2ZY3A

Dodecameric l-aspartate beta-decarboxylase
Total Genus 189
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
189
sequence length
510
structure length
510
Chain Sequence
ELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-aspartate beta-decarboxylase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
total genus 189
structure length 510
sequence length 510
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy3A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy3A01
1S08A 2D5YA 4AO4A 1W7LA 2VI9A 3BN1A 3DRDA 3FKDA 4JF0A 1MAPA 2QLRA 3MADA 1WYVA 4OMAA 4PIWA 3WY7A 3GR9A 3JW9A 3LVLB 3GJUA 5EQCA 1RV3A 1H1CA 1ORDA 4JEYA 2VMQA 1LC5A 3FTBA 1WKGA 2W7GA 2D63A 2OATA 2VMZA 2JG2A 5M49A 3WGBA 2BI9A 4RKDA 4MQRA 1ELQA 1ARTA 4CVQA 1JS6A 3CQ5A 4W1WA 4WYAA 3WKSA 2ZSLA 4ZM3A 4ZDLA 3H7FA 1QITA 4K2IA 2CH1A 4ZSWA 3A9XA 3BCXA 5EFSA 1ASGA 3A2BA 3NX3A 2D61A 4ATQA 1I43A 2VMNA 1O69A 1MAQA 4IXOA 1YNUA 1O4SA 4BQ0A 4Y0IA 2BI1A 4ZWMA 4R8DA 4XJOA 3PJ0A 1G4XA 2VGUA 1M32A 3LVJA 1VJOA 3PDBA 5G2PA 3MC6A 4AZKA 3ZZKA 2O1BA 4ITGA 4IXZA 1M4NA 2WKAA 2OGEA 1GBNA 3TCMA 5M4BA 1ZODA 1SZUA 3JWBA 4PFNA 4PVFA 3PAAA 1BJOB 4RJYA 2W7MA 4W91A 2DKBA 1IAXA 5DX5A 3WKRA 3CQ6A 4XAUA 3VK4A 3K7YA 3P6KA 4GEBA 4WYFA 2QB3A 3E2ZA 2HP1A 2QBTA 4E77A 3CQ4A 3NUBA 1B4XA 2AY7A 4F5IA 1JG8A 2AY4A 1CQ6A 1QZ9A 2R5CA 2ZYJA 3FRKA 3KKIA 4RAEA 3AOVA 5F9SA 3N5MA 3IHJA 4M2KA 1ZOBA 1BJNA 2AY2A 3LVMA 2W8VA 5EUDA 2VMSA 1GD9A 1LS3A 3EI6A 1AAMA 2PB0A 3BC8A 3OKSA 1DFOA 5HDMA 1V2EA 2YRRA 4E3QA 1WYUB 2PO3A 3ACZA 4KAMA 5G09A 1VEFA 1YAAA 2CSTA 5BJ4A 2W7FA 4P7YA 3LY1A 4EB7A 1AHFA 5M46A 1B5PA 1DGEA 2WK7A 3FDBA 4CBRA 4ITXA 5F8VA 3NYTA 4A0GA 2VGZA 2YCNA 4E1OA 1CQ7A 1V2DA 1YIYA 1AICA 5J8QA 1AX4A 1OHVA 4LW4A 4U2HA 2W7DA 1O61A 1LKCA 4ZDOA 1AKAA 2C81A 1N8PA 2VMXA 5FT4A 1IX7A 8AATA 5EUEA 1OATA 4W5KA 2WK9A 1BJWA 2AY9A 2Z9VA 4IXSA 4R2NA 4XJLA 3VOMA 1GEXA 3ECDA 5DJ1A 2ZSMA 4CXQA 5G4IA 3F6TA 1DJEA 4N0WA 4ZASA 2E7JA 2BIEA 1ARGA 1ARHA 1W7NA 2G6WA 3PPLA 1MGVA 1WSTA 2D65A 3ELEA 2WK8A 1AKCA 1ZC9A 3E2FA 2CTZA 2AY6A 4LNJA 1I48A 5K8BA 2OGAA 1AHYA 2V1PA 2OQXA 2VIBA 2VYCA 1D7UA 2GMUA 5EUNA 3F0HA 1BJOA 1FG3A 1CQ8A 1N31A 1U08A 1JS3A 2EO5A 2C7TA 1AMRA 4WBTA 2HOZA 2EZ1A 3DYDA 1T3IA 3E9KA 1IAYA 2YCPA 4WD2A 1MLZA 1CS1A 1EG5A 1QIRA 3R4TA 1OXPA 1X2AA 2D7YA 1IBJA 5E3KA 3NDNA 4ZDPA 1GC3A 3KE3A 4DQ6A 5E4ZA 1YIZA 4E3RA 2CY8A 4A6RA 5D95A 1AIAA 2Z9UA 3KGXA 1ASDA 3TQXA 3BV0A 7AATA 2BIGA 3AEMA 2R0TA 3M5UA 4GE4A 1G7WA 3B8XA 4GRXA 4ADBA 1YJSA 2HZPA 3E2YA 1GCKA 4GDYA 4JEVA 3VAXA 2VGVA 1AMQA 1SZKA 1C4KA 1FG7A 1G7XA 1KL2A 1WYUA 2W8TA 3EIAA 1S07A 2Z61A 3K40A 4JEZA 4BA5A 3DXVA 1CZEA 4XJMA 3ASAA 4EU1A 4IY7A 3R9AA 1M0NA 