2ZY3A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
510
structure length
510
Chain Sequence
ELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
molecule keywords L-aspartate beta-decarboxylase
total genus 189
structure length 510
sequence length 510
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy3A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy3A01
1OXPA 2ZC0A 2R0TA 2Z9WA 4U1TA 1ZOBA 1ASMA 1O4SA 2X8UA 4IW7A 4WYGA 1LW5A 2BIAA 1M0NA 4KYOA 4K2IA 4ZASA 4NOGA 1O61A 3GZDC 3II0A 2AY3A 1M0OA 3BS8A 2R5EA 2VMOA 1C9CA 3ELEA 4WYAA 4WYEA 2VGVA 2ZJGA 1WYTA 4JF0A 2EZ1A 3FKDA 4N0WA 4CVQA 1ZC9A 1AY4A 2VMQA 3FVSA 4ZSWA 3USFA 3A9YA 1IBJA 4MQQA 1IAXA 4E3RA 4JEZA 3E2ZA 5FT6A 2BWNA 1TOIA 4ADCA 2C0RA 3OP7A 1RV3A 3E2ZB 4J5UA 1KKJA 1C4KA 1G4XA 2HP2A 3N0LA 3AATA 4F5FA 3NYUA 5D95A 3RUYA 3GR9A 1VP4A 4OT8A 3FVUA 3A8UX 4TMRA 4JEWA 1AHYA 3BN1A 1N8PA 4FFCA 3TATA 3B1EA 4M2MA 2DKJA 2HOXA 4OTLA 3K40A 4HVKA 3ASAA 3F0HA 4LNMA 2EO5A 3FQ8A 3EI9A 2W7MA 1FG7A 2OQXA 1CQ7A 1LW4A 4F5HA 1TOKA 4RJYA 2CJGA 3NUIA 4XJLA 2VGTA 3PA9A 4IX8A 4F5KA 4XAUA 1OATA 1J32A 2EH6A 4O6ZA 4A0FA 3FDDA 4L0OA 1YJZA 2VYCA 1SFFA 3IHJA 5BJ3A 4F5MA 4F5LA 1BJWA 1QJ3A 2D5YA 2VMYA 1V2FA 2W7KA 1BT4A 1BQDA 1OHYA 1CL2A 4M2KA 1AICA 2YKYA 3FQ7A 2YCNA 1AMRA 1SVVA 4PIWA 1X28A 2FQ6A 4DQ6A 4WBTA 4ADEA 3EI5A 4B9BA 1GD9A 2W7EA 1WYTB 1QJ5A 1X0MA 3VK2A 2R2NA 4R5ZA 1ASEA 3QHXA 4ZLVA 2ZSMA 3BWNC 2FN6A 3ZZKA 1KL1A 3E6GA 1SPAA 5FT8A 5M46A 1LC5A 1IUGA 2W8UA 1AKCA 1D7SA 1ARIA 2CH2A 4DGTA 2BI3A 2HUIA 4LNLA 1ARSA 3JW9A 1W23A 1G7WA 3DXVA 3R9AA 1AJSB 1AHGA 1EJIA 3ZZJA 3JWBA 5E4ZA 4MKKA 3AENA 4RKCA 1MDOA 4GSAA 2HUFA 1BJOB 1JF9A 3QI6A 1AKAA 1V2EA 3MAFB 1B4XA 5G4JA 3GZCA 4ATQA 1MLYA 2Z9VA 3LV2A 3E77A 3I4JA 2YKXA 4ZDPA 4CXQA 3VOMA 4IXZA 1AMSA 1IJIA 4GDYA 1S08A 2CB1A 1C0NA 5EQCA 3BWNA 1N2TA 2VMWA 1ASLA 3F9TA 3PJ0A 1C7GA 1W7LA 2W8JA 1BS0A 1BW0A 4ISYA 2WKAA 1YIYA 5I92A 1AAWA 5AX8A 2CJHA 3L44A 3NRAA 2W7IA 4WLJA 3K7YA 3RCHB 3CBFA 4MQRA 3QPGA 2W7FA 5EUNA 1RVUA 2AY4A 2F8JA 3AELA 2EZ2A 1O62A 2DOUA 2ZY4A 3D6KA 1MDXA 2HZPA 3VK4A 1PFFA 1B9HA 3DRDA 1BQAA 2VMTA 2G6WA 3LVLB 4Y0DA 3KGWA 1S07A 5G2PA 2CFBA 4LW4A 2ORDA 4UOYA 2D7YA 5FT5A 1C7NA 4A6RA 3PGYA 3PAAA 4R8DA 3DZZA 1IAYA 2O0RA 2FNUA 1IX7A 2C44A 4XJPA 1DKAA 2X5DA 4Q76A 1LK9A 5EIGB 5M4DA 1Z7DA 4Y0HA 5E3KA 2HUUA 5F9SA 3VK3A 4AO9A 1B9IA 1ELQA 1IVRA 4WB0B 2Z1YA 2CINA 1CQ6A 3PIUA 4WXFA 1ARGA 4OC9A 4P3MA 2E54A 4IY7A 2CTZA 1WYUB 2VLFA 2GQNA 4LNJA 4ZWVA 4PFFA 1SZKA 3ELPA 3QGUA 2OGAA 5F8VA 1S09A 1LC8A 3FFRA 5JAYA 4WYCA 1UKJA 4OMAA 1DFOA 3AEOA 3QN6A 1DTYA 2W7HA 3ASBA 1DGDA 2BIGA 2Z1ZA 1BJ4A 1AY8A 1ELUA 2DKBA 2Z20A 3AEMC 3G7QA 4EB5A 2HOYA 4XEWA 3OKSA 1J04A 1CL1A 1PG8A 4ZM4A 3AEPA 1M4NA 2C81A 4Q6RA 1H0CA 1ORDA 1QZ9A 2JJHA 2VMRA 7AATA 2E7JA 1LS3A 3AEMA 2BI2A 2BHXA 3T32A 2X5FA 4EU1A 3FVXA 3VAXA 1D7UA 1VEFA 2AY1A 1AY5A 1GC3A 3FFHA 1BKGA 4FL0A 4H51A 3NU8A 4WB0A 1N31A 3PDBA 4EFFA 5G0AA 1WYVB 4AZJA 1KMKA 1C7OA 3QM2A 1D7VA 4UHNA 2FNIA 1WSTA 3TCMA 1RV4A 2BYJA 1M0PA 1WKHA 2JJEA 2ZSLA 4TN4A 4OCAA 1U08A 1SZUA 2W8VA 1YOOA 3EZ1A 3NDNA 1OHWA 3R4TA 2HP1A 2YRRA 4QGRA 3ATHA 1GCKA 4WYFA 2AY7A 1V2DA 1AHFA 1YIZA 2BWPA 1QISA 3E2FA 2E7UA 4M2JA 5EFSA 2R5CB 5HDMA 1AIBA 2VMUA 3MAUA 2ZP7A 4A6TA 1TOEA 3WKSA 2OGEA 2YOBA 5E5IA 1AMQA 5EIGA 4GE7A 4JEXA 2ZUKA 3TQXA 3G8MA 3PDXA 1GEYA 1I41A 1IX8A 4HF8A 4F4EA 1AHXA 4ITGA 4K2BA 4E77A 2W8TA 1ASAA 5D5SA 1GEWA 3EZSA 2FM1A 4F5GA 2JJFA 1AJSA 2WK7A 4UHOA 2PB0A 2GSAA 4WP0A 2VGUA 4CBRA 1YAAA 4MSOA 4WLHA 2BYLA 3FQAA 5DJ9A 1QIRA 2VIAA 1GC2A 3DODA 1TOGA 2ZY2A 2PB2A 1FC4A 1TPLA 3A9ZA 1OXOA 1CJ0A 3RQ1A 1AKBA 3ZRPA 4PFNA 2W8WA 2VMVA 3N75A 2JJGA 3DC1A 5TF5A 1W7MA 3LY1A 1G7XA 5EAVA 2W7GA 2EPJA 1VJOA 1ZODA 1GEXA 2D7ZA 4KAMA 4W1VA 2D63A 4ZAHA 4JEYA 1W7NA 3WGCA 4A0HA 3B46A 1AJRA 5K8BA 1MAPA 2VLHA 3LWSA 1WYUA 4JEVA 1ARTA 1BJOA 4ZM3A 1CS1A 3BCAA 4WD2A 1D2FA 5HHYA 1YJYA 4ZWMA 1DGEA 4XK1A 5G09A 3NX3A 2D65A 4F5IA 5DJ1A 2V0YA 1CZEA 1WYVA 3BCBA 3M5UA 3MC6A 4OYTA 1CQ8A 2NMPA 3P6KA 4JF1A 1MDZA 2XBNA 2CY8A 2W7JA 2VMSA 3Q8NA 2O1BA 2W7DA 4IYOA 3COGA 3ZRQA 4LW2A 4XJOA 3MAFA 4A0RA 3BC8A 3HMUA 1DJUA 4RAEA 2FYFA 1G4VA 2E7IA 3DXWA 2VIBA 4R5FA 4ZDLA 3CQ6A 4U2HA 4AO4A 1KL2A 2V1PA 5EAAA 1E5FA 4AOAA 4ZDOA 2AY9A 3PPLA 4MY5A 3ACZA 3PDBB 1OHVA 1ASNA 2VMXA 1QITA 3BWOA 3NYSA 3NUBA 4W1WA 1TARA 1YNUA 1TATA 3UWCA 3FRKA 4W91A 2CJDA 4A72A 4E3QA 4ATPA 3MC6C 2Z9UA 4R2NA 4BA5A 3WGBA 5HXXA 3WX9A 3LVJA 2QB2A 2AY5A 3L8AA 3TFTA 2PO3A 2D66A 1KMJA 2GMUA 2YCTA 4EB7A 1S0AA 3BB8A 2D64A 4UQVA 3WKRA 4XJMA 1Y4IA 4IXSA 2VMZA 3E2YA 4LC3A 3GZDA 1GC4A 2HOZA 2AY6A 4W8IA 3CQ4A 3P1TA 3AENB 1SZSA 3EUCA 4A00A 1JG8A 4EMYA 5DX5A 3FTBA 4B98A 8AATA 3NYTA 1JS6A 2Q7WA 3DU4A 3EI8A 4XQ2A 1DJ9A 4Q31A 1RVYA 4Y0IA 3AEJC 1UU1A 2VI8A 3B1CA 1EG5A 5EUDA 1H1CA 3HLMA 2VMPA 2QA3A 4GRXA 3AEJA 2BI1A 2VGZA 2ZY3A 1CZCA 2VGSA 3MKJA 2C7TA 4DBCA 3BV0A 5J8QA 4K2MA 3ISLA 1ASGA 4BQ0A 2YHKA 1UU2A 2OATA 4UHMA 1B8GA 3DR7A 2BKWA 3PD6B 3RBLA 1Z3ZA 2YCPA 3FDBA 3CAIA 1P3WA 1TASA 2BI9A 1T3IA 1X29A 1WKGA 3CQ5A 4W5KA 4WXBA 3WLXA 4A6UA 2AY2A 1GBNA 5G2QA 4BHDA 3B1DA 2QLRA 5BJ4A 1XI9A 3MEBA 1ASFA 4WYDA 3JWAA 4GE4A 1O69A 1I43A 1MAQA 1MLZA 1V72A 1JS3A 4E1OA 4GEBA 1ASCA 1EQBA 2JGTA 4RKDA 3MADA 2ZYJA 2VMNA 3EI6A 2RFVA 3GSBA 2AY8A 4BMKA 3AOVA 3BCXA 3HL2A 4P7YA 3RBFA 2D61A 2GMSA 1B5PA 3B8XA 3KGXA 3FCRA 4CBSA 2DR1A 3UAKA 2Z9XA 4F5JA 1DJEA 2WK8A 3HQTA 3K28A 3MBBA 3DYDA 4CXRA 3NNKA 4ZSYA 1X2AA 1W3UA 4GE9A 4I8AA 1ECXA 2CANA 2Z61A 4BA4A 2CH1A 3LVMA 3WY7A 3A9XA 2VI9A 3NU7A 5IWQA 3E9KA 3HDOA 3I5TA 1UU0A 4IYOB 5DB5A 1ARHA 3FSLA 1AIAA 1LC7A 2BWOA 2XH1A 1I48A 4PVFA 3LG0A 2YKVA 3RCHA 3GBXA 3KKIA 4MQPA 5M49A 1FG3A 1BJNA 2CSTA 1M0QA 3H7FA 2O7CA 4ITXA 2AATA 3EIAA 4MKJA 9AATA 1YJSA 2BIEA 2QBTA 1B5OA 1IX6A 1KKPA 2WK9A 3GETA 4AH3A 5C6UA 1AAMA 1S06A 1ASBA 5EUEA 1MGVA 2TPLA 3AOWA 1SF2A 1LKCA 4W1XA 1ASDA 3RI6A 1AX4A 2YRIA 1AMAA 1D7RA 3ECDA 2HORA 1GC0A 3KE3A 3JTXA 3LVKA 3PD6A 3NTJA 1TOJA 3AV7A 4ADDA 2BI5A 2VGWA 3TFUA 3GJUA 4WXGA 1E5EA 4ADBA 3EI7A 4A0GA 2R5CA 3EIBA 1AHEA 5M4BA 2W7LA 3A2BA 4KXKA 3UE8A 2QMAA 3DR4A 3F6TA 5G4IA 2QB3A 1M7YA 5FT4A 3QBOA 3WZFA 4AZKA 1QGNA 4Q75A 1I29A 2EGYA 3ZRRA 2JG2A 1M6SA 1GDEA 3N5MA 1M32A 2YKUA 2ZY5A 4IXOA 2GB3A
chains in the Genus database with same CATH superfamily
3H0MC 2JE5A 2ZC0A 5AV9D 1P3AC 3W97D 4U1TA 2CV5B 2BIAA 4KYOA 1O61A 2AY3A 3WKJA 3AZGD 1WYTA 3B0CT 4N0WA 3UT9C 1IBJA 2BG1A 1P34C 4E3RA 4JEZA 2BWNA 1TOIA 5B0YA 2C0RA 5B31A 1RV3A 5BS7A 5AV5B 4J5UA 4CAYA 1G4XA 1VP4A 3FVUA 3A8UX 4TMRA 4H63Q 1N8PA 3A6NA 3B0DB 4DQYB 3K40A 4LNMA 3AZEC 3REHB 3AN2A 4F5HA 5JRGA 5B24D 4IX8A 5C3IB 4KUDC 1J32A 5BJ3A 4CSRA 2W7KA 1BQDA 4WU9D 5CP6B 3AYWB 2PYOD 1X28A 5F99D 4YS3C 3A1IA 4B9BA 1AOIB 1X0MA 3QHXA 3W98D 2ZSMA 3W99B 3BWNC 1KL1A 5FT8A 2W8UA 3TU4D 5B2JD 4KUDA 1D7SA 2CH2A 4LNLA 3X1SB 1ARSA 3KXBA 3DXVA 1EJIA 3ZZJA 3JWBA 3AENA 4GSAA 3REHC 1V2EA 1B4XA 1M1AB 3N4XA 3E77A 4ZDPA 2YKXA 1S08A 2CB1A 2VMWA 3F9TA 3PJ0A 4ISYA 5I92A 1AAWA 1T3UA 2NQBD 5AY8B 5AV6D 3RCHB 4MQRA 1RVUA 2NZDD 5AV9A 1P3IC 2DOUA 3AZID 1MDXA 3DRDA 3TU4C 5G49B 1S07A 4LW4A 4H9PA 3DZZA 2O0RA 2FNUA 1EQZB 2C44A 3REKB 4XJPA 4Q76A 5BNVA 5M4DA 2YFVA 1Z7DA 2HUUA 5F9SA 1TZYC 4Z2MH 1ELQA 5B33D 2Z1YA 3PIUA 1F66D 4PFFA 3ELPA 4NFTA 5B24C 3AZJD 3ASBA 1DGDA 3G7QA 5JRGB 2Z20A 3MNNA 4EB5A 5B24A 3REHA 3WTPC 5B1LC 1CL1A 1PG8A 2JJHA 7AATA 4K05A 2BI2A 3EPKA 2BHXA 4RJ0A 4H9NA 1VEFA 1GC3A 4FL0A 4LD9B 4X23D 5F99B 3TCMA 4AZJA 1D7VA 3AZFB 1P34D 3C1BC 2BYJA 5B31B 4TN4A 4OCAA 2W8VA 4QGRA 3R4TA 2HP1A 2YRRA 3MGRD 1V2DA 1YIZA 3AZKB 4JJNA 5EFSA 2VMUA 3MAUA 1TOEA 4R8PA 2OGEA 5E5IA 1AMQA 3TU4A 4ZBJC 1P3MB 4GE7A 2IO5C 5AV9C 2DGMA 5AVCD 2W8TA 1ASAA 3EZSA 3MGSD 4F5GA 4UHOA 3MGQA 2RVQC 2GSAA 2VGUA 2NQBC 4CBRA 1YAAA 3B6GD 4ZUXC 1GC2A 3DODA 1TOGA 1TPLA 1OXOA 3ZRPA 3DC1A 3FZ7A 1W7MA 4HGAC 5B1MD 4H9SA 3AN2C 3AZGB 5AV6B 2IO5B 1VJOA 1ZODA 2D63A 3WGCA 2NZDA 1P3BD 3X1VA 1P3OB 1DGEA 3W96B 2V0YA 4J8UA 3LZ0C 2NMPA 1MDZA 3W99D 1TZYB 4XUJA 4UUZA 4XJOA 3WCOA 2Y2GA 3AYWA 2VIBA 4ZDLA 1KX3C 2NQBB 3W99C 4WU9C 3PDBB 3W97A 1TARA 3WKJC 3FRKA 4W91A 4ATPA 3MC6C 3AN2B 1P3IA 4LD9A 4BA5A 3AZGA 4H9NB 5B32D 3L8AA 4XJMA 3HT4A 4X23A 2AY6A 3P1TA 5B31D 2JSSA 3EUCA 5DX5A 3B6GC 3EI8A 1DJ9A 4Q31A 2G5IC 3AEJC 2VI8A 3B1CA 4GRXA 3WKJB 2QA3A 2OKJA 3X1SD 4K2MA 5JRGD 3AZLD 2YFVB 2YCPA 1TASA 2BI9A 1T3IA 4YM6A 3WLXA 3AZJC 3AZKA 4BHDA 3B1DA 2QLRA 1O69A 1MLZA 5G49A 3REKC 1EQBA 2FJ7A 5F99A 3JZLA 4P7YA 2D61A 3B8XA 4CBSA 1KX4A 4GE9A 5CPIA 3KUYB 2Z61A 2YFWA 1P3AB 3R45B 2F8NA 2BYMA 4IYOB 2XH1A 3LG0A 3KKIA 4M6BA 3WAAB 2CSTA 3AZHC 3EIAA 3C1CA 2WK9A 5KDMB 3AZIB 1ASBA 3C1BB 3REKA 1ASDA 4H9OB 1AX4A 4RIZA 1P3GB 3I16A 3LVKA 1TOJA 4ADDA 2BI5A 2R5CA 2W7LA 3A2BA 4KXKA 5G4IA 