 C;  2YCT A;  1AY4 A;  3AZM D;  3AZK B;  1KMJ A;  3REH A;  4ATP A;  3R45 B;  2PYO C;  4A6R A;  3REL C;  5EIG A;  3WTP B;  3HQT A;  4F5J A;  3MBB A;  4ZM4 A;  3REH D;  5AVB C;  2JJF A;  3RBL A;  3N4R A;  3AZK A;  3B6G D;  3WCO A;  3AZE B;  3W99 B;  3R45 A;  1IVR A;  3WTP A;  3FDD A;  4W1W A;  3CAI A;  4WYA A;  1P34 C;  1LS3 A;  2XH1 A;  3AZK D;  4OC9 A;  3ASB A;  3BWN C;  3PJ0 A;  1B5P A;  4WLH A;  3AZE A;  1Z2C B;  4CBS A;  3W99 A;  5G2Q A;  3C1C B;  2FKI A;  2EH6 A;  1M1A C;  3AV7 A;  5B0Z B;  3BCB A;  2QSR A;  1DKA A;  5AV9 B;  2BHX A;  1ELQ A;  3UTB C;  4R8P C;  3B0C T;  1LC7 A;  5D95 A;  3W99 D;  1QIT A;  4GE4 A;  2QA3 A;  3N4X A;  4U2H A;  3AZG D;  4ITG A;  3C1C A;  3MGS C;  5B0Z A;  3GSB A;  3E9K A;  5JRG C;  1P3G B;  2D63 A;  5G4J A;  3QPG A;  3JW9 A;  4A0H A;  1G7X A;  3C1C D;  2DGK A;  5FT4 A;  2CV5 B;  1KU5 A;  5B0Z D;  3AZL B;  3X1V B;  5AV9 D;  5D5S A;  3EZ1 A;  4JEV A;  2W7F A;  3EI7 A;  5EFS A;  5K8B A;  3REI B;  1ASA A;  4UHM A;  3AZN B;  4RM1 A;  4GSA A;  4J8X C;  1P3G A;  3AOV A;  2WK8 A;  4AZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...