4OCAA 2BHXA 1N2TA 1KKPA 3DR7A 2CJGA 3NU8A 5G4JA 4A00A 2BI5A 5HXXA 2FNIA 1C7GA 1AMSA 4L0OA 4ZAHA 4TN4A 2Z9WA 4F5HA 1X29A 4AO9A 3MKJA 2CB1A 1WKHA 2FN6A 4IYOB 1D7RA 1BKGA 4XEWA 1AIBA 3TFUA 1GC0A 4UHMA 2DOUA 1SF2A 1UKJA 2D66A 4MQPA 2VLFA 3VK2A 3NUIA 2VMVA 3BWNA 3ASBA 1ASFA 4RKCA 1QGNA 2BKWA 2VIAA 3EIBA 2CANA 1RVYA 3N75A 4WXFA 5JAYA 4UHOA 4OTLA 3A9ZA 4F4EA 2YCTA 2JJHA 3FVUA 5I92A 2GQNA 2HOXA 3RBFA 1AAWA 4BA4A 1ASAA 1KKJA 1AY4A 2FM1A 2XH1A 3A8UX 4WYDA 1FC4A 4XQ2A 3K28A 4FFCA 4A0RA 1DJ9A 4IX8A 4ISYA 3AELA 1C9CA 1GDEA 3WZFA 1E5FA 3FQAA 3L44A 3Q8NA 3GSBA 3LWSA 4Q75A 1YJYA 2CFBA 4ZM4A 3DZZA 3BB8A 3RBLA 4I8AA 4F5FA 4AH3A 2Q7WA 1ASBA 5FT6A 3WX9A 3P1TA 1OXOA 1I29A 3ZRPA 3GZDA 3UWCA 4WLJA 1GEYA 4JF1A 1LK9A 1YJZA 4MSOA 2DR1A 4Q76A 4UOYA 2W7LA 2W7EA 2YOBA 1QJ3A 3EUCA 5EAVA 3HMUA 3EI8A 4W8IA 1ELUA 2QB2A 4JEWA 4NOGA 4ADDA 2AY5A 2VMTA 1M6SA 2W8UA 4WXGA 4FL0A 2X5FA 4KYOA 1GC4A 1CZCA 3ZRQA 3B1DA 4J5UA 3USFA 2FNUA 3EI9A 4OYTA 1CJ0A 1SZSA 3AEMC 4W1VA 5TF5A 5AX8A 4IW7A 1BW0A 1TOIA 4F5KA 3DODA 1V2FA 3AOWA 3T32A 1Z3ZA 3NU7A 3OP7A 5EAAA 2D64A 3CBFA 1ASMA 2ORDA 1ASCA 3G8MA 3MBBA 4A0FA 1Y4IA 3E77A 1LC8A 4MKJA 2E7UA 3RUYA 1RVUA 4HVKA 1BQDA 1QISA 2R2NA 2X8UA 1PFFA 2VGTA 4F5MA 2GSAA 1AKBA 2QA3A 3QN6A 1AJSB 2FQ6A 2X5DA 4GE7A 2HORA 3LG0A 2BYLA 2O0RA 3N0LA 3D6KA 3MAUA 2XBNA 4P3MA 4ATPA 2ZY2A 4DBCA 1E5EA 3PDXA 4IYOA 4A6TA 1EJIA 3PD6B 4WB0B 3AV7A 1SVVA 1M7YA 2BWOA 3BS8A 1MDXA 3BWNC 4ADEA 1ASLA 1TOEA 1WYTB 4EB5A 1TOKA 1P3WA 4PFFA 3AEJA 1H0CA 2HUIA 2Z1YA 3UAKA 1BJ4A 4ADCA 4GE9A 1SFFA 3COGA 3ELPA 1W3UA 1W23A 2YKYA 3RI6A 1X0MA 4EMYA 4Y0HA 5DB5A 1JF9A 3EZSA 1KL1A 4R5ZA 3ISLA 3TFTA 1DKAA 2C0RA 2R5CB 3MAFB 1Z7DA 2O7CA 1TARA 4WLHA 1C7NA 2V0YA 3GZCA 2VMUA 2TPLA 2C44A 3GZDC 9AATA 4DGTA 4A6UA 1UU1A 3I4JA 4A72A 1M0QA 1ARIA 4M2MA 4MKKA 4WXBA 4BHDA 4LW2A 2RFVA 2GB3A 2HUUA 1ARSA 1KMJA 2ZUKA 5E5IA 4CXRA 4MY5A 5BJ3A 3AEPA 1TOGA 3TATA 3B1EA 4F5GA 1S09A 1DGDA 2EGYA 1B9HA 1S0AA 1TATA 1RV4A 3FVXA 3LV2A 2EPJA 4H51A 4UQVA 3AATA 3LVKA 1AY5A 1M0OA 3MEBA 4F5JA 4WYEA 3F9TA 3RCHB 3E6GA 1TPLA 2CJDA 1DJUA 3HLMA 1AJRA 2W7IA 3DR4A 3NNKA 3ZRRA 2QMAA 3PGYA 4CBSA 2YRIA 4TMRA 3HDOA 3FCRA 1VP4A 2W8WA 5C6UA 2JGTA 1OHWA 2EZ2A 3BWOA 3RQ1A 1AJSA 2YKVA 2BYJA 2E7IA 3BCAA 5G0AA 4MQQA 1C7OA 4ZSYA 4K2MA 4OT8A 1IVRA 4Y0DA 4LC3A 3NTJA 1B5OA 2VMYA 2W7KA 3PD6A 4WB0A 3AENB 3AEJC 4LNLA 3DC1A 3EI7A 1WYTA 2JJGA 2YKUA 3QBOA 1D7SA 1AY8A 1B9IA 2HUFA 5DJ9A 4Q6RA 2ZJGA 2Z20A 5EIGB 3GETA 3FFRA 4KXKA 1BT4A 3B1CA 4XJPA 1CL1A 2VGSA 4WP0A 3QI6A 3NRAA 1D2FA 4R5FA 5FT5A 1ASNA 1B8GA 2BWNA 4UHNA 3MAFA 4B9BA 2ZY4A 5IWQA 3GBXA 2BI3A 1IUGA 3EI5A 4WYGA 3B46A 5G2QA 1WYVB 3ATHA 3QHXA 3PA9A 1D7VA 2ZC0A 3UE8A 2BIAA 2ZY5A 