5GSUB 1M7YA 3WZFA 1P3ID 5E5AA 1M6SA 5B2JC 1ZLAA 5BS7C 2FJ7C 3G0TA 3B6GB 1ASMA 4WYGA 1LW5A 1M1AA 4ZUXB 5B33A 4OBVA 3II0A 3BS8A 2VMOA 3WTPB 3REIC 2ZJGA 2EZ1A 3W96D 4CVQA 1AY4A 3FVSA 1TAFA 4ZSWA 3A9YA 3AZIC 3X1SA 5GT3C 2HIOD 3OP7A 5DNMA 3N0LA 3KWQC 1PMMA 4F5FA 3RUYA 3GR9A 3KFUG 4JEWA 3TATA 3AZKD 4M2MA 2DKJA 4OTLA 2Y2QA 4HVKA 3X1TB 3NQJA 2W7MA 2CJGA 4YS3D 3NUIA 2VGTA 4F5KA 1HQ3B 1OATA 4JJND 2VYCA 1SFFA 3IHJA 3LJAB 4F5MA 3LZ0B 1QJ3A 2VMYA 3RELD 4RM1A 1BT4A 3AV1D 4X23B 3H0LC 4PIWA 2FQ6A 3W98C 2R2NA 4R5ZA 3MGSA 5CPJC 4KHAB 3MGQD 1LC5A 1IUGA 4DRAA 3N7NA 3B6GA 2BI3A 2HUIA 3MVDD 3WA9A 3LZ0A 3R9AA 3EG5B 3X1UA 1ZLAB 4J8VB 5E4ZA 4E44A 1P3FD 1AKAA 3GZCA 1MLYA 2Z9VA 3LV2A 4CXQA 3NQJB 1AMSA 3FZ6A 3VH5W 4R8PB 3AFAC 1W7LA 1BS0A 1BW0A 3UTAA 2W7IA 3K7YA 2KFPA 3CBFA 3GWPA 2W7FA 5GT0D 2EZ2A 4WNNB 4WU8A 1O62A 3REIB 2J8PA 3AV2A 1BQAA 3LVLB 5G2PA 2CFBA 3WTPD 2ORDA 2AEVA 3H0RC 4R8DA 3PAAA 1IAYA 3R45A 2DGLA 2F8NK 1KX5A 3KUYD 2CWEA 1ZLAC 3VK3A 5AVBB 2HIOA 2Y2MA 4J8XB 1B9IA 5DNMD 5B0ZC 4WXFA 4OC9A 4P3MA 3W1IA 4ZWVA 1WYUB 5GT3D 3A6NC 4WYCA 2UWXA 4R8PC 3AFAB 1DFOA 1DTYA 2BIGA 5B40B 1U35A 5BT1D 1HQ3D 5DNNB 3OKSA 4QLCB 1B6WA 4JJNB 3AEPA 2C81A 4Q6RA 1H3OA 2E7JA 1LS3A 3C1BA 1M18B 4KGCD 3FVXA 3VAXA 1P3GC 3RELA 1AY5A 4WB0A 4EFFA 5G0AA 1WYVB 4BQ0A 1KMKA 4UHNA 2FNIA 1WSTA 2ZSLA 2JJEA 4ZWMA 4WYFA 1GCKA 2AY7A 1AHFA 1A7WA 3E2FA 2E7UA 2F8NB 1P3LB 4RITA 3WKSA 2YOBA 5B2IA 5KTBA 2DF4C 3TQXA 4YM6C 1KX4B 2PYOC 1B67A 4K2BA 5BO0A 4E77A 2FM1A 1S32B 3AV2B 2JJFA 2WK7A 4WP0A 4Z66D 3KXBB 4WLHA 4MSOA 1QIRA 2ZY2A 2PB2A 1FC4A 1P3GA 3RQ1A 3FD0A 2Y2KA 3N75A 2JCHA 3UTAD 2OKKA 1W7NA 3B46A 1AJRA 3B6FD 1WYUA 4JEVA 1ARTA 3O62D 4ZM3A 1CS1A 4WD2A 3VP6A 1D2FA 5DJ1A 1CZEA 3BCBA 1CQ8A 4Z5TD 4JF1A 5B2IB 2CY8A 3KUYA 2PYOB 5CPJD 4LW2A 3VH6W 4NE5A 3BC8A 3HMUA 2CV5C 1DJUA 2E7IA 2QSRA 3KXBC 1KL2A 3ACZA 1ASNA 3BWOA 1QITA 3RELB 1TATA 3AZFC 4J8UC 1BH9B 3REJA 3UT9D 4E3QA 4J8VD 3MGQC 1HQ3A 3WGBA 5HXXA 3AZEA 3LVJA 3B0BA 1P3MC 3TFTA 3W98B 1KMJA 1AOIA 3AZND 4EB7A 3AFAA 4G91B 3BB8A 5AV8D 1Y4IA 3X1TA 2VMZA 3E2YA 3TU4B 2HOZA 3IP4C 2CV5A 4H9SC 3CQ4A 1ULYA 5JA4B 3EPLA 2Q7WA 3DU4A 4EO5B 4XQ2A 1BH9A 1UU1A 1KAFA 1H1CA 2VMPA 3AZFA 2BYKB 2VQRA 1CZCA 2C7TA 4DBCA 1TAFB 5J8QA 3ISLA 1ID3D 3W1HA 2OATA 4XZQD 4UHMA 1B8GA 3FDBA 3CAIA 1WKGA 3USFA 4A6UA 5B33B 3CQ5A 4ZUXA 3MNNB 2BYKA 3MEBA 4WYDA 3JWAA 2HIOC 3WCNA 1V72A 4E1OA 4GEBA 4RKDA 2VMNA 4DRBA 3GSBA 2F8NH 3B0CW 3AOVA 5B1LB 4BMKA 2RIQA 5B1MB 3W96C 1B5PA 5GSUA 4F5JA 3HQTA 1P3PD 4ZSYA 1X2AA 1Z2CB 4UUZB 4I8AA 2CH1A 3WA9D 2VI9A 3HDOA 1UU0A 4J8XC 5DNMB 1ARHA 1M19C 1AIAA 4PVFA 1P3FA 1BJNA 4AWLC 4MKJA 2NZDB 3MGSC 5CPJA 1BH8B 3GETA 1IX6A 4KHAA 4AH3A 5C6UA 1N1JA 1S06A 1JFIA 5EUEA 3AOWA 2PYOA 2HORA 3JTXA 3PD6A 1P3MD 4KGCB 2AROD 3REJD 3UT9A 4QLCD 2QB3A 3QBOA 1P3KC 1OXPA 2HUEC 4Z66B 3KXBD 2Z9WA 2X8UA 3AZMD 3UTAC 4ZASA 3GZDC 5DNNA 1M0OA 5JRGC 5GXQD 2VGVA 5GT3A 3X1SC 3FKDA 1Q9CA 2VMQA 3WAAA 5CPKC 4MQQA 2XD1A 1IAXA 3E2ZA 1C4KA 4J8XD 5D95A 5B31C 3MGRB 1AHYA 3BN1A 3B1EA 4KGCA 2HOXA 3ASAA 3F0HA 2EO5A 3EI9A 1FG7A 1LW4A 1TOKA 2Y2HA 3X1TC 4XJLA 1JFIB 3PA9A 2Y2JA 2HUEB 4O6ZA 2DGKA 3FDDA 4L0OA 1YJZA 3AV2C 4F5LA 1BJWA 2D5YA 1V2FA 1P3BB 1OHYA 4M2KA 5B2ID 4J8WC 1TZYD 3FQ7A 2YCNA 1SVVA 1KX3D 4KUDB 4DQ6A 5FUGA 4YM6B 1KX4C 1GD9A 1WYTB 1QJ5A 3VK2A 2FN6A 1SPAA 5M46A 1AKCA 3WKJD 1ARIA 3LELC 3AL0C 3JW9A 1W23A 1G7WA 3UT9B 4XZQB 1AJSB 5AVBA 4WU8C 5B0YD 1MDOA 1P34A 1BFMA 1JF9A 3QI6A 3MAFB 5G4JA 3MNND 3I4JA 1R4VA 3B6FA 4IXZA 3LZ1A 5B32B 1P3IB 3LZ1C 3A6NB 3UTBA 3EPHA 1C7GA 5B0YC 2WKAA 2F2AC 1YIYA 3L44A 3NRAA 5AV8B 4UPKA 2FJ7B 4CAYB 3QPGA 5EUNA 2AY4A 2F8JA 3AELA 2ZY4A 3X1UC 2HZPA 1B9HA 2VMTA 2G6WA 4Y0DA 5JA4A 4WU9A 1P3OD 3AN2D 4NE6A 5CPKB 4UOYA 1C7NA 4A6RA 5B1MC 3PGYA 1DKAA 2X5DA 1LK9A 3HBXA 5AVCA 3W98A 3WAAD 3MGPD 4XZQC 5B1MA 3MGRC 1P3FC 4J8UB 4J8VA 4AO9A 2CINA 1CQ6A 2ZM5A 1P3BA 4X23C 4EO5C 2VLFA 1SZKA 3X1TD 2OGAA 5JAYA 1S09A 2CV5D 1UKJA 5B1LD 3AZGC 3AEOA 1BJ4A 1AY8A 2DKBA 2Y2IA 2AROB 4XEWA 4WJ3C 4J8WB 2Y2NA 1M4NA 1H0CA 4Z2MG 3FZ8A 3X1VD 3AEMA 4H9QA 4EU1A 5BNXB 3FFHA 1BKGA 3AYWD 4J8VC 1N31A 3PDBA 3AV1C 4AWLB 1M18C 3QM2A 1KX3A 2NQBA 1RV4A 1M0PA 1WKHA 1U08A 1YOOA 4ZBJB 1OHWA 3ATHA 3AZHA 2BWPA 4XUJD 4M2JA 2R5CB 4A6TA 2ZP7A 1P3LC 2ZUKA 3KWQB 4H9OA 3AZKC 1IX8A 3REJB 3W97C 4ITGA 1P3AD 5GSUD 5KDMA 3AZIA 4Z5TC 1W2EA 3C1CB 3AV1B 5AV9B 2AROC 3FQAA 2VIAA 1P3KA 3O62C 1CJ0A 1AKBA 2VMVA 5B24B 2JJGA 5TF5A 3LY1A 1G7XA 1PMOA 3UTBD 4G92C 1GEXA 4W1VA 3REHD 4ZAHA 5K8BA 2VLHA 3LWSA 1F66A 3BCAA 5AV6C 5AV5D 5G09A 3NX3A 2D65A 4F5IA 3MC6A 1WYVA 4OYTA 1HTAA 3LELD 1P3FB 1P3MA 5CP6D 3P5JB 3Q8NA 3ZRQA 4YM6D 2EYQA 4QLCA 4R8PD 3C1CC 2FYFA 1G4VA 3CQ6A 4AO4A 5AY8C 5B32G 2FJ7D 2V1PA 5EAAA 4AOAA 4ZDOA 2AY9A 4MY5A 1OHVA 3NYSA 3UWCA 4A72A 5B1LA 1KX3B 5DNND 2Z9UA 4G92B 2AEUA 3KUYC 2PO3A 2GMUA 2YCTA 2XD5A 2D64A 3WKRA 4H9RA 4LC3A 1GC4A 5CP6C 3AENB 4A00A 1JG8A 4B98A 8AATA 3AZHD 4WNNA 4WU8B 5CPKD 5B0YB 3AZJB 5DNMC 2VGZA 3REKD 2ZY3A 2VGSA 3MKJA 5AVBC 5E5AD 1ASGA 3W99A 1UU2A 2YHKA 1ZLAD 3DR7A 5AVCB 1Z3ZA 1GBNA 5BJ4A 1XI9A 1M1AD 1ASFA 4XUJC 1I43A 1MAQA 1TZYA 2JGTA 3V9RB 4J8UD 3MADA 2F8NG 2RFVA 1P3KD 2AY8A 3W96A 4JJNC 2GMSA 5C3IC 3FCRA 2DR1A 3UAKA 2Z9XA 1DJEA 3DYDA 5GT0B 3X1VC 2W8SA 5B32A 1ECXA 2CANA 4BA4A 3WY7A 3A9XA 1N1JB 3AZLC 5IWQA 5AVBD 3I5TA 5B32C 1AOIC 5AV5A 3RELC 1LC7A 1I48A 4MQPA 4LD9D 1FG3A 1M0QA 3LJAA 2O7CA 2AATA 9AATA 1YJSA 2BIEA 3AYWC 2QBTA 3LZ1D 3NQUB 1KKPA 1B5OA 3REID 1AAMA 2TPLA 1S32C 3MGPC 3WAAC 4W1XA 4XUJB 2G7JA 3RI6A 2YRIA 1GC0A 3KE3A 4WXGA 4ADBA 3KWQD 4CSRB 3EI7A 1P3OC 1AHEA 2QMAA 3F6TA 1P3OA 4RLGA 5FT4A 1QGNA 3X1VB 1I29A 2JG2A 2FKIA 1M32A 2YKUA 4OT8A 3AZLA 3AZNB 3MVDA 3UTBB 5AY8D 2R0TA 3A1KA 1ZOBA 3MGPA 5BO0B 2Y2OA 1O4SA 4IW7A 1M0NA 4K2IA 4NOGA 3O62B 4H9RB 1KX4D 4E45A 5CPID 3ELEA 5B40C 2R5EA 4WYAA 1C9CA 4WYEA 5DNNC 4JF0A 5B2IC 4J8WD 3MNNC 3WTPE 1ZC9A 4Z5TB 3X1UD 5AV5C 4NE3A 3V9RA 5E5AB 5FT6A 4ADCA 3E2ZB 1KKJA 2HP2A 3B0DC 3AATA 3NYUA 1KU5A 3LELB 3C1CD 4FFCA 5GT3B 1HQ3C 2F8ND 3FQ8A 1M19A 1EQZA 5FUGB 1XEYA 2OQXA 1CQ7A 1EQZC 5B40A 4RJYA 4XAUA 4A0FA 2EH6A 4WU8D 3AV2D 5GSUC 1CL2A 1AICA 2YKYA 3WTPA 1AMRA 2BYMB 4WBTA 4ADEA 3EI5A 1P3AA 1KX5D 3AZMC 2W7EA 1ASEA 4ZLVA 3ZZKA 3E6GA 1U35C 2Y2LA 5B0ZB 4DGTA 1P3KB 1BH8A 3C1BD 3REIA 1AHGA 3N4SA 4MKKA 4RKCA 2HUFA 1BJOB 1U35D 4ATQA 3HVYA 2X3LA 3KWQA 3VOMA 1IJIA 4GDYA 1KX5C 1C0NA 5EQCA 3BWNA 1N2TA 1ASLA 2W8JA 3LELA 5AX8A 2CJHA 3AZHB 2WB6A 4WLJA 4Z66C 1F66C 5CP6A 1S32A 3NQUA 5AY8A 3MVDC 3AZMB 3D6KA 3VK4A 1PFFA 3LJAC 3KGWA 5BNXA 2D7YA 5FT5A 4J8WA 4YS3A 1IX7A 1P3PC 5EIGB 4G91C 4Y0HA 1ID3B 5E3KA 5CPJB 2L5AA 3AV1A 1IVRA 4WB0B 1ARGA 2E54A 4IY7A 2CTZA 2GQNA 4LNJA 4QLCC 1P3BC 3REJC 3W97B 2A1VA 1P3GD 3N4RA 3QGUA 5F8VA 1LC8A 3FFRA 1M19D 2G5HC 4OMAA 3QN6A 2W7HA 3AEMC 2Z1ZA 1ELUA 2HOYA 5BT1C 1J04A 4ZM4A 1P3PB 1ORDA 1QZ9A 2VMRA 5CPKA 3VH6T 3LZ0D 3T32A 1WWSA 5F99C 2X5FA 3AZEB 4WU9B 2AY1A 1D7UA 4H51A 2RVQD 3NU8A 2JISA 2HIOB 1C7OA 1F1EA 1SZUA 3EZ1A 3NDNA 5AVCC 1QISA 5HDMA 1AIBA 3VH5T 3AZNC 5EIGA 3LZ1B 4JEXA 3G8MA 3PDXA 4YS3B 3EPJA 1GEYA 1I41A 3AZLB 3AZNA 4HF8A 5GT0A 1AHXA 5D5SA 1GEWA 5GT0C 1AJSA 2PB0A 5B2JA 2BYLA 4KUDD 5DJ9A 3A9ZA 1AOID 4PFNA 2W8WA 5AV8C 5GXQB 5EAVA 2W7GA 2EPJA 4KAMA 5B2JB 2D7ZA 3LJAD 3VH6A 4JEYA 4A0HA 3X1UB 1MAPA 4ZUXD 1BJOA 3WA9B 5HHYA 1YJYA 3W1JA 5CHLB 4XK1A 3H9XA 3M5UA 3P6KA 2XBNA 1ID3A 5AV6A 1M1AC 2VMSA 2W7JA 5B0ZA 2O1BA 2W7DA 4IYOA 3COGA 3MAFA 4A0RA 2YFWB 4RAEA 3DXWA 4R5FA 5CPIB 4U2HA 1P3LA 3MGQB 1E5FA 3PPLA 2VMXA 3NUBA 4W1WA 1YNUA 2CJDA 1P3PA 4R2NA 5GXQC 3B6FC 3WX9A 1M18A 2QB2A 2AY5A 2D66A 1S0AA 4J8LA 4UQVA 4IXSA 3GZDA 3AZJA 1PZRA 4W8IA 5E5AC 4OBUA 4WV4B 1SZSA 4EMYA 4Z66A 3FTBA 2NZDC 3NYTA 1JS6A 1RVYA 4Y0IA 1EG5A 5EUDA 3HLMA 5B33C 3AEJA 1EQZD 2BI1A 3BV0A 4Z5TA 5B40D 5CPIC 2BKWA 3PD6B 3RBLA 1KX5B 1P3WA 3MGRA 1X29A 4F4EA 3A6ND 3O62A 4W5KA 4WXBA 2AY2A 5G2QA 2AROA 3AZMA 2Y2PA 4GE4A 3MGPB 1JS3A 1ASCA 2ZYJA 3EI6A 3MVDB 3BCXA 3HL2A 3RBFA 3KGXA 5BNVB 5B31G 1H3OB 2WK8A 3K28A 3MBBA 4CXRA 3UTAB 3NNKA 3WA9C 1M19B 1W3UA 1U35B 4H9PB 3AZED 3LVMA 5GXQA 3UTBC 1ID3C 3NU7A 3E9KA 3KSYA 5DB5A 1WWIA 4HGAB 3FSLA 2BWOA 3VH5A 2YKVA 3RCHA 3GBXA 4LD9C 1F66B 5M49A 4J8XA 3H7FA 4ITXA 5B0ZD 2LY8A 3AFAD 4KGCC 5AV8A 1MGVA 4H9QB 1SF2A 1LKCA 1P3LD 1AMAA 1D7RA 3ECDA 1S32D 3MGSB 3AV7A 3NTJA 4WZSB 2VGWA 3TFUA 3GJUA 3B6FB 1E5EA 4A0GA 3EIBA 5M4BA 2FFFB 2DQNC 3UE8A 3DR4A 3AZFD 1P34B 4AZKA 4Q75A 3ZRRA 2EGYA 1GDEA 3N5MA 1M18D 4XZQA 2ZY5A 4IXOA 2GB3A
chains in the Genus database with same CATH topology