2DKJA 4AOAA 2W7HA 4F5LA 2AY3A 1CL2A 3L8AA 2F8JA 2ZY3A 4LNMA 4JEXA 3NYUA 1LC7A 4OC9A 1TASA 2VI8A 3HL2A 1M0PA 3G7QA 5HHYA 4W1XA 2BI2A 1AHEA 3WLXA 3DU4A 2ZP7A 1IX6A 1MDOA 4XK1A 2HOYA 3CAIA 1S06A 1I41A 3VK3A 2JJEA 1UU2A 1AMAA 4AZJA 4GSAA 2PB2A 1G4VA 2JJFA 1AHXA 1ASEA 3HQTA 4B98A 3RCHA 3PDBB 1LW5A 4QGRA 2VMPA 1MDZA 1KMKA 1LW4A 3JTXA 3II0A 1GEWA 2AY8A 2CINA 3PIUA 3FQ7A 4K2BA 1C0NA 1J04A 1ECXA 1DTYA 2YKXA 3FDDA 2E54A 2CJHA 1XI9A 3QGUA 3NYSA 1AHGA 1O62A 4HF8A 2VGWA 3KGWA 2HP2A 3WGCA 4BMKA 3DXWA 2VMRA 3I5TA 3QM2A 4Q31A 3FSLA 5D5SA 1YOOA 5M4DA 4ZWVA 1QJ5A 3FFHA 1EQBA 2CH2A 2W7JA 3E2ZB 1BQAA 2R5EA 3MC6C 2BWPA 2NMPA 1IX8A 3AENA 2VMOA 2VMWA 2W8JA 1IJIA 2D7ZA 4U1TA 1MLYA 2GMSA 1X28A 2FYFA 3EZ1A 3FVSA 1PG8A 4ZLVA 3A9YA 1TOJA 3ZZJA 1UU0A 2Z9XA 4A0HA 1J32A 3FQ8A 3AEOA 5EIGA 2AY1A 4O6ZA 1BS0A 2EH6A 4M2JA 1GC2A 4WYCA 3BCBA 2YHKA 1V72A 2VLHA 1SPAA 5FT8A 1OHYA 3QPGA 4EFFA 2Z1ZA 1W7MA 3JWAA 2AATA
chains in the Genus database with same CATH superfamily
1M1AC 2VI9A 3BN1A 1MAPA 3MADA 1WYVA 3GR9A 3LVLB 3X1VC 5EQCA 1ORDA 5F99C 4JEYA 2VMQA 3FTBA 2JG2A 1KU5A 3WA9B 1HQ3B 3O62C 1ELQA 1ARTA 3AZJA 4J8VD 4YS3D 2CH1A 4ZSWA 3LJAC 3B6GC 5EFSA 3A2BA 1ID3C 1I43A 5CP6C 2BI1A 4R8DA 4XJOA 1G4XA 1BH9A 1VJOA 5G2PA 2RVQD 4IXZA 3MGQD 1T3UA 5DNMB 1GBNA 3TCMA 3JWBA 4RJYA 4W91A 2HIOC 3MNNB 5DX5A 3VK4A 3K7YA 3P6KA 2QB3A 2QBTA 3UT9A 3CQ4A 4Z66D 3WA9D 3FRKA 3KKIA 4RAEA 3AOVA 2AY2A 3RELB 3KWQC 1LS3A 3C1BB 4LD9A 3W99A 5CPKD 2PO3A 2CSTA 4H9SA 1P3KB 3X1SB 2W7FA 5B1MA 3V9RB 5DNMD 3FDBA 4ITXA 4A0GA 5JRGB 1CQ7A 5GXQC 5J8QA 1OHVA 2W7DA 1P3MB 2IO5C 5FT4A 4R2NA 3ECDA 3AZIB 2F8NG 5DJ1A 1DJEA 4ZASA 3RELD 3NQJA 3LZ1B 1ARHA 3C1BD 3AZKD 1WSTA 1AKCA 1ZC9A 3AZHB 2L5AA 1I48A 2VIBA 1P3KD 1D7UA 3X1SD 4J8UC 3I16A 2JE5A 1JFIB 1U08A 1JS3A 3KUYC 1AMRA 5C3IB 3DYDA 1Z2CB 1T3IA 3E9KA 2YCPA 5JRGD 4WD2A 1CS1A 1OXPA 1X2AA 2D7YA 1IBJA 5E3KA 2Y2JA 5E4ZA 5KDMB 2OKJA 2F8NK 3KGXA 2YFVB 3LELC 1P3LD 3AEMA 2R0TA 1M18B 3B8XA 4GRXA 1YJSA 2HZPA 3AZID 1GCKA 4JEVA 1C4KA 4H9QA 1M0NA 4OCAA 2BHXA 1P3GC 3AZHD 2BI5A 5GT0C 4ZUXA 4ZAHA 5BNXA 4F5HA 1X29A 1WKHA 3FZ8A 1D7RA 1BKGA 5B0ZC 3B6FC 3W99D 1S32B 3NUIA 2VMVA 4CSRB 3MGPA 2BKWA 2VIAA 3GWPA 4WXFA 4UHOA 3C1CB 3A9ZA 4F4EA 5G49A 2JJHA 5AVBC 2HOXA 4NFTA 2F8NA 1ASAA 4UUZB 2XH1A 3A8UX 5B31G 3K28A 2G5IC 1M18D 3AV2B 3WZFA 3FQAA 3AZLC 1KX3A 4ZM4A 4I8AA 4AH3A 3REHA 1OXOA 1I29A 4WLJA 2DGLA 2Y2GA 2DR1A 4UOYA 5B1LB 2W7LA 2W7EA 2Y2MA 3WTPD 3EI8A 4JEWA 4NOGA 3REKD 1M6SA 2W8UA 5GT3B 3ZRQA 1KX4C 3B1DA 1S32D 1CJ0A 3EPJA 4IW7A 5B0YB 1BW0A 4KUDB 3C1CD 2PYOB 2Y2QA 5EAAA 3AYWC 3WAAA 1ASMA 3G8MA 5B33B 4A0FA 4MKJA 3KXBC 1RVUA 2R2NA 3AV2D 3P5JB 2GSAA 3MGRA 2QA3A 1AJSB 4GE7A 2O0RA 4DBCA 4IYOA 1EJIA 1B6WA 1M7YA 3AN2B 5B1LD 4EB5A 1TOKA 2HUIA 5GT3D 4YM6A 3B0DC 1W23A 4R8PA 4KGCB 5B0YD 4KUDD 4Y0HA 5DB5A 1JF9A 3AZFC 4XUJB 5B31A 3ISLA 2PYOD 2FJ7A 5B33D 2F8NH 2O7CA 4WLHA 3GZCA 1H3OA 1M1AB 1KX5A 3GZDC 4A6UA 1UU1A 3MGSA 3X1VB 1M0QA 3REJB 5F99B 4LW2A 3O62B 2ZUKA 5B24A 4J8XA 5E5IA 2AROA 1P3OA 3TATA 4F5GA 2EGYA 1S0AA 3LJAB 3B6GB 4DRBA 3LV2A 4UQVA 4WNNA 1ID3B 1M0OA 3RCHB 1TPLA 1P3PA 5CP6B 4K05A 3DR4A 3NNKA 4XUJD 2YRIA 4H9RA 3HDOA 1P3AB 3AV1C 2BYJA 2E7IA 2YFWA 1C7OA 4OT8A 3TU4A 5AVCA 3AZMC 2VMYA 2W7KA 3PD6A 3REJD 3AENB 5DNNA 2ZM5A 3AEJC 2YKUA 3O62D 3QBOA 5AV6C 5B2IC 3W97A 3UTBC 3MGRD 2Z20A 3B6GD 3KWQB 3NRAA 1ID3D 5B2JC 4R5FA 5FT5A 1ASNA 4UHNA 2ZY4A 5CP6D 3MVDC 5IWQA 3X1TC 2BI3A 4WYGA 2NQBC 2BYMB 3AZGA 3QHXA 3PA9A 1P3AD 4WU8C 2ZY5A 1AOID 2DKJA 3W1JA 5GXQB 2AY3A 3L8AA 4Z5TC 1LC7A 4OC9A 2IO5B 5HHYA 1AHEA 2ZP7A 1KX5D 4AZJA 3W96A 1F1EA 1P3FA 1AHXA 1TAFA 1ASEA 4B98A 3AFAC 4K2BA 2AY8A 4M6BA 2CINA 1C0NA 3HVYA 2E54A 2CJHA 1O62A 2VGWA 3KGWA 4BMKA 4J8UB 2VMRA 4Q31A 5D5SA 3KUYB 2W7JA 2R5EA 2NMPA 5GXQD 2VMWA 2W8JA 4H9PB 3UTAA 2GMSA 1X28A 2FYFA 1PG8A 3ZZJA 1UU0A 2Z9XA 4A0HA 2G7JA 3LELB 2G6WA 2D5YA 4AO4A 1W7LA 1F66A 3FKDA 1ZLAC 4JF0A 3LZ0C 4QLCA 3WY7A 3JW9A 1N1JA 1WKGA 2W7GA 2D63A 2VMZA 5GT0B 5M49A 3WGBA 4J8UD 2F2AC 4W1WA 3CQ5A 2Y2LA 3KUYD 5B0ZB 3B6FB 3H7FA 3A9XA 3BCXA 2VMNA 1O69A 5B40C 1MAQA 4IXOA 5AVBB 4AWLC 3LELD 3REIC 5BS7A 1M4NA 3EPKA 3AZLB 3H0MC 4NE6A 4PFNA 1IAXA 3CQ6A 4XZQC 2HP1A 5GT0D 1JG8A 2R5CA 4YS3A 2J8PA 5F9SA 3N5MA 1KX4B 3B6FD 3LVMA 1GD9A 1AAMA 2PB0A 3OKSA 1DFOA 5HDMA 3MGQA 3AYWB 5AVBD 3ACZA 5CPID 4G92C 4G91C 3KXBB 1AHFA 2LY8A 3FZ7A 3NYTA 3AZLD 2VGZA 2YCNA 1V2DA 4Z66A 1YIYA 2HUEC 3WA9A 5AV9D 4U2HA 1LKCA 4ZDOA 2OKKA 5CPJD 2VMXA 8AATA 1EQZC 2AY9A 4IXSA 4XJLA 3B0DB 1KX4D 2G5HC 5CPKA 3F6TA 3FZ6A 1MGVA 3ELEA 3AZFB 3E2FA 5BNVA 5DNMA 3MGPC 4LNJA 3AYWD 2OGAA 1AHYA 2VYCA 2OQXA 5AY8C 5EUNA 3KXBD 1CQ8A 3MNNA 2C7TA 2HOZA 1MLZA 1EG5A 1QIRA 3R4TA 1KX3C 3NQUB 2JSSA 1GC3A 4DQ6A 2A1VA 2JISA 1ASDA 3TQXA 7AATA 3RELA 2BIGA 4ADBA 3C1BA 3AZKA 3VAXA 5B32C 2VGVA 1AMQA 1SZKA 1G7XA 1S07A 2Z61A 3K40A 4JEZA 1P3KA 3DXVA 4XJMA 3X1SA 1PMMA 3AZFD 3V9RA 3AV1B 5JRGA 4L0OA 4TN4A 1W2EA 4AO9A 3AZNC 4XEWA 2FKIA 3AZMB 1SF2A 1UKJA 4MQPA 2VLFA 3BWNA 1RVYA 1P3LA 5AV6B 5B2IB 3AZIA 3UTBB 3RBFA 1AAWA 4BA4A 1KKJA 1FC4A 4FFCA 5E5AC 2Y2HA 3LZ1A 4ISYA 1HQ3D 5B2JB 1BH8B 3LWSA 3AZHA 2CFBA 3DZZA 3BB8A 3RBLA 4F5FA 3MVDB 2Q7WA 3X1TB 2NQBB 1A7WA 3UWCA 4R8PC 1JFIA 4JF1A 4WU8B 3AV1D 1LK9A 4MSOA 1QJ3A 3EUCA 2FJ7C 4W8IA 1ELUA 4Z5TB 1GC4A 3W98C 4H9OB 3AZMD 2X3LA 2FNUA 5TF5A 2YFVA 5AX8A 4F5KA 3DODA 5AV8C 5AV6D 5B2ID 1M18A 3NU7A 3CBFA 3MNND 2ORDA 1ASCA 