3H0MC 2JE5A 2ZC0A 5AV9D 1P3AC 3W97D 4U1TA 2CV5B 2BIAA 4KYOA 1O61A 2AY3A 3WKJA 3AZGD 1WYTA 3B0CT 4N0WA 3UT9C 1IBJA 2BG1A 1P34C 4E3RA 4JEZA 2BWNA 1TOIA 5B0YA 2C0RA 5B31A 1RV3A 5BS7A 5AV5B 4J5UA 4CAYA 1G4XA 1VP4A 3FVUA 3A8UX 4TMRA 4H63Q 1N8PA 3A6NA 3B0DB 4DQYB 3K40A 4LNMA 3AZEC 3REHB 3AN2A 4F5HA 5JRGA 5B24D 4IX8A 5C3IB 4KUDC 1J32A 5BJ3A 4CSRA 2W7KA 1BQDA 4WU9D 5CP6B 3AYWB 2PYOD 1X28A 5F99D 4YS3C 3A1IA 4B9BA 1AOIB 1X0MA 3QHXA 3W98D 2ZSMA 3W99B 3BWNC 1KL1A 5FT8A 2W8UA 3TU4D 5B2JD 4KUDA 1D7SA 2CH2A 4LNLA 3X1SB 1ARSA 3KXBA 3DXVA 1EJIA 3ZZJA 3JWBA 3AENA 4GSAA 3REHC 1V2EA 1B4XA 1M1AB 3N4XA 3E77A 4ZDPA 2YKXA 1S08A 2CB1A 2VMWA 3F9TA 3PJ0A 4ISYA 5I92A 1AAWA 1T3UA 2NQBD 5AY8B 5AV6D 3RCHB 4MQRA 1RVUA 2NZDD 5AV9A 1P3IC 2DOUA 3AZID 1MDXA 3DRDA 3TU4C 5G49B 1S07A 4LW4A 4H9PA 3DZZA 2O0RA 2FNUA 1EQZB 2C44A 3REKB 4XJPA 4Q76A 5BNVA 5M4DA 2YFVA 1Z7DA 2HUUA 5F9SA 1TZYC 4Z2MH 1ELQA 5B33D 2Z1YA 3PIUA 1F66D 4PFFA 3ELPA 4NFTA 5B24C 3AZJD 3ASBA 1DGDA 3G7QA 5JRGB 2Z20A 3MNNA 4EB5A 5B24A 3REHA 3WTPC 5B1LC 1CL1A 1PG8A 2JJHA 7AATA 4K05A 2BI2A 3EPKA 2BHXA 4RJ0A 4H9NA 1VEFA 1GC3A 4FL0A 4LD9B 4X23D 5F99B 3TCMA 4AZJA 1D7VA 3AZFB 1P34D 3C1BC 2BYJA 5B31B 4TN4A 4OCAA 2W8VA 4QGRA 3R4TA 2HP1A 2YRRA 3MGRD 1V2DA 1YIZA 3AZKB 4JJNA 5EFSA 2VMUA 3MAUA 1TOEA 4R8PA 2OGEA 5E5IA 1AMQA 3TU4A 4ZBJC 1P3MB 4GE7A 2IO5C 5AV9C 2DGMA 5AVCD 2W8TA 1ASAA 3EZSA 3MGSD 4F5GA 4UHOA 3MGQA 2RVQC 2GSAA 2VGUA 2NQBC 4CBRA 1YAAA 3B6GD 4ZUXC 1GC2A 3DODA 1TOGA 1TPLA 1OXOA 3ZRPA 3DC1A 3FZ7A 1W7MA 4HGAC 5B1MD 4H9SA 3AN2C 3AZGB 5AV6B 2IO5B 1VJOA 1ZODA 2D63A 3WGCA 2NZDA 1P3BD 3X1VA 1P3OB 1DGEA 3W96B 2V0YA 4J8UA 3LZ0C 2NMPA 1MDZA 3W99D 1TZYB 4XUJA 4UUZA 4XJOA 3WCOA 2Y2GA 3AYWA 2VIBA 4ZDLA 1KX3C 2NQBB 3W99C 4WU9C 3PDBB 3W97A 1TARA 3WKJC 3FRKA 4W91A 4ATPA 3MC6C 3AN2B 1P3IA 4LD9A 4BA5A 3AZGA 4H9NB 5B32D 3L8AA 4XJMA 3HT4A 4X23A 2AY6A 3P1TA 5B31D 2JSSA 3EUCA 5DX5A 3B6GC 3EI8A 1DJ9A 4Q31A 2G5IC 3AEJC 2VI8A 3B1CA 4GRXA 3WKJB 2QA3A 2OKJA 3X1SD 4K2MA 5JRGD 3AZLD 2YFVB 2YCPA 1TASA 2BI9A 1T3IA 4YM6A 3WLXA 3AZJC 3AZKA 4BHDA 3B1DA 2QLRA 1O69A 1MLZA 5G49A 3REKC 1EQBA 2FJ7A 5F99A 3JZLA 4P7YA 2D61A 3B8XA 4CBSA 1KX4A 4GE9A 5CPIA 3KUYB 2Z61A 2YFWA 1P3AB 3R45B 2F8NA 2BYMA 4IYOB 2XH1A 3LG0A 3KKIA 4M6BA 3WAAB 2CSTA 3AZHC 3EIAA 3C1CA 2WK9A 5KDMB 3AZIB 1ASBA 3C1BB 3REKA 1ASDA 4H9OB 1AX4A 4RIZA 1P3GB 3I16A 3LVKA 1TOJA 4ADDA 2BI5A 2R5CA 2W7LA 3A2BA 4KXKA 5G4IA 5GSUB 1M7YA 3WZFA 1P3ID 5E5AA 1M6SA 5B2JC 1ZLAA 5BS7C 2FJ7C 3G0TA 3B6GB 1ASMA 4WYGA 1LW5A 1M1AA 4ZUXB 5B33A 4OBVA 3II0A 3BS8A 2VMOA 3WTPB 3REIC 2ZJGA 2EZ1A 3W96D 4CVQA 1AY4A 3FVSA 1TAFA 4ZSWA 3A9YA 3AZIC 3X1SA 5GT3C 2HIOD 3OP7A 5DNMA 3N0LA 3KWQC 1PMMA 4F5FA 3RUYA 3GR9A 3KFUG 4JEWA 3TATA 3AZKD 4M2MA 2DKJA 4OTLA 2Y2QA 4HVKA 3X1TB 3NQJA 2W7MA 2CJGA 4YS3D 3NUIA 2VGTA 4F5KA 1HQ3B 1OATA 4JJND 2VYCA 1SFFA 3IHJA 3LJAB 4F5MA 3LZ0B 1QJ3A 2VMYA 3RELD 4RM1A 1BT4A 3AV1D 4X23B 3H0LC 4PIWA 2FQ6A 3W98C 2R2NA 4R5ZA 3MGSA 5CPJC 4KHAB 3MGQD 1LC5A 1IUGA 4DRAA 3N7NA 3B6GA 2BI3A 2HUIA 3MVDD 3WA9A 3LZ0A 3R9AA 3EG5B 3X1UA 1ZLAB 4J8VB 5E4ZA 4E44A 1P3FD 1AKAA 3GZCA 1MLYA 2Z9VA 3LV2A 4CXQA 3NQJB 1AMSA 3FZ6A 3VH5W 4R8PB 3AFAC 1W7LA 1BS0A 1BW0A 3UTAA 2W7IA 3K7YA 2KFPA 3CBFA 3GWPA 2W7FA 5GT0D 2EZ2A 4WNNB 4WU8A 1O62A 3REIB 2J8PA 3AV2A 1BQAA 3LVLB 5G2PA 2CFBA 3WTPD 2ORDA 2AEVA 3H0RC 4R8DA 3PAAA 1IAYA 3R45A 2DGLA 2F8NK 1KX5A 3KUYD 2CWEA 1ZLAC 3VK3A 5AVBB 2HIOA 2Y2MA 4J8XB 1B9IA 5DNMD 5B0ZC 4WXFA 4OC9A 4P3MA 3W1IA 4ZWVA 1WYUB 5GT3D 3A6NC 4WYCA 2UWXA 4R8PC 3AFAB 1DFOA 1DTYA 2BIGA 5B40B 1U35A 5BT1D 1HQ3D 5DNNB 3OKSA 4QLCB 1B6WA 4JJNB 3AEPA 2C81A 4Q6RA 1H3OA 2E7JA 1LS3A 3C1BA 1M18B 4KGCD 3FVXA 3VAXA 1P3GC 3RELA 1AY5A 4WB0A 4EFFA 5G0AA 1WYVB 4BQ0A 1KMKA 4UHNA 2FNIA 1WSTA 2ZSLA 2JJEA 4ZWMA 4WYFA 1GCKA 2AY7A 1AHFA 1A7WA 3E2FA 2E7UA 2F8NB 1P3LB 4RITA 3WKSA 2YOBA 5B2IA 5KTBA 2DF4C 3TQXA 4YM6C 1KX4B 2PYOC 1B67A 4K2BA 5BO0A 4E77A 2FM1A 1S32B 3AV2B 2JJFA 2WK7A 4WP0A 4Z66D 3KXBB 4WLHA 4MSOA 1QIRA 2ZY2A 2PB2A 1FC4A 1P3GA 3RQ1A 3FD0A 2Y2KA 3N75A 2JCHA 3UTAD 2OKKA 1W7NA 3B46A 1AJRA 3B6FD 1WYUA 4JEVA 1ARTA 3O62D 4ZM3A 1CS1A 4WD2A 3VP6A 1D2FA 5DJ1A 1CZEA 3BCBA 1CQ8A 4Z5TD 4JF1A 5B2IB 2CY8A 3KUYA 2PYOB 5CPJD 4LW2A 3VH6W 4NE5A 3BC8A 3HMUA 2CV5C 1DJUA 2E7IA 2QSRA 3KXBC 1KL2A 3ACZA 1ASNA 3BWOA 1QITA 3RELB 1TATA 3AZFC 4J8UC 1BH9B 3REJA 3UT9D 4E3QA 4J8VD 3MGQC 1HQ3A 3WGBA 5HXXA 3AZEA 3LVJA 3B0BA 1P3MC 3TFTA 3W98B 1KMJA 1AOIA 3AZND 4EB7A 3AFAA 4G91B 3BB8A 5AV8D 1Y4IA 3X1TA 2VMZA 3E2YA 3TU4B 2HOZA 3IP4C 2CV5A 4H9SC 3CQ4A 1ULYA 5JA4B 3EPLA 2Q7WA 3DU4A 4EO5B 4XQ2A 1BH9A 1UU1A 1H1CA 2VMPA 3AZFA 2BYKB 2VQRA 1CZCA 2C7TA 4DBCA 1TAFB 5J8QA 3ISLA 1ID3D 3W1HA 2OATA 4XZQD 4UHMA 1B8GA 3FDBA 3CAIA 1WKGA 3USFA 4A6UA 5B33B 3CQ5A 4ZUXA 3MNNB 2BYKA 3MEBA 4WYDA 3JWAA 2HIOC 3WCNA 1V72A 4E1OA 4GEBA 4RKDA 2VMNA 4DRBA 3GSBA 2F8NH 3B0CW 3AOVA 5B1LB 4BMKA 2RIQA 5B1MB 3W96C 1B5PA 5GSUA 4F5JA 3HQTA 1P3PD 4ZSYA 1X2AA 1Z2CB 4UUZB 4I8AA 2CH1A 3WA9D 2VI9A 3HDOA 1UU0A 4J8XC 5DNMB 1ARHA 1M19C 1AIAA 4PVFA 1P3FA 1BJNA 4AWLC 4MKJA 2NZDB 3MGSC 5CPJA 1BH8B 3GETA 1IX6A 4KHAA 4AH3A 5C6UA 1N1JA 1S06A 1JFIA 5EUEA 3AOWA 2PYOA 2HORA 3JTXA 3PD6A 1P3MD 4KGCB 2AROD 3REJD 3UT9A 4QLCD 2QB3A 3QBOA 1P3KC 1OXPA 2HUEC 4Z66B 3KXBD 2Z9WA 2X8UA 3AZMD 3UTAC 4ZASA 3GZDC 5DNNA 1M0OA 5JRGC 5GXQD 2VGVA 5GT3A 3X1SC 3FKDA 1Q9CA 2VMQA 3WAAA 5CPKC 4MQQA 2XD1A 1IAXA 3E2ZA 1C4KA 4J8XD 5D95A 5B31C 3MGRB 1AHYA 3BN1A 3B1EA 4KGCA 2HOXA 3ASAA 3F0HA 2EO5A 3EI9A 1FG7A 1LW4A 1TOKA 2Y2HA 3X1TC 4XJLA 1JFIB 3PA9A 2Y2JA 2HUEB 4O6ZA 2DGKA 3FDDA 4L0OA 1YJZA 3AV2C 4F5LA 1BJWA 2D5YA 1V2FA 1P3BB 1OHYA 4M2KA 5B2ID 4J8WC 1TZYD 3FQ7A 2YCNA 1SVVA 1KX3D 4KUDB 4DQ6A 5FUGA 4YM6B 1KX4C 1GD9A 1WYTB 1QJ5A 3VK2A 2FN6A 1SPAA 5M46A 1AKCA 3WKJD 1ARIA 3LELC 3AL0C 3JW9A 1W23A 1G7WA 3UT9B 4XZQB 1AJSB 5AVBA 4WU8C 5B0YD 1MDOA 1P34A 1BFMA 1JF9A 3QI6A 3MAFB 5G4JA 3MNND 3I4JA 1R4VA 3B6FA 4IXZA 3LZ1A 5B32B 1P3IB 3LZ1C 3A6NB 3UTBA 3EPHA 1C7GA 5B0YC 2WKAA 2F2AC 1YIYA 3L44A 3NRAA 5AV8B 4UPKA 2FJ7B 4CAYB 3QPGA 5EUNA 2AY4A 2F8JA 3AELA 2ZY4A 3X1UC 2HZPA 1B9HA 2VMTA 2G6WA 4Y0DA 5JA4A 4WU9A 1P3OD 3AN2D 4NE6A 5CPKB 4UOYA 1C7NA 4A6RA 5B1MC 3PGYA 1DKAA 2X5DA 1LK9A 3HBXA 5AVCA 3W98A 3WAAD 3MGPD 4XZQC 5B1MA 3MGRC 1P3FC 4J8UB 4J8VA 4AO9A 2CINA 1CQ6A 2ZM5A 1P3BA 4X23C 4EO5C 2VLFA 1SZKA 3X1TD 2OGAA 5JAYA 1S09A 2CV5D 1UKJA 5B1LD 3AZGC 3AEOA 1BJ4A 1AY8A 2DKBA 2Y2IA 2AROB 4XEWA 4WJ3C 4J8WB 2Y2NA 1M4NA 1H0CA 4Z2MG 3FZ8A 3X1VD 3AEMA 4H9QA 4EU1A 5BNXB 3FFHA 1BKGA 3AYWD 4J8VC 1N31A 3PDBA 3AV1C 4AWLB 1M18C 3QM2A 1KX3A 2NQBA 1RV4A 1M0PA 1WKHA 1U08A 1YOOA 4ZBJB 1OHWA 3ATHA 3AZHA 2BWPA 4XUJD 4M2JA 2R5CB 4A6TA 2ZP7A 1P3LC 2ZUKA 3KWQB 4H9OA 3AZKC 1IX8A 3REJB 3W97C 4ITGA 1P3AD 5GSUD 5KDMA 3AZIA 4Z5TC 1W2EA 3C1CB 3AV1B 5AV9B 2AROC 3FQAA 2VIAA 1P3KA 3O62C 1CJ0A 1AKBA 2VMVA 5B24B 2JJGA 5TF5A 3LY1A 1G7XA 1PMOA 3UTBD 4G92C 1GEXA 4W1VA 3REHD 4ZAHA 5K8BA 2VLHA 3LWSA 1F66A 3BCAA 5AV6C 5AV5D 5G09A 3NX3A 2D65A 4F5IA 3MC6A 1WYVA 4OYTA 1HTAA 3LELD 1P3FB 1P3MA 5CP6D 3P5JB 3Q8NA 3ZRQA 4YM6D 2EYQA 4QLCA 4R8PD 3C1CC 2FYFA 1G4VA 3CQ6A 4AO4A 5AY8C 5B32G 2FJ7D 2V1PA 5EAAA 4AOAA 4ZDOA 2AY9A 4MY5A 1OHVA 3NYSA 3UWCA 4A72A 5B1LA 1KX3B 5DNND 2Z9UA 4G92B 2AEUA 3KUYC 2PO3A 2GMUA 2YCTA 2XD5A 2D64A 3WKRA 4H9RA 4LC3A 1GC4A 5CP6C 3AENB 4A00A 1JG8A 4B98A 8AATA 3AZHD 4WNNA 4WU8B 5CPKD 5B0YB 3AZJB 5DNMC 2VGZA 3REKD 2ZY3A 2VGSA 3MKJA 5AVBC 5E5AD 1ASGA 3W99A 1UU2A 2YHKA 1ZLAD 3DR7A 5AVCB 1Z3ZA 1GBNA 5BJ4A 1XI9A 1M1AD 1ASFA 4XUJC 1I43A 1MAQA 1TZYA 2JGTA 3V9RB 4J8UD 3MADA 2F8NG 2RFVA 1P3KD 2AY8A 3W96A 4JJNC 2GMSA 5C3IC 3FCRA 2DR1A 3UAKA 2Z9XA 1DJEA 3DYDA 5GT0B 3X1VC 2W8SA 5B32A 1ECXA 2CANA 4BA4A 3WY7A 3A9XA 1N1JB 3AZLC 5IWQA 5AVBD 3I5TA 5B32C 1AOIC 5AV5A 3RELC 1LC7A 1I48A 4MQPA 4LD9D 1FG3A 1M0QA 3LJAA 2O7CA 2AATA 9AATA 1YJSA 2BIEA 3AYWC 2QBTA 3LZ1D 3NQUB 1KKPA 1B5OA 3REID 1AAMA 2TPLA 1S32C 3MGPC 3WAAC 4W1XA 4XUJB 2G7JA 3RI6A 2YRIA 1GC0A 3KE3A 4WXGA 4ADBA 3KWQD 4CSRB 3EI7A 1P3OC 1AHEA 2QMAA 3F6TA 1P3OA 4RLGA 5FT4A 1QGNA 3X1VB 1I29A 2JG2A 2FKIA 1M32A 2YKUA 4OT8A 3AZLA 3AZNB 3MVDA 3UTBB 5AY8D 2R0TA 3A1KA 1ZOBA 3MGPA 5BO0B 2Y2OA 1O4SA 4IW7A 1M0NA 4K2IA 4NOGA 3O62B 4H9RB 1KX4D 4E45A 5CPID 3ELEA 5B40C 2R5EA 4WYAA 1C9CA 4WYEA 5DNNC 4JF0A 5B2IC 4J8WD 3MNNC 3WTPE 1ZC9A 4Z5TB 3X1UD 5AV5C 4NE3A 3V9RA 5E5AB 5FT6A 4ADCA 3E2ZB 1KKJA 2HP2A 3B0DC 3AATA 3NYUA 1KU5A 3LELB 3C1CD 4FFCA 5GT3B 1HQ3C 2F8ND 3FQ8A 1M19A 1EQZA 5FUGB 1XEYA 2OQXA 1CQ7A 1EQZC 5B40A 4RJYA 4XAUA 4A0FA 2EH6A 4WU8D 3AV2D 5GSUC 1CL2A 1AICA 2YKYA 3WTPA 1AMRA 2BYMB 4WBTA 4ADEA 3EI5A 1P3AA 1KX5D 3AZMC 2W7EA 1ASEA 4ZLVA 3ZZKA 3E6GA 1U35C 2Y2LA 5B0ZB 4DGTA 1P3KB 1BH8A 3C1BD 3REIA 1AHGA 3N4SA 4MKKA 4RKCA 2HUFA 1BJOB 1U35D 4ATQA 3HVYA 2X3LA 3KWQA 3VOMA 1IJIA 4GDYA 1KX5C 1C0NA 5EQCA 3BWNA 1N2TA 1ASLA 2W8JA 3LELA 5AX8A 2CJHA 3AZHB 2WB6A 4WLJA 4Z66C 1F66C 5CP6A 1S32A 3NQUA 5AY8A 3MVDC 3AZMB 3D6KA 3VK4A 1PFFA 3LJAC 3KGWA 5BNXA 2D7YA 5FT5A 4J8WA 4YS3A 1IX7A 1P3PC 5EIGB 4G91C 4Y0HA 1ID3B 5E3KA 5CPJB 2L5AA 3AV1A 1IVRA 4WB0B 1ARGA 2E54A 4IY7A 2CTZA 2GQNA 4LNJA 4QLCC 1P3BC 3REJC 3W97B 2A1VA 1P3GD 3N4RA 3QGUA 5F8VA 1LC8A 3FFRA 1M19D 2G5HC 4OMAA 3QN6A 2W7HA 3AEMC 2Z1ZA 1ELUA 2HOYA 5BT1C 1J04A 4ZM4A 1P3PB 1ORDA 1QZ9A 2VMRA 5CPKA 3VH6T 3LZ0D 3T32A 1WWSA 5F99C 2X5FA 3AZEB 4WU9B 2AY1A 1D7UA 4H51A 2RVQD 3NU8A 2JISA 2HIOB 1C7OA 1F1EA 1SZUA 3EZ1A 3NDNA 5AVCC 1QISA 5HDMA 1AIBA 3VH5T 3AZNC 5EIGA 3LZ1B 4JEXA 3G8MA 3PDXA 4YS3B 3EPJA 1GEYA 1I41A 3AZLB 3AZNA 4HF8A 5GT0A 1AHXA 5D5SA 1GEWA 5GT0C 1AJSA 2PB0A 5B2JA 2BYLA 4KUDD 5DJ9A 3A9ZA 1AOID 4PFNA 2W8WA 5AV8C 5GXQB 5EAVA 2W7GA 2EPJA 4KAMA 5B2JB 2D7ZA 3LJAD 3VH6A 4JEYA 4A0HA 3X1UB 1MAPA 4ZUXD 1BJOA 3WA9B 5HHYA 1YJYA 3W1JA 5CHLB 4XK1A 3H9XA 3M5UA 3P6KA 2XBNA 1ID3A 5AV6A 1M1AC 2VMSA 2W7JA 5B0ZA 2O1BA 2W7DA 4IYOA 3COGA 3MAFA 4A0RA 2YFWB 4RAEA 3DXWA 4R5FA 5CPIB 4U2HA 1P3LA 3MGQB 1E5FA 3PPLA 2VMXA 3NUBA 4W1WA 1YNUA 2CJDA 1P3PA 4R2NA 5GXQC 3B6FC 3WX9A 1M18A 2QB2A 2AY5A 2D66A 1S0AA 4J8LA 4UQVA 4IXSA 3GZDA 3AZJA 1PZRA 4W8IA 5E5AC 4OBUA 4WV4B 1SZSA 4EMYA 4Z66A 3FTBA 2NZDC 3NYTA 1JS6A 1RVYA 4Y0IA 1EG5A 5EUDA 3HLMA 5B33C 3AEJA 1EQZD 2BI1A 3BV0A 4Z5TA 5B40D 5CPIC 2BKWA 3PD6B 3RBLA 1KX5B 1P3WA 3MGRA 1X29A 4F4EA 3A6ND 3O62A 4W5KA 4WXBA 2AY2A 5G2QA 2AROA 3AZMA 2Y2PA 4GE4A 3MGPB 1JS3A 1ASCA 2ZYJA 3EI6A 3MVDB 3BCXA 3HL2A 3RBFA 3KGXA 5BNVB 5B31G 1H3OB 2WK8A 3K28A 3MBBA 4CXRA 3UTAB 3NNKA 3WA9C 1M19B 1W3UA 1U35B 4H9PB 3AZED 3LVMA 5GXQA 3UTBC 1ID3C 3NU7A 3E9KA 3KSYA 5DB5A 1WWIA 4HGAB 3FSLA 2BWOA 3VH5A 2YKVA 3RCHA 3GBXA 4LD9C 1F66B 5M49A 4J8XA 3H7FA 4ITXA 5B0ZD 2LY8A 3AFAD 4KGCC 5AV8A 1MGVA 4H9QB 1SF2A 1LKCA 1P3LD 1AMAA 1D7RA 3ECDA 1S32D 3MGSB 3AV7A 3NTJA 4WZSB 2VGWA 3TFUA 3GJUA 3B6FB 1E5EA 4A0GA 3EIBA 5M4BA 2FFFB 2DQNC 3UE8A 3DR4A 3AZFD 1P34B 4AZKA 4Q75A 3ZRRA 2EGYA 1GDEA 3N5MA 1M18D 4XZQA 2ZY5A 4IXOA 2GB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXP A;  2ZC0 A;  2R0T A;  2Z9W A;  4U1T A;  1ZOB A;  1ASM A;  1O4S A;  2X8U A;  4IW7 A;  4WYG A;  1LW5 A;  2BIA A;  1M0N A;  4KYO A;  4K2I A;  4ZAS A;  4NOG A;  1O61 A;  3GZD C;  3II0 A;  2AY3 A;  1M0O A;  3BS8 A;  2R5E A;  2VMO A;  1C9C A;  3ELE A;  4WYA A;  4WYE A;  2VGV A;  2ZJG A;  1WYT A;  4JF0 A;  2EZ1 A;  3FKD A;  4N0W A;  4CVQ A;  1ZC9 A;  1AY4 A;  2VMQ A;  3FVS A;  4ZSW A;  3USF A;  3A9Y A;  1IBJ A;  4MQQ A;  1IAX A;  4E3R A;  4JEZ A;  3E2Z A;  5FT6 A;  2BWN A;  1TOI A;  4ADC A;  2C0R A;  3OP7 A;  1RV3 A;  3E2Z B;  4J5U A;  1KKJ A;  1C4K A;  1G4X A;  2HP2 A;  3N0L A;  3AAT A;  4F5F A;  3NYU A;  5D95 A;  3RUY A;  3GR9 A;  1VP4 A;  4OT8 A;  3FVU A;  3A8U X;  4TMR A;  4JEW A;  1AHY A;  3BN1 A;  1N8P A;  4FFC A;  3TAT A;  3B1E A;  4M2M A;  2DKJ A;  2HOX A;  4OTL A;  3K40 A;  4HVK A;  3ASA A;  3F0H A;  4LNM A;  2EO5 A;  3FQ8 A;  3EI9 A;  2W7M A;  1FG7 A;  2OQX A;  1CQ7 A;  1LW4 A;  4F5H A;  1TOK A;  4RJY A;  2CJG A;  3NUI A;  4XJL A;  2VGT A;  3PA9 A;  4IX8 A;  4F5K A;  4XAU A;  1OAT A;  1J32 A;  2EH6 A;  4O6Z A;  4A0F A;  3FDD A;  4L0O A;  1YJZ A;  2VYC A;  1SFF A;  3IHJ A;  5BJ3 A;  4F5M A;  4F5L A;  1BJW A;  1QJ3 A;  2D5Y A;  2VMY A;  1V2F A;  2W7K A;  1BT4 A;  1BQD A;  1OHY A;  1CL2 A;  4M2K A;  1AIC A;  2YKY A;  3FQ7 A;  2YCN A;  1AMR A;  1SVV A;  4PIW A;  1X28 A;  2FQ6 A;  4DQ6 A;  4WBT A;  4ADE A;  3EI5 A;  4B9B A;  1GD9 A;  2W7E A;  1WYT B;  1QJ5 A;  1X0M A;  3VK2 A;  2R2N A;  4R5Z A;  1ASE A;  3QHX A;  4ZLV A;  2ZSM A;  3BWN C;  2FN6 A;  3ZZK A;  1KL1 A;  3E6G A;  1SPA A;  5FT8 A;  5M46 A;  1LC5 A;  1IUG A;  2W8U A;  1AKC A;  1D7S A;  1ARI A;  2CH2 A;  4DGT A;  2BI3 A;  2HUI A;  4LNL A;  1ARS A;  3JW9 A;  1W23 A;  1G7W A;  3DXV A;  3R9A A;  1AJS B;  1AHG A;  1EJI A;  3ZZJ A;  3JWB A;  5E4Z A;  4MKK A;  3AEN A;  4RKC A;  1MDO A;  4GSA A;  2HUF A;  1BJO B;  1JF9 A;  3QI6 A;  1AKA A;  1V2E A;  3MAF B;  1B4X A;  5G4J A;  3GZC A;  4ATQ A;  1MLY A;  2Z9V A;  3LV2 A;  3E77 A;  3I4J A;  2YKX A;  4ZDP A;  4CXQ A;  3VOM A;  4IXZ A;  1AMS A;  1IJI A;  4GDY A;  1S08 A;  2CB1 A;  1C0N A;  5EQC A;  3BWN A;  1N2T A;  2VMW A;  1ASL A;  3F9T A;  3PJ0 A;  1C7G A;  1W7L A;  2W8J A;  1BS0 A;  1BW0 A;  4ISY A;  2WKA A;  1YIY A;  5I92 A;  1AAW A;  5AX8 A;  2CJH A;  3L44 A;  3NRA A;  2W7I A;  4WLJ A;  3K7Y A;  3RCH B;  3CBF A;  4MQR A;  3QPG A;  2W7F A;  5EUN A;  1RVU A;  2AY4 A;  2F8J A;  3AEL A;  2EZ2 A;  1O62 A;  2DOU A;  2ZY4 A;  3D6K A;  1MDX A;  2HZP A;  3VK4 A;  1PFF A;  1B9H A;  3DRD A;  1BQA A;  2VMT A;  2G6W A;  3LVL B;  4Y0D A;  3KGW A;  1S07 A;  5G2P A;  2CFB A;  4LW4 A;  2ORD A;  4UOY A;  2D7Y A;  5FT5 A;  1C7N A;  4A6R A;  3PGY A;  3PAA A;  4R8D A;  3DZZ A;  1IAY A;  2O0R A;  2FNU A;  1IX7 A;  2C44 A;  4XJP A;  1DKA A;  2X5D A;  4Q76 A;  1LK9 A;  5EIG B;  5M4D A;  1Z7D A;  4Y0H A;  5E3K A;  2HUU A;  5F9S A;  3VK3 A;  4AO9 A;  1B9I A;  1ELQ A;  1IVR A;  4WB0 B;  2Z1Y A;  2CIN A;  1CQ6 A;  3PIU A;  4WXF A;  1ARG A;  4OC9 A;  4P3M A;  2E54 A;  4IY7 A;  2CTZ A;  1WYU B;  2VLF A;  2GQN A;  4LNJ A;  4ZWV A;  4PFF A;  1SZK A;  3ELP A;  3QGU A;  2OGA A;  5F8V A;  1S09 A;  1LC8 A;  3FFR A;  5JAY A;  4WYC A;  1UKJ A;  4OMA A;  1DFO A;  3AEO A;  3QN6 A;  1DTY A;  2W7H A;  3ASB A;  1DGD A;  2BIG A;  2Z1Z A;  1BJ4 A;  1AY8 A;  1ELU A;  2DKB A;  2Z20 A;  3AEM C;  3G7Q A;  4EB5 A;  2HOY A;  4XEW A;  3OKS A;  1J04 A;  1CL1 A;  1PG8 A;  4ZM4 A;  3AEP A;  1M4N A;  2C81 A;  4Q6R A;  1H0C A;  1ORD A;  1QZ9 A;  2JJH A;  2VMR A;  7AAT A;  2E7J A;  1LS3 A;  3AEM A;  2BI2 A;  2BHX A;  3T32 A;  2X5F A;  4EU1 A;  3FVX A;  3VAX A;  1D7U A;  1VEF A;  2AY1 A;  1AY5 A;  1GC3 A;  3FFH A;  1BKG A;  4FL0 A;  4H51 A;  3NU8 A;  4WB0 A;  1N31 A;  3PDB A;  4EFF A;  5G0A A;  1WYV B;  4AZJ A;  1KMK A;  1C7O A;  3QM2 A;  1D7V A;  4UHN A;  2FNI A;  1WST A;  3TCM A;  1RV4 A;  2BYJ A;  1M0P A;  1WKH A;  2JJE A;  2ZSL A;  4TN4 A;  4OCA A;  1U08 A;  1SZU A;  2W8V A;  1YOO A;  3EZ1 A;  3NDN A;  1OHW A;  3R4T A;  2HP1 A;  2YRR A;  4QGR A;  3ATH A;  1GCK A;  4WYF A;  2AY7 A;  1V2D A;  1AHF A;  1YIZ A;  2BWP A;  1QIS A;  3E2F A;  2E7U A;  4M2J A;  5EFS A;  2R5C B;  5HDM A;  1AIB A;  2VMU A;  3MAU A;  2ZP7 A;  4A6T A;  1TOE A;  3WKS A;  2OGE A;  2YOB A;  5E5I A;  1AMQ A;  5EIG A;  4GE7 A;  4JEX A;  2ZUK A;  3TQX A;  3G8M A;  3PDX A;  1GEY A;  1I41 A;  1IX8 A;  4HF8 A;  4F4E A;  1AHX A;  4ITG A;  4K2B A;  4E77 A;  2W8T A;  1ASA A;  5D5S A;  1GEW A;  3EZS A;  2FM1 A;  4F5G A;  2JJF A;  1AJS A;  2WK7 A;  4UHO A;  2PB0 A;  2GSA A;  4WP0 A;  2VGU A;  4CBR A;  1YAA A;  4MSO A;  4WLH A;  2BYL A;  3FQA A;  5DJ9 A;  1QIR A;  2VIA A;  1GC2 A;  3DOD A;  1TOG A;  2ZY2 A;  2PB2 A;  1FC4 A;  1TPL A;  3A9Z A;  1OXO A;  1CJ0 A;  3RQ1 A;  1AKB A;  3ZRP A;  4PFN A;  2W8W A;  2VMV A;  3N75 A;  2JJG A;  3DC1 A;  5TF5 A;  1W7M A;  3LY1 A;  1G7X A;  5EAV A;  2W7G A;  2EPJ A;  1VJO A;  1ZOD A;  1GEX A;  2D7Z A;  4KAM A;  4W1V A;  2D63 A;  4ZAH A;  4JEY A;  1W7N A;  3WGC A;  4A0H A;  3B46 A;  1AJR A;  5K8B A;  1MAP A;  2VLH A;  3LWS A;  1WYU A;  4JEV A;  1ART A;  1BJO A;  4ZM3 A;  1CS1 A;  3BCA A;  4WD2 A;  1D2F A;  5HHY A;  1YJY A;  4ZWM A;  1DGE A;  4XK1 A;  5G09 A;  3NX3 A;  2D65 A;  4F5I A;  5DJ1 A;  2V0Y A;  1CZE A;  1WYV A;  3BCB A;  3M5U A;  3MC6 A;  4OYT A;  1CQ8 A;  2NMP A;  3P6K A;  4JF1 A;  1MDZ A;  2XBN A;  2CY8 A;  2W7J A;  2VMS A;  3Q8N A;  2O1B A;  2W7D A;  4IYO A;  3COG A;  3ZRQ A;  4LW2 A;  4XJO A;  3MAF A;  4A0R A;  3BC8 A;  3HMU A;  1DJU A;  4RAE A;  2FYF A;  1G4V A;  2E7I A;  3DXW A;  2VIB A;  4R5F A;  4ZDL A;  3CQ6 A;  4U2H A;  4AO4 A;  1KL2 A;  2V1P A;  5EAA A;  1E5F A;  4AOA A;  4ZDO A;  2AY9 A;  3PPL A;  4MY5 A;  3ACZ A;  3PDB B;  1OHV A;  1ASN A;  2VMX A;  1QIT A;  3BWO A;  3NYS A;  3NUB A;  4W1W A;  1TAR A;  1YNU A;  1TAT A;  3UWC A;  3FRK A;  4W91 A;  2CJD A;  4A72 A;  4E3Q A;  4ATP A;  3MC6 C;  2Z9U A;  4R2N A;  4BA5 A;  3WGB A;  5HXX A;  3WX9 A;  3LVJ A;  2QB2 A;  2AY5 A;  3L8A A;  3TFT A;  2PO3 A;  2D66 A;  1KMJ A;  2GMU A;  2YCT A;  4EB7 A;  1S0A A;  3BB8 A;  2D64 A;  4UQV A;  3WKR A;  4XJM A;  1Y4I A;  4IXS A;  2VMZ A;  3E2Y A;  4LC3 A;  3GZD A;  1GC4 A;  2HOZ A;  2AY6 A;  4W8I A;  3CQ4 A;  3P1T A;  3AEN B;  1SZS A;  3EUC A;  4A00 A;  1JG8 A;  4EMY A;  5DX5 A;  3FTB A;  4B98 A;  8AAT A;  3NYT A;  1JS6 A;  2Q7W A;  3DU4 A;  3EI8 A;  4XQ2 A;  1DJ9 A;  4Q31 A;  1RVY A;  4Y0I A;  3AEJ C;  1UU1 A;  2VI8 A;  3B1C A;  1EG5 A;  5EUD A;  1H1C A;  3HLM A;  2VMP A;  2QA3 A;  4GRX A;  3AEJ A;  2BI1 A;  2VGZ A;  2ZY3 A;  1CZC A;  2VGS A;  3MKJ A;  2C7T A;  