3MBBA 3AFAB 2E7UA 3RUYA 1M19C 1BQDA 4F5MA 4WU9C 1AKBA 3QN6A 3LG0A 3N0LA 3X1TD 3WTPA 3MAUA 2XBNA 3REKA 3HT4A 2ZY2A 4P3MA 1E5EA 3N4SA 4A6TA 1BH9B 4WU8D 3AV7A 2BWOA 1WYTB 1S32A 4CSRA 3IP4C 1U35C 4Z5TD 3C1CA 1SFFA 2YKYA 4UUZA 1X0MA 5DNNC 3EZSA 1KL1A 3AZEC 3AV2A 2C0RA 3MAFB 2WB6A 1P3MD 1TARA 3AFAD 2VQRA 3W97C 2VMUA 2C44A 1ZLAB 3LZ0B 2XD5A 3I4JA 1ARIA 4WXBA 4BHDA 5B1LA 2HUUA 4DRAA 4JJNC 3WTPE 5GT3A 3LZ1D 1DGDA 1TATA 5B0YA 4KUDA 2PYOA 5B40B 3F9TA 3G0TA 3E6GA 4AWLB 5B33A 3REIB 1AJRA 3ZRRA 2QMAA 3FCRA 2W8WA 5C6UA 2EZ2A 1AJSA 2YKVA 3W96C 5G0AA 4ZSYA 4K2MA 1ZLAD 1P34C 1IVRA 3LZ0D 1B5OA 4XZQB 3DC1A 3EI7A 1D7SA 3X1UC 4Q6RA 3N7NA 5AV5C 2VGSA 3QI6A 4XUJA 5B40D 2BWNA 3A1KA 4G92B 4G91B 1IUGA 2NZDC 3UE8A 3REJA 5F99A 3VP6A 4F5LA 2HUEB 2ZY3A 4LNMA 3O62A 4JEXA 5JA4B 1TASA 1M0PA 1F66C 2BI2A 3DU4A 1MDOA 1S06A 1I41A 1EQZB 3VK3A 3B6GA 2CV5B 1ID3A 1KAFA 3RCHA 3PDBB 1LW5A 4QGRA 5CP6A 3JTXA 3PIUA 1DTYA 3MGPB 1P3AA 2YKXA 3QGUA 1XI9A 1AOIA 4HF8A 5AY8B 3DXWA 3I5TA 3QM2A 5M4DA 1EQBA 3E2ZB 3WCNA 3AENA 2VMOA 1KX3B 3FVSA 5BO0B 4ZLVA 5FUGB 4DQYB 1EQZD 2KFPA 2CV5D 4J8VC 3JZLA 4WYCA 4X23C 5B32B 1V72A 4EFFA 1Q9CA 3JWAA 1AY4A 3AN2D 3DRDA 2BYMA 4J8WC 4OMAA 4PIWA 2QSRA 5AY8D 4KHAB 2OATA 3H0RC 3WKJC 2BI9A 5GXQA 1P3BC 4CVQA 5GSUC 4KGCD 3A6NC 3AZNB 4WYAA 3WKSA 4ZM3A 4ZDLA 4ZBJC 4K2IA 2FFFB 1P3IC 4ATQA 4H9NB 1M1AD 4Z66C 1O4SA 2HIOB 4Y0IA 3PJ0A 3X1VD 2VGUA 5F99D 4AZKA 5E5AB 2O1BA 5B32D 3PAAA 1BJOB 4J8UA 5CPKC 2DKBA 3LJAD 2CWEA 4R8PB 4GEBA 4WYFA 3KUYA 4E77A 3NUBA 2AY7A 4F5IA 2FJ7B 4H9PA 3AZND 3IHJA 1ZOBA 3W98B 1BJNA 1H3OB 1TZYC 2W8VA 3B0CT 2DGKA 3LELA 3BC8A 5AV8B 1V2EA 2YRRA 1WYUB 2HIOD 4KAMA 5BJ4A 3LY1A 1M19B 4EB7A 5E5AD 5M46A 1B5PA 2WK7A 5F8VA 4WU9B 4E1OA 3AZKC 5GT0A 3AZJC 4LW4A 3KWQD 1O61A 1PMOA 1AKAA 1N8PA 3B6FA 2W8SA 5EUEA 1OATA 2WK9A 2Z9VA 1U35B 1GEXA 3W98D 2ZSMA 4CXQA 5AVBA 5G4IA 5CPIA 2BIEA 3FD0A 3PPLA 5DNNB 2BYKB 2WK8A 3AZEB 5AV8D 2CTZA 1P3LC 3AZLA 3F0HA 1M19D 3W97B 5AV9A 4WU9D 3UT9C 2EZ1A 1IAYA 5CPJA 3NDNA 4ZDPA 4JJNB 2CY8A 3VH5T 1P3GB 1KX4A 1AIAA 3BV0A 4LD9C 1G7WA 3W99C 1U35D 4H9SC 1FG7A 3AYWA 3EIAA 5B1MC 4BA5A 3ASAA 3KXBA 3R9AA 1N2TA 3AZED 2CJGA 3DR7A 4H63Q 4RM1A 2FNIA 1B67A 1C7GA 3EPHA 3W96B 2Z9WA 3MKJA 2CB1A 2FN6A 1TAFB 1P34B 1AIBA 3TFUA 4UHMA 3VK2A 3ASBA 1ASFA 1QGNA 2CANA 5JAYA 3X1UB 2YCTA 3WTPC 2GQNA 3REKC 1P3GD 5AV5B 4XQ2A 4IX8A 1C9CA 1GDEA 1E5FA 3AZFA 3Q8NA 3GSBA 4Q75A 5B0ZD 1ASBA 3P1TA 3GZDA 1GEYA 2NZDB 1YJZA 2BG1A 2YOBA 3HMUA 4ADDA 2QB2A 1P34D 2X5FA 3NQUA 4J5UA 1F66B 1SZSA 3AEMC 3B0CW 3X1UD 1V2FA 3T32A 1Z3ZA 3OP7A 1HQ3A 2D64A 1Y4IA 3E77A 1LC8A 4EO5C 5AV5D 3B0BA 2Y2PA 4ZUXC 3AV1A 2X5DA 4KUDC 2HORA 2BYLA 3D6KA 4Z2MG 2AEUA 4ATPA 2NZDD 4WB0B 