4DBC A;  3BV0 A;  5J8Q A;  4K2M A;  3ISL A;  1ASG A;  4BQ0 A;  2YHK A;  1UU2 A;  2OAT A;  4UHM A;  1B8G A;  3DR7 A;  2BKW A;  3PD6 B;  3RBL A;  1Z3Z A;  2YCP A;  3FDB A;  3CAI A;  1P3W A;  1TAS A;  2BI9 A;  1T3I A;  1X29 A;  1WKG A;  3CQ5 A;  4W5K A;  4WXB A;  3WLX A;  4A6U A;  2AY2 A;  1GBN A;  5G2Q A;  4BHD A;  3B1D A;  2QLR A;  5BJ4 A;  1XI9 A;  3MEB A;  1ASF A;  4WYD A;  3JWA A;  4GE4 A;  1O69 A;  1I43 A;  1MAQ A;  1MLZ A;  1V72 A;  1JS3 A;  4E1O A;  4GEB A;  1ASC A;  1EQB A;  2JGT A;  4RKD A;  3MAD A;  2ZYJ A;  2VMN A;  3EI6 A;  2RFV A;  3GSB A;  2AY8 A;  4BMK A;  3AOV A;  3BCX A;  3HL2 A;  4P7Y A;  3RBF A;  2D61 A;  2GMS A;  1B5P A;  3B8X A;  3KGX A;  3FCR A;  4CBS A;  2DR1 A;  3UAK A;  2Z9X A;  4F5J A;  1DJE A;  2WK8 A;  3HQT A;  3K28 A;  3MBB A;  3DYD A;  4CXR A;  3NNK A;  4ZSY A;  1X2A A;  1W3U A;  4GE9 A;  4I8A A;  1ECX A;  2CAN A;  2Z61 A;  4BA4 A;  2CH1 A;  3LVM A;  3WY7 A;  3A9X A;  2VI9 A;  3NU7 A;  5IWQ A;  3E9K A;  3HDO A;  3I5T A;  1UU0 A;  4IYO B;  5DB5 A;  1ARH A;  3FSL A;  1AIA A;  1LC7 A;  2BWO A;  2XH1 A;  1I48 A;  4PVF A;  3LG0 A;  2YKV A;  3RCH A;  3GBX A;  3KKI A;  4MQP A;  5M49 A;  1FG3 A;  1BJN A;  2CST A;  1M0Q A;  3H7F A;  2O7C A;  4ITX A;  2AAT A;  3EIA A;  4MKJ A;  9AAT A;  1YJS A;  2BIE A;  2QBT A;  1B5O A;  1IX6 A;  1KKP A;  2WK9 A;  3GET A;  4AH3 A;  5C6U A;  1AAM A;  1S06 A;  1ASB A;  5EUE A;  1MGV A;  2TPL A;  3AOW A;  1SF2 A;  1LKC A;  4W1X A;  1ASD A;  3RI6 A;  1AX4 A;  2YRI A;  1AMA A;  1D7R A;  3ECD A;  2HOR A;  1GC0 A;  3KE3 A;  3JTX A;  3LVK A;  3PD6 A;  3NTJ A;  1TOJ A;  3AV7 A;  4ADD A;  2BI5 A;  2VGW A;  3TFU A;  3GJU A;  4WXG A;  1E5E A;  4ADB A;  3EI7 A;  4A0G A;  2R5C A;  3EIB A;  1AHE A;  5M4B A;  2W7L A;  3A2B A;  4KXK A;  3UE8 A;  2QMA A;  3DR4 A;  3F6T A;  5G4I A;  2QB3 A;  1M7Y A;  5FT4 A;  3QBO A;  3WZF A;  4AZK A;  1QGN A;  4Q75 A;  1I29 A;  2EGY A;  3ZRR A;  2JG2 A;  1M6S A;  1GDE A;  3N5M A;  1M32 A;  2YKU A;  2ZY5 A;  4IXO A;  2GB3 A; 
#chains in the Genus database with same CATH topology
 3H0M C;  2JE5 A;  2ZC0 A;  5AV9 D;  1P3A C;  3W97 D;  4U1T A;  2CV5 B;  2BIA A;  4KYO A;  1O61 A;  2AY3 A;  3WKJ A;  3AZG D;  1WYT A;  3B0C T;  4N0W A;  3UT9 C;  1IBJ A;  2BG1 A;  1P34 C;  4E3R A;  4JEZ A;  2BWN A;  1TOI A;  5B0Y A;  2C0R A;  5B31 A;  1RV3 A;  5BS7 A;  5AV5 B;  4J5U A;  4CAY A;  1G4X A;  1VP4 A;  3FVU A;  3A8U X;  4TMR A;  4H63 Q;  1N8P A;  3A6N A;  3B0D B;  4DQY B;  3K40 A;  4LNM A;  3AZE C;  3REH B;  3AN2 A;  4F5H A;  5JRG A;  5B24 D;  4IX8 A;  5C3I B;  4KUD C;  1J32 A;  5BJ3 A;  4CSR A;  2W7K A;  1BQD A;  4WU9 D;  5CP6 B;  3AYW B;  2PYO D;  1X28 A;  5F99 D;  4YS3 C;  3A1I A;  4B9B A;  1AOI B;  1X0M A;  3QHX A;  3W98 D;  2ZSM A;  3W99 B;  3BWN C;  1KL1 A;  5FT8 A;  2W8U A;  3TU4 D;  5B2J D;  4KUD A;  1D7S A;  2CH2 A;  4LNL A;  3X1S B;  1ARS A;  3KXB A;  3DXV A;  1EJI A;  3ZZJ A;  3JWB A;  3AEN A;  4GSA A;  3REH C;  1V2E A;  1B4X A;  1M1A B;  3N4X A;  3E77 A;  4ZDP A;  2YKX A;  1S08 A;  2CB1 A;  2VMW A;  3F9T A;  3PJ0 A;  4ISY A;  5I92 A;  1AAW A;  1T3U A;  2NQB D;  5AY8 B;  5AV6 D;  3RCH B;  4MQR A;  1RVU A;  2NZD D;  5AV9 A;  1P3I C;  2DOU A;  3AZI D;  1MDX A;  3DRD A;  3TU4 C;  5G49 B;  1S07 A;  4LW4 A;  4H9P A;  3DZZ A;  2O0R A;  2FNU A;  1EQZ B;  2C44 A;  3REK B;  4XJP A;  4Q76 A;  5BNV A;  5M4D A;  2YFV A;  1Z7D A;  2HUU A;  5F9S A;  1TZY C;  4Z2M H;  1ELQ A;  5B33 D;  2Z1Y A;  3PIU A;  1F66 D;  4PFF A;  3ELP A;  4NFT A;  5B24 C;  3AZJ D;  3ASB A;  1DGD A;  3G7Q A;  5JRG B;  2Z20 A;  3MNN A;  4EB5 A;  5B24 A;  3REH A;  3WTP C;  5B1L C;  1CL1 A;  1PG8 A;  2JJH A;  7AAT A;  4K05 A;  2BI2 A;  3EPK A;  2BHX A;  4RJ0 A;  4H9N A;  1VEF A;  1GC3 A;  4FL0 A;  4LD9 B;  4X23 D;  5F99 B;  3TCM A;  4AZJ A;  1D7V A;  3AZF B;  1P34 D;  3C1B C;  2BYJ A;  5B31 B;  4TN4 A;  4OCA A;  2W8V A;  4QGR A;  3R4T A;  2HP1 A;  2YRR A;  3MGR D;  1V2D A;  1YIZ A;  3AZK B;  4JJN A;  5EFS A;  2VMU A;  3MAU A;  1TOE A;  4R8P A;  2OGE A;  5E5I A;  1AMQ A;  3TU4 A;  4ZBJ C;  1P3M B;  4GE7 A;  2IO5 C;  5AV9 C;  2DGM A;  5AVC D;  2W8T A;  1ASA A;  3EZS A;  3MGS D;  4F5G A;  4UHO A;  3MGQ A;  2RVQ C;  2GSA A;  2VGU A;  2NQB C;  4CBR A;  1YAA A;  3B6G D;  4ZUX C;  1GC2 A;  3DOD A;  1TOG A;  1TPL A;  1OXO A;  3ZRP A;  3DC1 A;  3FZ7 A;  1W7M A;  4HGA C;  5B1M D;  4H9S A;  3AN2 C;  3AZG B;  5AV6 B;  2IO5 B;  1VJO A;  1ZOD A;  2D63 A;  3WGC A;  2NZD A;  1P3B D;  3X1V A;  1P3O B;  1DGE A;  3W96 B;  2V0Y A;  4J8U A;  3LZ0 C;  2NMP A;  1MDZ A;  3W99 D;  1TZY B;  4XUJ A;  4UUZ A;  4XJO A;  3WCO A;  2Y2G A;  3AYW A;  2VIB A;  4ZDL A;  1KX3 C;  2NQB B;  3W99 C;  4WU9 C;  3PDB B;  3W97 A;  1TAR A;  3WKJ C;  3FRK A;  4W91 A;  4ATP A;  3MC6 C;  3AN2 B;  1P3I A;  4LD9 A;  4BA5 A;  3AZG A;  4H9N B;  5B32 D;  3L8A A;  4XJM A;  3HT4 A;  4X23 A;  2AY6 A;  3P1T A;  5B31 D;  2JSS A;  3EUC A;  5DX5 A;  3B6G C;  3EI8 A;  1DJ9 A;  4Q31 A;  2G5I C;  3AEJ C;  2VI8 A;  3B1C A;  4GRX A;  3WKJ B;  2QA3 A;  2OKJ A;  3X1S D;  4K2M A;  5JRG D;  3AZL D;  2YFV B;  2YCP A;  1TAS A;  2BI9 A;  1T3I A;  4YM6 A;  3WLX A;  3AZJ C;  3AZK A;  4BHD A;  3B1D A;  2QLR A;  1O69 A;  1MLZ A;  5G49 A;  3REK C;  1EQB A;  2FJ7 A;  5F99 A;  3JZL A;  4P7Y A;  2D61 A;  3B8X A;  4CBS A;  1KX4 A;  4GE9 A;  5CPI A;  3KUY B;  2Z61 A;  2YFW A;  1P3A B;  3R45 B;  2F8N A;  2BYM A;  4IYO B;  2XH1 A;  3LG0 A;  3KKI A;  4M6B A;  3WAA B;  2CST A;  3AZH C;  3EIA A;  3C1C A;  2WK9 A;  5KDM B;  3AZI B;  1ASB A;  3C1B B;  3REK A;  1ASD A;  4H9O B;  1AX4 A;  4RIZ A;  1P3G B;  3I16 A;  3LVK A;  1TOJ A;  4ADD A;  2BI5 A;  2R5C A;  2W7L A;  3A2B A;  4KXK A;  5G4I A;  5GSU B;  1M7Y A;  3WZF A;  1P3I D;  5E5A A;  1M6S A;  5B2J C;  1ZLA A;  5BS7 C;  2FJ7 C;  3G0T A;  3B6G B;  1ASM A;  4WYG A;  1LW5 A;  1M1A A;  4ZUX B;  5B33 A;  4OBV A;  3II0 A;  3BS8 A;  2VMO A;  3WTP B;  3REI C;  2ZJG A;  2EZ1 A;  3W96 D;  4CVQ A;  1AY4 A;  3FVS A;  1TAF A;  4ZSW A;  3A9Y A;  3AZI C;  3X1S A;  5GT3 C;  2HIO D;  3OP7 A;  5DNM A;  3N0L A;  3KWQ C;  1PMM A;  4F5F A;  3RUY A;  3GR9 A;  3KFU G;  4JEW A;  3TAT A;  3AZK D;  4M2M A;  2DKJ A;  4OTL A;  2Y2Q A;  4HVK A;  3X1T B;  3NQJ A;  2W7M A;  2CJG A;  4YS3 D;  3NUI A;  2VGT A;  4F5K A;  1HQ3 B;  1OAT A;  4JJN D;  2VYC A;  1SFF A;  3IHJ A;  3LJA B;  4F5M A;  3LZ0 B;  1QJ3 A;  2VMY A;  3REL D;  4RM1 A;  1BT4 A;  3AV1 D;  4X23 B;  3H0L C;  4PIW A;  2FQ6 A;  3W98 C;  2R2N A;  4R5Z A;  3MGS A;  5CPJ C;  4KHA B;  3MGQ D;  1LC5 A;  1IUG A;  4DRA A;  3N7N A;  3B6G A;  2BI3 A;  2HUI A;  3MVD D;  3WA9 A;  3LZ0 A;  3R9A A;  3EG5 B;  3X1U A;  1ZLA B;  4J8V B;  5E4Z A;  4E44 A;  1P3F D;  1AKA A;  3GZC A;  1MLY A;  2Z9V A;  3LV2 A;  4CXQ A;  3NQJ B;  1AMS A;  3FZ6 A;  3VH5 W;  4R8P B;  3AFA C;  1W7L A;  1BS0 A;  1BW0 A;  3UTA A;  2W7I A;  3K7Y A;  2KFP A;  3CBF A;  3GWP A;  2W7F A;  5GT0 D;  2EZ2 A;  4WNN B;  4WU8 A;  1O62 A;  3REI B;  2J8P A;  3AV2 A;  1BQA A;  3LVL B;  5G2P A;  2CFB A;  3WTP D;  2ORD A;  2AEV A;  3H0R C;  4R8D A;  3PAA A;  1IAY A;  3R45 A;  2DGL A;  2F8N K;  1KX5 A;  3KUY D;  2CWE A;  1ZLA C;  3VK3 A;  5AVB B;  2HIO A;  2Y2M A;  4J8X B;  1B9I A;  5DNM D;  5B0Z C;  4WXF A;  4OC9 A;  4P3M A;  3W1I A;  4ZWV A;  1WYU B;  5GT3 D;  3A6N C;  4WYC A;  2UWX A;  4R8P C;  3AFA B;  1DFO A;  1DTY A;  2BIG A;  5B40 B;  1U35 A;  5BT1 D;  1HQ3 D;  5DNN B;  3OKS A;  4QLC B;  1B6W A;  4JJN B;  3AEP A;  2C81 A;  4Q6R A;  1H3O A;  2E7J A;  1LS3 A;  3C1B A;  1M18 B;  4KGC D;  3FVX A;  3VAX A;  1P3G C;  3REL A;  1AY5 A;  4WB0 A;  4EFF A;  5G0A A;  1WYV B;  4BQ0 A;  1KMK A;  4UHN A;  2FNI A;  1WST A;  2ZSL A;  2JJE A;  4ZWM A;  4WYF A;  1GCK A;  2AY7 A;  1AHF A;  1A7W A;  3E2F A;  2E7U A;  2F8N B;  1P3L B;  4RIT A;  3WKS A;  2YOB A;  5B2I A;  5KTB A;  2DF4 C;  3TQX A;  4YM6 C;  1KX4 B;  2PYO C;  1B67 A;  4K2B A;  5BO0 A;  4E77 A;  2FM1 A;  1S32 B;  3AV2 B;  2JJF A;  2WK7 A;  4WP0 A;  4Z66 D;  3KXB B;  4WLH A;  4MSO A;  1QIR A;  2ZY2 A;  2PB2 A;  1FC4 A;  1P3G A;  3RQ1 A;  3FD0 A;  2Y2K A;  3N75 A;  2JCH A;  3UTA D;  2OKK A;  1W7N A;  3B46 A;  1AJR A;  3B6F D;  1WYU A;  4JEV A;  1ART A;  3O62 D;  4ZM3 A;  1CS1 A;  4WD2 A;  3VP6 A;  1D2F A;  5DJ1 A;  1CZE A;  3BCB A;  1CQ8 A;  4Z5T D;  4JF1 A;  5B2I B;  2CY8 A;  3KUY A;  2PYO B;  5CPJ D;  4LW2 A;  3VH6 W;  4NE5 A;  3BC8 A;  3HMU A;  2CV5 C;  1DJU A;  2E7I A;  2QSR A;  3KXB C;  1KL2 A;  3ACZ A;  1ASN A;  3BWO A;  1QIT A;  3REL B;  1TAT A;  3AZF C;  4J8U C;  1BH9 B;  3REJ A;  3UT9 D;  4E3Q A;  4J8V D;  3MGQ C;  1HQ3 A;  3WGB A;  5HXX A;  3AZE A;  3LVJ A;  3B0B A;  1P3M C;  3TFT A;  3W98 B;  1KMJ A;  1AOI A;  3AZN D;  4EB7 A;  3AFA A;  4G91 B;  3BB8 A;  5AV8 D;  1Y4I A;  3X1T A;  2VMZ A;  3E2Y A;  3TU4 B;  2HOZ A;  3IP4 C;  2CV5 A;  4H9S C;  3CQ4 A;  1ULY A;  5JA4 B;  3EPL A;  2Q7W A;  3DU4 A;  4EO5 B;  4XQ2 A;  1BH9 A;  1UU1 A;  1KAF A;  1H1C A;  2VMP A;  3AZF A;  2BYK B;  2VQR A;  1CZC A;  2C7T A;  4DBC A;  1TAF B;  5J8Q A;  3ISL A;  1ID3 D;  3W1H A;  2OAT A;  4XZQ D;  4UHM A;  1B8G A;  3FDB A;  3CAI A;  1WKG A;  3USF A;  4A6U A;  5B33 B;  3CQ5 A;  4ZUX A;  3MNN B;  2BYK A;  3MEB A;  4WYD A;  3JWA A;  2HIO C;  3WCN A;  1V72 A;  4E1O A;  4GEB A;  4RKD A;  2VMN A;  4DRB A;  3GSB A;  2F8N H;  3B0C W;  3AOV A;  5B1L B;  4BMK A;  2RIQ A;  5B1M B;  3W96 C;  1B5P A;  5GSU A;  4F5J A;  3HQT A;  1P3P D;  4ZSY A;  1X2A A;  1Z2C B;  4UUZ B;  4I8A A;  2CH1 A;  3WA9 D;  2VI9 A;  3HDO A;  1UU0 A;  4J8X C;  5DNM B;  1ARH A;  1M19 C;  1AIA A;  4PVF A;  1P3F A;  1BJN A;  4AWL C;  4MKJ A;  2NZD B;  3MGS C;  5CPJ A;  1BH8 B;  3GET A;  1IX6 A;  4KHA A;  4AH3 A;  5C6U A;  1N1J A;  1S06 A;  1JFI A;  5EUE A;  3AOW A;  2PYO A;  2HOR A;  3JTX A;  3PD6 A;  1P3M D;  4KGC B;  2ARO D;  3REJ D;  3UT9 A;  4QLC D;  2QB3 A;  3QBO A;  1P3K C;  1OXP A;  2HUE C;  4Z66 B;  3KXB D;  2Z9W A;  2X8U A;  3AZM D;  3UTA C;  4ZAS A;  3GZD C;  5DNN A;  1M0O A;  5JRG C;  5GXQ D;  2VGV A;  5GT3 A;  3X1S C;  3FKD A;  1Q9C A;  2VMQ A;  3WAA A;  5CPK C;  4MQQ A;  2XD1 A;  1IAX A;  3E2Z A;  1C4K A;  4J8X D;  5D95 A;  5B31 C;  3MGR B;  1AHY A;  3BN1 A;  3B1E A;  4KGC A;  2HOX A;  3ASA A;  3F0H A;  2EO5 A;  3EI9 A;  1FG7 A;  1LW4 A;  1TOK A;  2Y2H A;  3X1T C;  4XJL A;  1JFI B;  3PA9 A;  2Y2J A;  2HUE B;  4O6Z A;  2DGK A;  3FDD A;  4L0O A;  1YJZ A;  3AV2 C;  4F5L A;  1BJW A;  2D5Y A;  1V2F A;  1P3B B;  1OHY A;  4M2K A;  5B2I D;  4J8W C;  1TZY D;  3FQ7 A;  2YCN A;  1SVV A;  1KX3 D;  4KUD B;  4DQ6 A;  5FUG A;  4YM6 B;  1KX4 C;  1GD9 A;  1WYT B;  1QJ5 A;  3VK2 A;  2FN6 A;  1SPA A;  5M46 A;  1AKC A;  3WKJ D;  1ARI A;  3LEL C;  3AL0 C;  3JW9 A;  1W23 A;  1G7W A;  3UT9 B;  4XZQ B;  1AJS B;  5AVB A;  4WU8 C;  5B0Y D;  1MDO A;  1P34 A;  1BFM A;  1JF9 A;  3QI6 A;  3MAF B;  5G4J A;  3MNN D;  3I4J A;  1R4V A;  3B6F A;  4IXZ A;  3LZ1 A;  5B32 B;  1P3I B;  3LZ1 C;  3A6N B;  3UTB A;  3EPH A;  1C7G A;  5B0Y C;  2WKA A;  2F2A C;  1YIY A;  3L44 A;  3NRA A;  5AV8 B;  4UPK A;  2FJ7 B;  4CAY B;  3QPG A;  5EUN A;  2AY4 A;  2F8J A;  3AEL A;  2ZY4 A;  3X1U C;  2HZP A;  1B9H A;  2VMT A;  2G6W A;  4Y0D A;  5JA4 A;  4WU9 A;  1P3O D;  3AN2 D;  4NE6 A;  5CPK B;  4UOY A;  1C7N A;  4A6R A;  5B1M C;  3PGY A;  1DKA A;  2X5D A;  1LK9 A;  3HBX A;  5AVC A;  3W98 A;  3WAA D;  3MGP D;  4XZQ C;  5B1M A;  3MGR C;  1P3F C;  4J8U B;  4J8V A;  4AO9 A;  2CIN A;  1CQ6 A;  2ZM5 A;  1P3B A;  4X23 C;  4EO5 C;  2VLF A;  1SZK A;  3X1T D;  2OGA A;  5JAY A;  1S09 A;  2CV5 D;  1UKJ A;  5B1L D;  3AZG C;  3AEO A;  1BJ4 A;  1AY8 A;  2DKB A;  2Y2I A;  2ARO B;  4XEW A;  4WJ3 C;  4J8W B;  2Y2N A;  1M4N A;  1H0C A;  4Z2M G;  3FZ8 A;  3X1V D;  3AEM A;  4H9Q A;  4EU1 A;  5BNX B;  3FFH A;  1BKG A;  3AYW D;  4J8V C;  1N31 A;  3PDB A;  3AV1 C;  4AWL B;  1M18 C;  3QM2 A;  1KX3 A;  2NQB A;  1RV4 A;  1M0P A;  1WKH A;  1U08 A;  1YOO A;  4ZBJ B;  1OHW A;  3ATH A;  3AZH A;  2BWP A;  4XUJ D;  4M2J A;  2R5C B;  4A6T A;  2ZP7 A;  1P3L C;  2ZUK A;  3KWQ B;  4H9O A;  3AZK C;  1IX8 A;  3REJ B;  3W97 C;  4ITG A;  1P3A D;  5GSU D;  5KDM A;  3AZI A;  4Z5T C;  1W2E A;  3C1C B;  3AV1 B;  5AV9 B;  2ARO C;  3FQA A;  2VIA A;  1P3K A;  3O62 C;  1CJ0 A;  1AKB A;  2VMV A;  5B24 B;  2JJG A;  5TF5 A;  3LY1 A;  1G7X A;  1PMO A;  3UTB D;  4G92 C;  1GEX A;  4W1V A;  3REH D;  4ZAH A;  5K8B A;  2VLH A;  3LWS A;  1F66 A;  3BCA A;  5AV6 C;  5AV5 D;  5G09 A;  3NX3 A;  2D65 A;  4F5I A;  3MC6 A;  1WYV A;  4OYT A;  1HTA A;  3LEL D;  1P3F B;  1P3M A;  5CP6 D;  3P5J B;  3Q8N A;  3ZRQ A;  4YM6 D;  2EYQ A;  4QLC A;  4R8P D;  3C1C C;  2FYF A;  1G4V A;  3CQ6 A;  4AO4 A;  5AY8 C;  5B32 G;  2FJ7 D;  2V1P A;  5EAA A;  4AOA A;  4ZDO A;  2AY9 A;  4MY5 A;  1OHV A;  3NYS A;  3UWC A;  4A72 A;  5B1L A;  1KX3 B;  5DNN D;  2Z9U A;  4G92 B;  2AEU A;  3KUY C;  2PO3 A;  2GMU A;  2YCT A;  2XD5 A;  2D64 A;  3WKR A;  4H9R A;  4LC3 A;  1GC4 A;  5CP6 C;  3AEN B;  4A00 A;  1JG8 A;  4B98 A;  8AAT A;  3AZH D;  4WNN A;  4WU8 B;  5CPK D;  5B0Y B;  3AZJ B;  5DNM C;  2VGZ A;  3REK D;  2ZY3 A;  2VGS A;  3MKJ A;  5AVB C;  5E5A D;  1ASG A;  3W99 A;  1UU2 A;  2YHK A;  1ZLA D;  3DR7 A;  5AVC B;  1Z3Z A;  1GBN A;  5BJ4 A;  1XI9 A;  1M1A D;  1ASF A;  4XUJ C;  1I43 A;  1MAQ A;  1TZY A;  2JGT A;  3V9R B;  4J8U D;  3MAD A;  2F8N G;  2RFV A;  1P3K D;  2AY8 A;  3W96 A;  4JJN C;  2GMS A;  5C3I C;  3FCR A;  2DR1 A;  3UAK A;  2Z9X A;  1DJE A;  3DYD A;  5GT0 B;  3X1V C;  2W8S A;  5B32 A;  1ECX A;  2CAN A;  4BA4 A;  3WY7 A;  3A9X A;  1N1J B;  3AZL C;  5IWQ A;  5AVB D;  3I5T A;  5B32 C;  1AOI C;  5AV5 A;  3REL C;  1LC7 A;  1I48 A;  4MQP A;  4LD9 D;  1FG3 A;  1M0Q A;  3LJA A;  2O7C A;  2AAT A;  9AAT A;  1YJS A;  2BIE A;  3AYW C;  2QBT A;  3LZ1 D;  3NQU B;  1KKP A;  1B5O A;  3REI D;  1AAM A;  2TPL A;  1S32 C;  3MGP C;  3WAA C;  4W1X A;  4XUJ B;  2G7J A;  3RI6 A;  2YRI A;  1GC0 A;  3KE3 A;  4WXG A;  4ADB A;  3KWQ D;  4CSR B;  3EI7 A;  1P3O C;  1AHE A;  2QMA A;  3F6T A;  1P3O A;  4RLG A;  5FT4 A;  1QGN A;  3X1V B;  1I29 A;  2JG2 A;  2FKI A;  1M32 A;  2YKU A;  4OT8 A;  3AZL A;  3AZN B;  3MVD A;  3UTB B;  5AY8 D;  2R0T A;  3A1K A;  1ZOB A;  3MGP A;  5BO0 B;  2Y2O A;  1O4S A;  4IW7 A;  1M0N A;  4K2I A;  4NOG A;  3O62 B;  4H9R B;  1KX4 D;  4E45 A;  5CPI D;  3ELE A;  5B40 C;  2R5E A;  4WYA A;  1C9C A;  4WYE A;  5DNN C;  4JF0 A;  5B2I C;  4J8W D;  3MNN C;  3WTP E;  1ZC9 A;  4Z5T B;  3X1U D;  5AV5 C;  4NE3 A;  3V9R A;  5E5A B;  5FT6 A;  4ADC A;  3E2Z B;  1KKJ A;  2HP2 A;  3B0D C;  3AAT A;  3NYU A;  1KU5 A;  3LEL B;  3C1C D;  4FFC A;  5GT3 B;  1HQ3 C;  2F8N D;  3FQ8 A;  1M19 A;  1EQZ A;  5FUG B;  1XEY A;  2OQX A;  1CQ7 A;  1EQZ C;  5B40 A;  4RJY A;  4XAU A;  4A0F A;  2EH6 A;  4WU8 D;  3AV2 D;  5GSU C;  1CL2 A;  1AIC A;  2YKY A;  3WTP A;  1AMR A;  2BYM B;  4WBT A;  4ADE A;  3EI5 A;  1P3A A;  1KX5 D;  3AZM C;  2W7E A;  1ASE A;  4ZLV A;  3ZZK A;  3E6G A;  1U35 C;  2Y2L A;  5B0Z B;  4DGT A;  1P3K B;  1BH8 A;  3C1B D;  3REI A;  1AHG A;  3N4S A;  4MKK A;  4RKC A;  2HUF A;  1BJO B;  1U35 D;  4ATQ A;  3HVY A;  2X3L A;  3KWQ A;  3VOM A;  1IJI A;  4GDY A;  1KX5 C;  1C0N A;  5EQC A;  3BWN A;  1N2T A;  1ASL A;  2W8J A;  3LEL A;  5AX8 A;  2CJH A;  3AZH B;  2WB6 A;  4WLJ A;  4Z66 C;  1F66 C;  5CP6 A;  1S32 A;  3NQU A;  5AY8 A;  3MVD C;  3AZM B;  3D6K A;  3VK4 A;  1PFF A;  3LJA C;  3KGW A;  5BNX A;  2D7Y A;  5FT5 A;  4J8W A;  4YS3 A;  1IX7 A;  1P3P C;  5EIG B;  4G91 C;  4Y0H A;  1ID3 B;  5E3K A;  5CPJ B;  2L5A A;  3AV1 A;  1IVR A;  4WB0 B;  1ARG A;  2E54 A;  4IY7 A;  2CTZ A;  2GQN A;  4LNJ A;  4QLC C;  1P3B C;  3REJ C;  3W97 B;  2A1V A;  1P3G D;  3N4R A;  3QGU A;  5F8V A;  1LC8 A;  3FFR A;  1M19 D;  2G5H C;  4OMA A;  3QN6 A;  2W7H A;  3AEM C;  2Z1Z A;  1ELU A;  2HOY A;  5BT1 C;  1J04 A;  4ZM4 A;  1P3P B;  1ORD A;  1QZ9 A;  2VMR A;  5CPK A;  3VH6 T;  3LZ0 D;  3T32 A;  1WWS A;  5F99 C;  2X5F A;  3AZE B;  4WU9 B;  2AY1 A;  1D7U A;  4H51 A;  2RVQ D;  3NU8 A;  2JIS A;  2HIO B;  1C7O A;  1F1E A;  1SZU A;  3EZ1 A;  3NDN A;  5AVC C;  1QIS A;  5HDM A;  1AIB A;  3VH5 T;  3AZN C;  5EIG A;  3LZ1 B;  4JEX A;  3G8M A;  3PDX A;  4YS3 B;  3EPJ A;  1GEY A;  1I41 A;  3AZL B;  3AZN A;  4HF8 A;  5GT0 A;  1AHX A;  5D5S A;  1GEW A;  5GT0 C;  1AJS A;  2PB0 A;  5B2J A;  2BYL A;  4KUD D;  5DJ9 A;  3A9Z A;  1AOI D;  4PFN A;  2W8W A;  5AV8 C;  5GXQ B;  5EAV A;  2W7G A;  2EPJ A;  4KAM A;  5B2J B;  2D7Z A;  3LJA D;  3VH6 A;  4JEY A;  4A0H A;  3X1U B;  1MAP A;  4ZUX D;  1BJO A;  3WA9 B;  5HHY A;  1YJY A;  3W1J A;  5CHL B;  4XK1 A;  3H9X A;  3M5U A;  3P6K A;  2XBN A;  1ID3 A;  5AV6 A;  1M1A C;  2VMS A;  2W7J A;  5B0Z A;  2O1B A;  2W7D A;  4IYO A;  3COG A;  3MAF A;  4A0R A;  2YFW B;  4RAE A;  3DXW A;  4R5F A;  5CPI B;  4U2H A;  1P3L A;  3MGQ B;  1E5F A;  3PPL A;  2VMX A;  3NUB A;  4W1W A;  1YNU A;  2CJD A;  1P3P A;  4R2N A;  5GXQ C;  3B6F C;  3WX9 A;  1M18 A;  2QB2 A;  2AY5 A;  2D66 A;  1S0A A;  4J8L A;  4UQV A;  4IXS A;  3GZD A;  3AZJ A;  1PZR A;  4W8I A;  5E5A C;  4OBU A;  4WV4 B;  1SZS A;  4EMY A;  4Z66 A;  3FTB A;  2NZD C;  3NYT A;  1JS6 A;  1RVY A;  4Y0I A;  1EG5 A;  5EUD A;  3HLM A;  5B33 C;  3AEJ A;  1EQZ D;  2BI1 A;  3BV0 A;  4Z5T A;  5B40 D;  5CPI C;  2BKW A;  3PD6 B;  3RBL A;  1KX5 B;  1P3W A;  3MGR A;  1X29 A;  4F4E A;  3A6N D;  3O62 A;  4W5K A;  4WXB A;  2AY2 A;  5G2Q A;  2ARO A;  3AZM A;  2Y2P A;  4GE4 A;  3MGP B;  1JS3 A;  1ASC A;  2ZYJ A;  3EI6 A;  3MVD B;  3BCX A;  3HL2 A;  3RBF A;  3KGX A;  5BNV B;  5B31 G;  1H3O B;  2WK8 A;  3K28 A;  3MBB A;  4CXR A;  3UTA B;  3NNK A;  3WA9 C;  1M19 B;  1W3U A;  1U35 B;  4H9P B;  3AZE D;  3LVM A;  5GXQ A;  3UTB C;  1ID3 C;  3NU7 A;  3E9K A;  3KSY A;  5DB5 A;  1WWI A;  4HGA B;  3FSL A;  2BWO A;  3VH5 A;  2YKV A;  3RCH A;  3GBX A;  4LD9 C;  1F66 B;  5M49 A;  4J8X A;  3H7F A;  4ITX A;  5B0Z D;  2LY8 A;  3AFA D;  4KGC C;  5AV8 A;  1MGV A;  4H9Q B;  1SF2 A;  1LKC A;  1P3L D;  1AMA A;  1D7R A;  3ECD A;  1S32 D;  3MGS B;  3AV7 A;  3NTJ A;  4WZS B;  2VGW A;  3TFU A;  3GJU A;  3B6F B;  1E5E A;  4A0G A;  3EIB A;  5M4B A;  2FFF B;  2DQN C;  3UE8 A;  3DR4 A;  3AZF D;  1P34 B;  4AZK A;  4Q75 A;  3ZRR A;  2EGY A;  1GDE A;  3N5M A;  1M18 D;  4XZQ A;  2ZY5 A;  4IXO A;  2GB3 A; 