1MDXA 3AZMA 1ASLA 1P3WA 3AEJA 4ADCA 4CAYB 5AV6A 5B2IA 3ELPA 3UTBA 5BT1C 4EMYA 3TFTA 4R5ZA 4J8VB 1DKAA 2R5CB 4X23B 1BH8A 1Z7DA 3REHC 1C7NA 2TPLA 3X1TA 3EPLA 4DGTA 4J8WB 4A72A 2Y2OA 4WU8A 4M2MA 2RFVA 1ARSA 1KMJA 3WKJB 1P3BB 5GSUB 1PZRA 3KFUG 3A6NB 3N4RA 4Z5TA 5BJ3A 4H9OA 3AEPA 1TOGA 3B1EA 4ZBJB 3VH5W 1P3IB 1RV4A 2EPJA 3AATA 3REJC 1AY5A 3WAAC 3LVKA 3MEBA 4Z66B 4WYEA 2CJDA 1P3MA 3AFAA 2W7IA 1XEYA 3PGYA 3MGRC 1VP4A 4X23D 3R45B 3BWOA 3RQ1A 3BCAA 4MQQA 5CPKB 4J8WD 3NTJA 5BNVB 3WKJD 1P3AC 1WYTA 2JJGA 4YM6C 1P3BD 1AY8A 5GSUD 1AOIC 1B9IA 2HUFA 3A6ND 1TZYB 5EIGB 1P3ID 5B31C 1CL1A 3MAFA 4B9BA 1KX5C 5KDMA 3EI5A 5G2QA 1WYVB 3MGSC 1ZLAA 1D7VA 2ZC0A 3LZ0A 4AOAA 3AZKB 3UTBD 5B24C 4J8XC 1CL2A 2F8JA 3AZJB 2AROC 3VH5A 1P3OC 3G7QA 4W1XA 5B2JD 3WLXA 4XK1A 2JJEA 3MVDD 1UU2A 4GSAA 2PB2A 2NQBD 1P3PC 1TZYD 5B40A 2RIQA 2VMPA 1MDZA 1KMKA 1LW4A 3REIA 3FQ7A 3WCOA 1ECXA 1P3LB 3WGCA 3TU4C 3FSLA 1YOOA 5AVCC 4ZWVA 1QJ5A 3FFHA 3UT9B 4XZQA 1IJIA 4Z2MH 3AZJD 4HGAC 3A9YA 1TOJA 3VH6T 1J32A 2AY1A 4LD9B 1BS0A 2EH6A 3W99B 5B32G 2JCHA 2VLHA 5FT8A 3QPGA 1W7MA 5B1MB 1S08A 3AZGC 2QLRA 3GJUA 1RV3A 1H1CA 1LC5A 4RKDA 4MQRA 1JS6A 2ZSLA 5JA4A 3UT9D 3EG5B 1QITA 1ASGA 3NX3A 2D61A 1EQZA 1P3FC 2CV5A 3WTPB 1YNUA 4BQ0A 3REKB 4ZWMA 3NQJB 1BFMA 1M32A 3LVJA 3PDBA 3AN2A 3MC6A 4LD9D 3ZZKA 4ITGA 2WKAA 2OGEA 2XD1A 5M4BA 1ZODA 1SZUA 5B1MD 4PVFA 5AY8A 2W7MA 3WKRA 4XAUA 5CPIC 4KGCA 3E2ZA 1B4XA 3UTAC 2AY4A 1CQ6A 1QZ9A 2ZYJA 3REID 4M2KA 3W1IA 1M1AA 5BO0A 4E45A 5EUDA 5AV9C 2VMSA 5FUGA 3X1VA 3EI6A 5CPJC 4E3QA 5G09A 1VEFA 1YAAA 5B32A 4H9QB 4P7YA 4XZQD 4EO5B 4QLCC 1DGEA 4CBRA 3LJAA 4ZUXB 5BNXB 4KHAA 1AICA 1AX4A 3AZNA 2C81A 4NE5A 1IX7A 4W5KA 1BJWA 3VOMA 5G49B 4H9NA 3H0LC 2F8NB 5KTBA 2HIOA 4N0WA 2E7JA 5BS7C 1ARGA 1W7NA 2D65A 5E5AA 2AY6A 5K8BA 2V1PA 3REHB 2GMUA 1BJOA 1FG3A 1N31A 2EO5A 4WBTA 3KWQA 4ZUXD 2DQNC 4YS3C 2Y2KA 3KE3A 1YIZA 4E3RA 4A6RA 3W98A 5D95A 2Z9UA 3MGPD 3M5UA 4GE4A 2RVQC 3VH6W 3MGQC 4RJ0A 3WAAB 3E2YA 4GDYA 5AV8A 1WWSA 2F8ND 1WYUA 1KL2A 2W8TA 3AL0C 5BT1D 1CZEA 4EU1A 4IY7A 1M19A 1KKPA 3NU8A 3MGRB 5G4JA 1KX3D 4A00A 4WU9A 5HXXA 3REHD 4WZSB 1AMSA 3WA9C 1HQ3C 4IYOB 2UWXA 1GC0A 2DOUA 2D66A 4RKCA 4WV4B 3EIBA 3N75A 4YM6B 1AOIB 4OTLA 1HTAA 1U35A 3FVUA 5I92A 2FM1A 4WYDA 4A0RA 5B31B 1DJ9A 2EYQA 3AELA 5DNMC 3WAAD 3L44A 2BYKA 3AZEA 1R4VA 1YJYA 1KX5B 5FT6A 3WX9A 3MNNC 3ZRPA 3MGSB 2Y2NA 4Q76A 4NE3A 5EAVA 5B24B 4J8XB 2AY5A 2VMTA 4WXGA 4FL0A 4KYOA 1CZCA 2AROB 1P3OB 4JJNA 3USFA 3VH6A 4WJ3C 3EI9A 3RELC 1P3GA 4OYTA 4W1VA 1TOIA 4WNNB 3C1BC 4YM6D 3AOWA 1P3PB 4R8PD 1P3KC 3X1SC 5B0ZA 2Y2IA 4HVKA 5B31D 1QISA 2X8UA 4H9RB 2FJ7D 1PFFA 2VGTA 5JRGC 2FQ6A 2YFWB 3TU4B 1P3MC 5AVCB 3MGSD 3PDXA 1P34A 