#chains in the Genus database with same CATH homology
 3H0M C;  2JE5 A;  2ZC0 A;  5AV9 D;  1P3A C;  3W97 D;  4U1T A;  2CV5 B;  2BIA A;  4KYO A;  1O61 A;  2AY3 A;  3WKJ A;  3AZG D;  1WYT A;  3B0C T;  4N0W A;  3UT9 C;  1IBJ A;  2BG1 A;  1P34 C;  4E3R A;  4JEZ A;  2BWN A;  1TOI A;  5B0Y A;  2C0R A;  5B31 A;  1RV3 A;  5BS7 A;  5AV5 B;  4J5U A;  4CAY A;  1G4X A;  1VP4 A;  3FVU A;  3A8U X;  4TMR A;  4H63 Q;  1N8P A;  3A6N A;  3B0D B;  4DQY B;  3K40 A;  4LNM A;  3AZE C;  3REH B;  3AN2 A;  4F5H A;  5JRG A;  5B24 D;  4IX8 A;  5C3I B;  4KUD C;  1J32 A;  5BJ3 A;  4CSR A;  2W7K A;  1BQD A;  4WU9 D;  5CP6 B;  3AYW B;  2PYO D;  1X28 A;  5F99 D;  4YS3 C;  3A1I A;  4B9B A;  1AOI B;  1X0M A;  3QHX A;  3W98 D;  2ZSM A;  3W99 B;  3BWN C;  1KL1 A;  5FT8 A;  2W8U A;  3TU4 D;  5B2J D;  4KUD A;  1D7S A;  2CH2 A;  4LNL A;  3X1S B;  1ARS A;  3KXB A;  3DXV A;  1EJI A;  3ZZJ A;  3JWB A;  3AEN A;  4GSA A;  3REH C;  1V2E A;  1B4X A;  1M1A B;  3N4X A;  3E77 A;  4ZDP A;  2YKX A;  1S08 A;  2CB1 A;  2VMW A;  3F9T A;  3PJ0 A;  4ISY A;  5I92 A;  1AAW A;  1T3U A;  2NQB D;  5AY8 B;  5AV6 D;  3RCH B;  4MQR A;  1RVU A;  2NZD D;  5AV9 A;  1P3I C;  2DOU A;  3AZI D;  1MDX A;  3DRD A;  3TU4 C;  5G49 B;  1S07 A;  4LW4 A;  4H9P A;  3DZZ A;  2O0R A;  2FNU A;  1EQZ B;  2C44 A;  3REK B;  4XJP A;  4Q76 A;  5BNV A;  5M4D A;  2YFV A;  1Z7D A;  2HUU A;  5F9S A;  1TZY C;  4Z2M H;  1ELQ A;  5B33 D;  2Z1Y A;  3PIU A;  1F66 D;  4PFF A;  3ELP A;  4NFT A;  5B24 C;  3AZJ D;  3ASB A;  1DGD A;  3G7Q A;  5JRG B;  2Z20 A;  3MNN A;  4EB5 A;  5B24 A;  3REH A;  3WTP C;  5B1L C;  1CL1 A;  1PG8 A;  2JJH A;  7AAT A;  4K05 A;  2BI2 A;  3EPK A;  2BHX A;  4RJ0 A;  4H9N A;  1VEF A;  1GC3 A;  4FL0 A;  4LD9 B;  4X23 D;  5F99 B;  3TCM A;  4AZJ A;  1D7V A;  3AZF B;  1P34 D;  3C1B C;  2BYJ A;  5B31 B;  4TN4 A;  4OCA A;  2W8V A;  4QGR A;  3R4T A;  2HP1 A;  2YRR A;  3MGR D;  1V2D A;  1YIZ A;  3AZK B;  4JJN A;  5EFS A;  2VMU A;  3MAU A;  1TOE A;  4R8P A;  2OGE A;  5E5I A;  1AMQ A;  3TU4 A;  4ZBJ C;  1P3M B;  4GE7 A;  2IO5 C;  5AV9 C;  2DGM A;  5AVC D;  2W8T A;  1ASA A;  3EZS A;  3MGS D;  4F5G A;  4UHO A;  3MGQ A;  2RVQ C;  2GSA A;  2VGU A;  2NQB C;  4CBR A;  1YAA A;  3B6G D;  4ZUX C;  1GC2 A;  3DOD A;  1TOG A;  1TPL A;  1OXO A;  3ZRP A;  3DC1 A;  3FZ7 A;  1W7M A;  4HGA C;  5B1M D;  4H9S A;  3AN2 C;  3AZG B;  5AV6 B;  2IO5 B;  1VJO A;  1ZOD A;  2D63 A;  3WGC A;  2NZD A;  1P3B D;  3X1V A;  1P3O B;  1DGE A;  3W96 B;  2V0Y A;  4J8U A;  3LZ0 C;  2NMP A;  1MDZ A;  3W99 D;  1TZY B;  4XUJ A;  4UUZ A;  4XJO A;  3WCO A;  2Y2G A;  3AYW A;  2VIB A;  4ZDL A;  1KX3 C;  2NQB B;  3W99 C;  4WU9 C;  3PDB B;  3W97 A;  1TAR A;  3WKJ C;  3FRK A;  4W91 A;  4ATP A;  3MC6 C;  3AN2 B;  1P3I A;  4LD9 A;  4BA5 A;  3AZG A;  4H9N B;  5B32 D;  3L8A A;  4XJM A;  3HT4 A;  4X23 A;  2AY6 A;  3P1T A;  5B31 D;  2JSS A;  3EUC A;  5DX5 A;  3B6G C;  3EI8 A;  1DJ9 A;  4Q31 A;  2G5I C;  3AEJ C;  2VI8 A;  3B1C A;  4GRX A;  3WKJ B;  2QA3 A;  2OKJ A;  3X1S D;  4K2M A;  5JRG D;  3AZL D;  2YFV B;  2YCP A;  1TAS A;  2BI9 A;  1T3I A;  4YM6 A;  3WLX A;  3AZJ C;  3AZK A;  4BHD A;  3B1D A;  2QLR A;  1O69 A;  1MLZ A;  5G49 A;  3REK C;  1EQB A;  2FJ7 A;  5F99 A;  3JZL A;  4P7Y A;  2D61 A;  3B8X A;  4CBS A;  1KX4 A;  4GE9 A;  5CPI A;  3KUY B;  2Z61 A;  2YFW A;  1P3A B;  3R45 B;  2F8N A;  2BYM A;  4IYO B;  2XH1 A;  3LG0 A;  3KKI A;  4M6B A;  3WAA B;  2CST A;  3AZH C;  3EIA A;  3C1C A;  2WK9 A;  5KDM B;  3AZI B;  1ASB A;  3C1B B;  3REK A;  1ASD A;  4H9O B;  1AX4 A;  4RIZ A;  1P3G B;  3I16 A;  3LVK A;  1TOJ A;  4ADD A;  2BI5 A;  2R5C A;  2W7L A;  3A2B A;  4KXK A;  5G4I A;  5GSU B;  1M7Y A;  3WZF A;  1P3I D;  5E5A A;  1M6S A;  5B2J C;  1ZLA A;  5BS7 C;  2FJ7 C;  3G0T A;  3B6G B;  1ASM A;  4WYG A;  1LW5 A;  1M1A A;  4ZUX B;  5B33 A;  4OBV A;  3II0 A;  3BS8 A;  2VMO A;  3WTP B;  3REI C;  2ZJG A;  2EZ1 A;  3W96 D;  4CVQ A;  1AY4 A;  3FVS A;  1TAF A;  4ZSW A;  3A9Y A;  3AZI C;  3X1S A;  5GT3 C;  2HIO D;  3OP7 A;  5DNM A;  3N0L A;  3KWQ C;  1PMM A;  4F5F A;  3RUY A;  3GR9 A;  3KFU G;  4JEW A;  3TAT A;  3AZK D;  4M2M A;  2DKJ A;  4OTL A;  2Y2Q A;  4HVK A;  3X1T B;  3NQJ A;  2W7M A;  2CJG A;  4YS3 D;  3NUI A;  2VGT A;  4F5K A;  1HQ3 B;  1OAT A;  4JJN D;  2VYC A;  1SFF A;  3IHJ A;  3LJA B;  4F5M A;  3LZ0 B;  1QJ3 A;  2VMY A;  3REL D;  4RM1 A;  1BT4 A;  3AV1 D;  4X23 B;  3H0L C;  4PIW A;  2FQ6 A;  3W98 C;  2R2N A;  4R5Z A;  3MGS A;  5CPJ C;  4KHA B;  3MGQ D;  1LC5 A;  1IUG A;  4DRA A;  3N7N A;  3B6G A;  2BI3 A;  2HUI A;  3MVD D;  3WA9 A;  3LZ0 A;  3R9A A;  3EG5 B;  3X1U A;  1ZLA B;  4J8V B;  5E4Z A;  4E44 A;  1P3F D;  1AKA A;  3GZC A;  1MLY A;  2Z9V A;  3LV2 A;  4CXQ A;  3NQJ B;  1AMS A;  3FZ6 A;  3VH5 W;  4R8P B;  3AFA C;  1W7L A;  1BS0 A;  1BW0 A;  3UTA A;  2W7I A;  3K7Y A;  2KFP A;  3CBF A;  3GWP A;  2W7F A;  5GT0 D;  2EZ2 A;  4WNN B;  4WU8 A;  1O62 A;  3REI B;  2J8P A;  3AV2 A;  1BQA A;  3LVL B;  5G2P A;  2CFB A;  3WTP D;  2ORD A;  2AEV A;  3H0R C;  4R8D A;  3PAA A;  1IAY A;  3R45 A;  2DGL A;  2F8N K;  1KX5 A;  3KUY D;  2CWE A;  1ZLA C;  3VK3 A;  5AVB B;  2HIO A;  2Y2M A;  4J8X B;  1B9I A;  5DNM D;  5B0Z C;  4WXF A;  4OC9 A;  4P3M A;  3W1I A;  4ZWV A;  1WYU B;  5GT3 D;  3A6N C;  4WYC A;  2UWX A;  4R8P C;  3AFA B;  1DFO A;  1DTY A;  2BIG A;  5B40 B;  1U35 A;  5BT1 D;  1HQ3 D;  5DNN B;  3OKS A;  4QLC B;  1B6W A;  4JJN B;  3AEP A;  2C81 A;  4Q6R A;  1H3O A;  2E7J A;  1LS3 A;  3C1B A;  1M18 B;  4KGC D;  3FVX A;  3VAX A;  1P3G C;  3REL A;  1AY5 A;  4WB0 A;  4EFF A;  5G0A A;  1WYV B;  4BQ0 A;  1KMK A;  4UHN A;  2FNI A;  1WST A;  2ZSL A;  2JJE A;  4ZWM A;  4WYF A;  1GCK A;  2AY7 A;  1AHF A;  1A7W A;  3E2F A;  2E7U A;  2F8N B;  1P3L B;  4RIT A;  3WKS A;  2YOB A;  5B2I A;  5KTB A;  2DF4 C;  3TQX A;  4YM6 C;  1KX4 B;  2PYO C;  1B67 A;  4K2B A;  5BO0 A;  4E77 A;  2FM1 A;  1S32 B;  3AV2 B;  2JJF A;  2WK7 A;  4WP0 A;  4Z66 D;  3KXB B;  4WLH A;  4MSO A;  1QIR A;  2ZY2 A;  2PB2 A;  1FC4 A;  1P3G A;  3RQ1 A;  3FD0 A;  2Y2K A;  3N75 A;  2JCH A;  3UTA D;  2OKK A;  1W7N A;  3B46 A;  1AJR A;  3B6F D;  1WYU A;  4JEV A;  1ART A;  3O62 D;  4ZM3 A;  1CS1 A;  4WD2 A;  3VP6 A;  1D2F A;  5DJ1 A;  1CZE A;  3BCB A;  1CQ8 A;  4Z5T D;  4JF1 A;  5B2I B;  2CY8 A;  3KUY A;  2PYO B;  5CPJ D;  4LW2 A;  3VH6 W;  4NE5 A;  3BC8 A;  3HMU A;  2CV5 C;  1DJU A;  2E7I A;  2QSR A;  3KXB C;  1KL2 A;  3ACZ A;  1ASN A;  3BWO A;  1QIT A;  3REL B;  1TAT A;  3AZF C;  4J8U C;  1BH9 B;  3REJ A;  3UT9 D;  4E3Q A;  4J8V D;  3MGQ C;  1HQ3 A;  3WGB A;  5HXX A;  3AZE A;  3LVJ A;  3B0B A;  1P3M C;  3TFT A;  3W98 B;  1KMJ A;  1AOI A;  3AZN D;  4EB7 A;  3AFA A;  4G91 B;  3BB8 A;  5AV8 D;  1Y4I A;  3X1T A;  2VMZ A;  3E2Y A;  3TU4 B;  2HOZ A;  3IP4 C;  2CV5 A;  4H9S C;  3CQ4 A;  1ULY A;  5JA4 B;  3EPL A;  2Q7W A;  3DU4 A;  4EO5 B;  4XQ2 A;  1BH9 A;  1UU1 A;  1H1C A;  2VMP A;  3AZF A;  2BYK B;  2VQR A;  1CZC A;  2C7T A;  4DBC A;  1TAF B;  5J8Q A;  3ISL A;  1ID3 D;  3W1H A;  2OAT A;  4XZQ D;  4UHM A;  1B8G A;  3FDB A;  3CAI A;  1WKG A;  3USF A;  4A6U A;  5B33 B;  3CQ5 A;  4ZUX A;  3MNN B;  2BYK A;  3MEB A;  4WYD A;  3JWA A;  2HIO C;  3WCN A;  1V72 A;  4E1O A;  4GEB A;  4RKD A;  2VMN A;  4DRB A;  3GSB A;  2F8N H;  3B0C W;  3AOV A;  5B1L B;  4BMK A;  2RIQ A;  5B1M B;  3W96 C;  1B5P A;  5GSU A;  4F5J A;  3HQT A;  1P3P D;  4ZSY A;  1X2A A;  1Z2C B;  4UUZ B;  4I8A A;  2CH1 A;  3WA9 D;  2VI9 A;  3HDO A;  1UU0 A;  4J8X C;  5DNM B;  1ARH A;  1M19 C;  1AIA A;  4PVF A;  1P3F A;  1BJN A;  4AWL C;  4MKJ A;  2NZD B;  3MGS C;  5CPJ A;  1BH8 B;  3GET A;  1IX6 A;  4KHA A;  