3PD6B 1SVVA 3BS8A 4ADEA 3BWNC 1TOEA 4PFFA 5B24D 2DF4C 4J8XD 4OBVA 1H0CA 4RIZA 2Z1YA 3UAKA 1BJ4A 2AROD 3AZIC 4HGAB 3X1UA 1P3OD 4GE9A 3COGA 1W3UA 3RI6A 3LZ1C 5AV5A 3AZHC 1P3PD 2V0YA 9AATA 3AZGB 5C3IC 4E44A 2NZDA 4MKKA 4RITA 2GB3A 3TU4D 5AVCD 4CXRA 4MY5A 5DNND 1S09A 3A1IA 1B9HA 3FVXA 1M18C 4H51A 1P3FB 3W97D 4F5JA 3N4XA 1DJUA 3HLMA 4CBSA 4TMRA 3W1HA 4JJND 1OHWA 2JGTA 3AZGD 4Y0DA 4LC3A 5CPIB 4WB0A 1S32C 3UTAB 4LNLA 3C1CC 5DJ9A 2ZJGA 4CAYA 2DGMA 5AV9B 3GETA 3FFRA 4KXKA 1BT4A 3B1CA 4XJPA 4WP0A 3AV2C 1WWIA 3W96D 1D2FA 1P3FD 5CPJB 4J8VA 1B8GA 4X23A 3GBXA 3B46A 4QLCB 3ATHA 4J8WA 2BIAA 1N1JB 5B1LC 4OBUA 2W7HA 3WKJA 5GT3C 1P3BA 3NYUA 4UPKA 5GSUA 2VI8A 3H9XA 1ULYA 3A6NA 3HL2A 3KSYA 1IX6A 3UTAD 2HOYA 3CAIA 5B0YC 1P3IA 2PYOC 1AMAA 1G4VA 5B33C 2JJFA 3HQTA 3II0A 1GEWA 1J04A 3FDDA 3R45A 3NYSA 1AHGA 2HP2A 2CV5C 1F66D 4QLCD 2CH2A 5CHLB 3AN2C 1BQAA 3MC6C 2BWPA 3HBXA 1IX8A 4YS3B 5B2JA 2AEVA 2D7ZA 4U1TA 1MLYA 4RLGA 3MVDA 3EZ1A 2NQBA 1TZYA 4KGCC 3FQ8A 3AEOA 5EIGA 4O6ZA 4XUJC 4M2JA 3MGQB 1GC2A 3BCBA 2YHKA 1SPAA 1OHYA 4J8LA 2Z1ZA 2AATA
chains in the Genus database with same CATH topology
1M1AC 2VI9A 3BN1A 1MAPA 3MADA 1WYVA 3GR9A 3LVLB 3X1VC 5EQCA 1ORDA 5F99C 4JEYA 2VMQA 3FTBA 2JG2A 1KU5A 3WA9B 1HQ3B 3O62C 1ELQA 1ARTA 3AZJA 4J8VD 4YS3D 2CH1A 4ZSWA 3LJAC 3B6GC 5EFSA 3A2BA 1ID3C 1I43A 5CP6C 2BI1A 4R8DA 4XJOA 1G4XA 1BH9A 1VJOA 5G2PA 2RVQD 4IXZA 3MGQD 1T3UA 5DNMB 1GBNA 3TCMA 3JWBA 4RJYA 4W91A 2HIOC 3MNNB 5DX5A 3VK4A 3K7YA 3P6KA 2QB3A 2QBTA 3UT9A 3CQ4A 4Z66D 3WA9D 3FRKA 3KKIA 4RAEA 3AOVA 2AY2A 3RELB 3KWQC 1LS3A 3C1BB 4LD9A 3W99A 5CPKD 2PO3A 2CSTA 4H9SA 1P3KB 3X1SB 2W7FA 5B1MA 3V9RB 5DNMD 3FDBA 4ITXA 4A0GA 5JRGB 1CQ7A 5GXQC 5J8QA 1OHVA 2W7DA 1P3MB 2IO5C 5FT4A 4R2NA 3ECDA 3AZIB 2F8NG 5DJ1A 1DJEA 4ZASA 3RELD 3NQJA 3LZ1B 1ARHA 3C1BD 3AZKD 1WSTA 1AKCA 1ZC9A 3AZHB 2L5AA 1I48A 2VIBA 1P3KD 1D7UA 3X1SD 4J8UC 3I16A 2JE5A 1JFIB 1U08A 1JS3A 3KUYC 1AMRA 5C3IB 3DYDA 1Z2CB 1T3IA 3E9KA 2YCPA 5JRGD 4WD2A 1CS1A 1OXPA 1X2AA 2D7YA 1IBJA 5E3KA 2Y2JA 5E4ZA 5KDMB 2OKJA 2F8NK 3KGXA 2YFVB 3LELC 1P3LD 3AEMA 2R0TA 1M18B 3B8XA 4GRXA 1YJSA 2HZPA 3AZID 1GCKA 4JEVA 1C4KA 4H9QA 1M0NA 4OCAA 2BHXA 1P3GC 3AZHD 2BI5A 5GT0C 4ZUXA 4ZAHA 5BNXA 4F5HA 1X29A 1WKHA 3FZ8A 1D7RA 1BKGA 5B0ZC 3B6FC 3W99D 1S32B 3NUIA 2VMVA 4CSRB 3MGPA 2BKWA 2VIAA 3GWPA 4WXFA 4UHOA 3C1CB 3A9ZA 4F4EA 5G49A 2JJHA 5AVBC 2HOXA 4NFTA 2F8NA 1ASAA 4UUZB 2XH1A 3A8UX 5B31G 3K28A 2G5IC 1M18D 3AV2B 3WZFA 3FQAA 3AZLC 1KX3A 4ZM4A 4I8AA 4AH3A 3REHA 1OXOA 1I29A 4WLJA 2DGLA 2Y2GA 2DR1A 4UOYA 5B1LB 2W7LA 2W7EA 2Y2MA 3WTPD 3EI8A 4JEWA 4NOGA 3REKD 1M6SA 2W8UA 5GT3B 3ZRQA 1KX4C 3B1DA 1S32D 1CJ0A 3EPJA 4IW7A 5B0YB 1BW0A 