4AH3 A;  5C6U A;  1N1J A;  1S06 A;  1JFI A;  5EUE A;  3AOW A;  2PYO A;  2HOR A;  3JTX A;  3PD6 A;  1P3M D;  4KGC B;  2ARO D;  3REJ D;  3UT9 A;  4QLC D;  2QB3 A;  3QBO A;  1P3K C;  1OXP A;  2HUE C;  4Z66 B;  3KXB D;  2Z9W A;  2X8U A;  3AZM D;  3UTA C;  4ZAS A;  3GZD C;  5DNN A;  1M0O A;  5JRG C;  5GXQ D;  2VGV A;  5GT3 A;  3X1S C;  3FKD A;  1Q9C A;  2VMQ A;  3WAA A;  5CPK C;  4MQQ A;  2XD1 A;  1IAX A;  3E2Z A;  1C4K A;  4J8X D;  5D95 A;  5B31 C;  3MGR B;  1AHY A;  3BN1 A;  3B1E A;  4KGC A;  2HOX A;  3ASA A;  3F0H A;  2EO5 A;  3EI9 A;  1FG7 A;  1LW4 A;  1TOK A;  2Y2H A;  3X1T C;  4XJL A;  1JFI B;  3PA9 A;  2Y2J A;  2HUE B;  4O6Z A;  2DGK A;  3FDD A;  4L0O A;  1YJZ A;  3AV2 C;  4F5L A;  1BJW A;  2D5Y A;  1V2F A;  1P3B B;  1OHY A;  4M2K A;  5B2I D;  4J8W C;  1TZY D;  3FQ7 A;  2YCN A;  1SVV A;  1KX3 D;  4KUD B;  4DQ6 A;  5FUG A;  4YM6 B;  1KX4 C;  1GD9 A;  1WYT B;  1QJ5 A;  3VK2 A;  2FN6 A;  1SPA A;  5M46 A;  1AKC A;  3WKJ D;  1ARI A;  3LEL C;  3AL0 C;  3JW9 A;  1W23 A;  1G7W A;  3UT9 B;  4XZQ B;  1AJS B;  5AVB A;  4WU8 C;  5B0Y D;  1MDO A;  1P34 A;  1BFM A;  1JF9 A;  3QI6 A;  3MAF B;  5G4J A;  3MNN D;  3I4J A;  1R4V A;  3B6F A;  4IXZ A;  3LZ1 A;  5B32 B;  1P3I B;  3LZ1 C;  3A6N B;  3UTB A;  3EPH A;  1C7G A;  5B0Y C;  2WKA A;  2F2A C;  1YIY A;  3L44 A;  3NRA A;  5AV8 B;  4UPK A;  2FJ7 B;  4CAY B;  3QPG A;  5EUN A;  2AY4 A;  2F8J A;  3AEL A;  2ZY4 A;  3X1U C;  2HZP A;  1B9H A;  2VMT A;  2G6W A;  4Y0D A;  5JA4 A;  4WU9 A;  1P3O D;  3AN2 D;  4NE6 A;  5CPK B;  4UOY A;  1C7N A;  4A6R A;  5B1M C;  3PGY A;  1DKA A;  2X5D A;  1LK9 A;  3HBX A;  5AVC A;  3W98 A;  3WAA D;  3MGP D;  4XZQ C;  5B1M A;  3MGR C;  1P3F C;  4J8U B;  4J8V A;  4AO9 A;  2CIN A;  1CQ6 A;  2ZM5 A;  1P3B A;  4X23 C;  4EO5 C;  2VLF A;  1SZK A;  3X1T D;  2OGA A;  5JAY A;  1S09 A;  2CV5 D;  1UKJ A;  5B1L D;  3AZG C;  3AEO A;  1BJ4 A;  1AY8 A;  2DKB A;  2Y2I A;  2ARO B;  4XEW A;  4WJ3 C;  4J8W B;  2Y2N A;  1M4N A;  1H0C A;  4Z2M G;  3FZ8 A;  3X1V D;  3AEM A;  4H9Q A;  4EU1 A;  5BNX B;  3FFH A;  1BKG A;  3AYW D;  4J8V C;  1N31 A;  3PDB A;  3AV1 C;  4AWL B;  1M18 C;  3QM2 A;  1KX3 A;  2NQB A;  1RV4 A;  1M0P A;  1WKH A;  1U08 A;  1YOO A;  4ZBJ B;  1OHW A;  3ATH A;  3AZH A;  2BWP A;  4XUJ D;  4M2J A;  2R5C B;  4A6T A;  2ZP7 A;  1P3L C;  2ZUK A;  3KWQ B;  4H9O A;  3AZK C;  1IX8 A;  3REJ B;  3W97 C;  4ITG A;  1P3A D;  5GSU D;  5KDM A;  3AZI A;  4Z5T C;  1W2E A;  3C1C B;  3AV1 B;  5AV9 B;  2ARO C;  3FQA A;  2VIA A;  1P3K A;  3O62 C;  1CJ0 A;  1AKB A;  2VMV A;  5B24 B;  2JJG A;  5TF5 A;  3LY1 A;  1G7X A;  1PMO A;  3UTB D;  4G92 C;  1GEX A;  4W1V A;  3REH D;  4ZAH A;  5K8B A;  2VLH A;  3LWS A;  1F66 A;  3BCA A;  5AV6 C;  5AV5 D;  5G09 A;  3NX3 A;  2D65 A;  4F5I A;  3MC6 A;  1WYV A;  4OYT A;  1HTA A;  3LEL D;  1P3F B;  1P3M A;  5CP6 D;  3P5J B;  3Q8N A;  3ZRQ A;  4YM6 D;  2EYQ A;  4QLC A;  4R8P D;  3C1C C;  2FYF A;  1G4V A;  3CQ6 A;  4AO4 A;  5AY8 C;  5B32 G;  2FJ7 D;  2V1P A;  5EAA A;  4AOA A;  4ZDO A;  2AY9 A;  4MY5 A;  1OHV A;  3NYS A;  3UWC A;  4A72 A;  5B1L A;  1KX3 B;  5DNN D;  2Z9U A;  4G92 B;  2AEU A;  3KUY C;  2PO3 A;  2GMU A;  2YCT A;  2XD5 A;  2D64 A;  3WKR A;  4H9R A;  4LC3 A;  1GC4 A;  5CP6 C;  3AEN B;  4A00 A;  1JG8 A;  4B98 A;  8AAT A;  3AZH D;  4WNN A;  4WU8 B;  5CPK D;  5B0Y B;  3AZJ B;  5DNM C;  2VGZ A;  3REK D;  2ZY3 A;  2VGS A;  3MKJ A;  5AVB C;  5E5A D;  1ASG A;  3W99 A;  1UU2 A;  2YHK A;  1ZLA D;  3DR7 A;  5AVC B;  1Z3Z A;  1GBN A;  5BJ4 A;  1XI9 A;  1M1A D;  1ASF A;  4XUJ C;  1I43 A;  1MAQ A;  1TZY A;  2JGT A;  3V9R B;  4J8U D;  3MAD A;  2F8N G;  2RFV A;  1P3K D;  2AY8 A;  3W96 A;  4JJN C;  2GMS A;  5C3I C;  3FCR A;  2DR1 A;  3UAK A;  2Z9X A;  1DJE A;  3DYD A;  5GT0 B;  3X1V C;  2W8S A;  5B32 A;  1ECX A;  2CAN A;  4BA4 A;  3WY7 A;  3A9X A;  1N1J B;  3AZL C;  5IWQ A;  5AVB D;  3I5T A;  5B32 C;  1AOI C;  5AV5 A;  3REL C;  1LC7 A;  1I48 A;  4MQP A;  4LD9 D;  1FG3 A;  1M0Q A;  3LJA A;  2O7C A;  2AAT A;  9AAT A;  1YJS A;  2BIE A;  3AYW C;  2QBT A;  3LZ1 D;  3NQU B;  1KKP A;  1B5O A;  3REI D;  1AAM A;  2TPL A;  1S32 C;  3MGP C;  3WAA C;  4W1X A;  4XUJ B;  2G7J A;  3RI6 A;  2YRI A;  1GC0 A;  3KE3 A;  4WXG A;  4ADB A;  3KWQ D;  4CSR B;  3EI7 A;  1P3O C;  1AHE A;  2QMA A;  3F6T A;  1P3O A;  4RLG A;  5FT4 A;  1QGN A;  3X1V B;  1I29 A;  2JG2 A;  2FKI A;  1M32 A;  2YKU A;  4OT8 A;  3AZL A;  3AZN B;  3MVD A;  3UTB B;  5AY8 D;  2R0T A;  3A1K A;  1ZOB A;  3MGP A;  5BO0 B;  2Y2O A;  1O4S A;  4IW7 A;  1M0N A;  4K2I A;  4NOG A;  3O62 B;  4H9R B;  1KX4 D;  4E45 A;  5CPI D;  3ELE A;  5B40 C;  2R5E A;  4WYA A;  1C9C A;  4WYE A;  5DNN C;  4JF0 A;  5B2I C;  4J8W D;  3MNN C;  3WTP E;  1ZC9 A;  4Z5T B;  3X1U D;  5AV5 C;  4NE3 A;  3V9R A;  5E5A B;  5FT6 A;  4ADC A;  3E2Z B;  1KKJ A;  2HP2 A;  3B0D C;  3AAT A;  3NYU A;  1KU5 A;  3LEL B;  3C1C D;  4FFC A;  5GT3 B;  1HQ3 C;  2F8N D;  3FQ8 A;  1M19 A;  1EQZ A;  5FUG B;  1XEY A;  2OQX A;  1CQ7 A;  1EQZ C;  5B40 A;  4RJY A;  4XAU A;  4A0F A;  2EH6 A;  4WU8 D;  3AV2 D;  5GSU C;  1CL2 A;  1AIC A;  2YKY A;  3WTP A;  1AMR A;  2BYM B;  4WBT A;  4ADE A;  3EI5 A;  1P3A A;  1KX5 D;  3AZM C;  2W7E A;  1ASE A;  4ZLV A;  3ZZK A;  3E6G A;  1U35 C;  2Y2L A;  5B0Z B;  4DGT A;  1P3K B;  1BH8 A;  3C1B D;  3REI A;  1AHG A;  3N4S A;  4MKK A;  4RKC A;  2HUF A;  1BJO B;  1U35 D;  4ATQ A;  3HVY A;  2X3L A;  3KWQ A;  3VOM A;  1IJI A;  4GDY A;  1KX5 C;  1C0N A;  5EQC A;  3BWN A;  1N2T A;  1ASL A;  2W8J A;  3LEL A;  5AX8 A;  2CJH A;  3AZH B;  2WB6 A;  4WLJ A;  4Z66 C;  1F66 C;  5CP6 A;  1S32 A;  3NQU A;  5AY8 A;  3MVD C;  3AZM B;  3D6K A;  3VK4 A;  1PFF A;  3LJA C;  3KGW A;  5BNX A;  2D7Y A;  5FT5 A;  4J8W A;  4YS3 A;  1IX7 A;  1P3P C;  5EIG B;  4G91 C;  4Y0H A;  1ID3 B;  5E3K A;  5CPJ B;  2L5A A;  3AV1 A;  1IVR A;  4WB0 B;  1ARG A;  2E54 A;  4IY7 A;  2CTZ A;  2GQN A;  4LNJ A;  4QLC C;  1P3B C;  3REJ C;  3W97 B;  2A1V A;  1P3G D;  3N4R A;  3QGU A;  5F8V A;  1LC8 A;  3FFR A;  1M19 D;  2G5H C;  4OMA A;  3QN6 A;  2W7H A;  3AEM C;  2Z1Z A;  1ELU A;  2HOY A;  5BT1 C;  1J04 A;  4ZM4 A;  1P3P B;  1ORD A;  1QZ9 A;  2VMR A;  5CPK A;  3VH6 T;  3LZ0 D;  3T32 A;  1WWS A;  5F99 C;  2X5F A;  3AZE B;  4WU9 B;  2AY1 A;  1D7U A;  4H51 A;  2RVQ D;  3NU8 A;  2JIS A;  2HIO B;  1C7O A;  1F1E A;  1SZU A;  3EZ1 A;  3NDN A;  5AVC C;  1QIS A;  5HDM A;  1AIB A;  3VH5 T;  3AZN C;  5EIG A;  3LZ1 B;  4JEX A;  3G8M A;  3PDX A;  4YS3 B;  3EPJ A;  1GEY A;  1I41 A;  3AZL B;  3AZN A;  4HF8 A;  5GT0 A;  1AHX A;  5D5S A;  1GEW A;  5GT0 C;  1AJS A;  2PB0 A;  5B2J A;  2BYL A;  4KUD D;  5DJ9 A;  3A9Z A;  1AOI D;  4PFN A;  2W8W A;  5AV8 C;  5GXQ B;  5EAV A;  2W7G A;  2EPJ A;  4KAM A;  5B2J B;  2D7Z A;  3LJA D;  3VH6 A;  4JEY A;  4A0H A;  3X1U B;  1MAP A;  4ZUX D;  1BJO A;  3WA9 B;  5HHY A;  1YJY A;  3W1J A;  5CHL B;  4XK1 A;  3H9X A;  3M5U A;  3P6K A;  2XBN A;  1ID3 A;  5AV6 A;  1M1A C;  2VMS A;  2W7J A;  5B0Z A;  2O1B A;  2W7D A;  4IYO A;  3COG A;  3MAF A;  4A0R A;  2YFW B;  4RAE A;  3DXW A;  4R5F A;  5CPI B;  4U2H A;  1P3L A;  3MGQ B;  1E5F A;  3PPL A;  2VMX A;  3NUB A;  4W1W A;  1YNU A;  2CJD A;  1P3P A;  4R2N A;  5GXQ C;  3B6F C;  3WX9 A;  1M18 A;  2QB2 A;  2AY5 A;  2D66 A;  1S0A A;  4J8L A;  4UQV A;  4IXS A;  3GZD A;  3AZJ A;  1PZR A;  4W8I A;  5E5A C;  4OBU A;  4WV4 B;  1SZS A;  4EMY A;  4Z66 A;  3FTB A;  2NZD C;  3NYT A;  1JS6 A;  1RVY A;  4Y0I A;  1EG5 A;  5EUD A;  3HLM A;  5B33 C;  3AEJ A;  1EQZ D;  2BI1 A;  3BV0 A;  4Z5T A;  5B40 D;  5CPI C;  2BKW A;  3PD6 B;  3RBL A;  1KX5 B;  1P3W A;  3MGR A;  1X29 A;  4F4E A;  3A6N D;  3O62 A;  4W5K A;  4WXB A;  2AY2 A;  5G2Q A;  2ARO A;  3AZM A;  2Y2P A;  4GE4 A;  3MGP B;  1JS3 A;  1ASC A;  2ZYJ A;  3EI6 A;  3MVD B;  3BCX A;  3HL2 A;  3RBF A;  3KGX A;  5BNV B;  5B31 G;  1H3O B;  2WK8 A;  3K28 A;  3MBB A;  4CXR A;  3UTA B;  3NNK A;  3WA9 C;  1M19 B;  1W3U A;  1U35 B;  4H9P B;  3AZE D;  3LVM A;  5GXQ A;  3UTB C;  1ID3 C;  3NU7 A;  3E9K A;  3KSY A;  5DB5 A;  1WWI A;  4HGA B;  3FSL A;  2BWO A;  3VH5 A;  2YKV A;  3RCH A;  3GBX A;  4LD9 C;  1F66 B;  5M49 A;  4J8X A;  3H7F A;  4ITX A;  5B0Z D;  2LY8 A;  3AFA D;  4KGC C;  5AV8 A;  1MGV A;  4H9Q B;  1SF2 A;  1LKC A;  1P3L D;  1AMA A;  1D7R A;  3ECD A;  1S32 D;  3MGS B;  3AV7 A;  3NTJ A;  4WZS B;  2VGW A;  3TFU A;  3GJU A;  3B6F B;  1E5E A;  4A0G A;  3EIB A;  5M4B A;  2FFF B;  2DQN C;  3UE8 A;  3DR4 A;  3AZF D;  1P34 B;  4AZK A;  4Q75 A;  3ZRR A;  2EGY A;  1GDE A;  3N5M A;  1M18 D;  4XZQ A;  2ZY5 A;  4IXO A;  2GB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...