4KUDB 3C1CD 2PYOB 2Y2QA 5EAAA 3AYWC 3WAAA 1ASMA 3G8MA 5B33B 4A0FA 4MKJA 3KXBC 1RVUA 2R2NA 3AV2D 3P5JB 2GSAA 3MGRA 2QA3A 1AJSB 4GE7A 2O0RA 4DBCA 4IYOA 1EJIA 1B6WA 1M7YA 3AN2B 5B1LD 4EB5A 1TOKA 2HUIA 5GT3D 4YM6A 3B0DC 1W23A 4R8PA 4KGCB 5B0YD 4KUDD 4Y0HA 5DB5A 1JF9A 3AZFC 4XUJB 5B31A 3ISLA 2PYOD 2FJ7A 5B33D 2F8NH 2O7CA 4WLHA 3GZCA 1H3OA 1M1AB 1KX5A 3GZDC 4A6UA 1UU1A 3MGSA 3X1VB 1M0QA 3REJB 5F99B 4LW2A 3O62B 2ZUKA 5B24A 4J8XA 5E5IA 2AROA 1P3OA 3TATA 4F5GA 2EGYA 1S0AA 3LJAB 3B6GB 4DRBA 3LV2A 4UQVA 4WNNA 1ID3B 1M0OA 3RCHB 1TPLA 1P3PA 5CP6B 4K05A 3DR4A 3NNKA 4XUJD 2YRIA 4H9RA 3HDOA 1P3AB 3AV1C 2BYJA 2E7IA 2YFWA 1C7OA 4OT8A 3TU4A 5AVCA 3AZMC 2VMYA 2W7KA 3PD6A 3REJD 3AENB 5DNNA 2ZM5A 3AEJC 2YKUA 3O62D 3QBOA 5AV6C 5B2IC 3W97A 3UTBC 3MGRD 2Z20A 3B6GD 3KWQB 3NRAA 1ID3D 5B2JC 4R5FA 5FT5A 1ASNA 4UHNA 2ZY4A 5CP6D 3MVDC 5IWQA 3X1TC 2BI3A 4WYGA 2NQBC 2BYMB 3AZGA 3QHXA 3PA9A 1P3AD 4WU8C 2ZY5A 1AOID 2DKJA 3W1JA 5GXQB 2AY3A 3L8AA 4Z5TC 1LC7A 4OC9A 2IO5B 5HHYA 1AHEA 2ZP7A 1KX5D 4AZJA 3W96A 1F1EA 1P3FA 1AHXA 1TAFA 1ASEA 4B98A 3AFAC 4K2BA 2AY8A 4M6BA 2CINA 1C0NA 3HVYA 2E54A 2CJHA 1O62A 2VGWA 3KGWA 4BMKA 4J8UB 2VMRA 4Q31A 5D5SA 3KUYB 2W7JA 2R5EA 2NMPA 5GXQD 2VMWA 2W8JA 4H9PB 3UTAA 2GMSA 1X28A 2FYFA 1PG8A 3ZZJA 1UU0A 2Z9XA 4A0HA 2G7JA 3LELB 2G6WA 2D5YA 4AO4A 1W7LA 1F66A 3FKDA 1ZLAC 4JF0A 3LZ0C 4QLCA 3WY7A 3JW9A 1N1JA 1WKGA 2W7GA 2D63A 2VMZA 5GT0B 5M49A 3WGBA 4J8UD 2F2AC 4W1WA 3CQ5A 2Y2LA 3KUYD 5B0ZB 3B6FB 3H7FA 3A9XA 3BCXA 2VMNA 1O69A 5B40C 1MAQA 4IXOA 5AVBB 4AWLC 3LELD 3REIC 5BS7A 1M4NA 3EPKA 3AZLB 3H0MC 4NE6A 4PFNA 1IAXA 3CQ6A 4XZQC 2HP1A 5GT0D 1JG8A 2R5CA 4YS3A 2J8PA 5F9SA 3N5MA 1KX4B 3B6FD 3LVMA 1GD9A 1AAMA 2PB0A 3OKSA 1DFOA 5HDMA 3MGQA 3AYWB 5AVBD 3ACZA 5CPID 4G92C 4G91C 3KXBB 1AHFA 2LY8A 3FZ7A 3NYTA 3AZLD 2VGZA 2YCNA 1V2DA 4Z66A 1YIYA 2HUEC 3WA9A 5AV9D 4U2HA 1LKCA 4ZDOA 2OKKA 5CPJD 2VMXA 8AATA 1EQZC 2AY9A 4IXSA 4XJLA 3B0DB 1KX4D 2G5HC 5CPKA 3F6TA 3FZ6A 1MGVA 3ELEA 3AZFB 3E2FA 5BNVA 5DNMA 3MGPC 4LNJA 3AYWD 2OGAA 1AHYA 2VYCA 2OQXA 5AY8C 5EUNA 3KXBD 1CQ8A 3MNNA 2C7TA 2HOZA 1MLZA 1EG5A 1QIRA 3R4TA 1KX3C 3NQUB 2JSSA 1GC3A 4DQ6A 2A1VA 2JISA 1ASDA 3TQXA 7AATA 3RELA 2BIGA 4ADBA 3C1BA 3AZKA 3VAXA 5B32C 2VGVA 1AMQA 1SZKA 1G7XA 1S07A 2Z61A 3K40A 4JEZA 1P3KA 3DXVA 4XJMA 3X1SA 1PMMA 3AZFD 3V9RA 3AV1B 5JRGA 4L0OA 4TN4A 1W2EA 4AO9A 3AZNC 4XEWA 2FKIA 3AZMB 1SF2A 1UKJA 4MQPA 2VLFA 3BWNA 1RVYA 1P3LA 5AV6B 5B2IB 3AZIA 3UTBB 3RBFA 1AAWA 4BA4A 1KKJA 1FC4A 4FFCA 5E5AC 2Y2HA 3LZ1A 4ISYA 1HQ3D 5B2JB 1BH8B 3LWSA 3AZHA 2CFBA 3DZZA 3BB8A 3RBLA 4F5FA 3MVDB 2Q7WA 3X1TB 2NQBB 1A7WA 3UWCA 4R8PC 1JFIA 4JF1A 4WU8B 3AV1D 1LK9A 4MSOA 1QJ3A 3EUCA 2FJ7C 4W8IA 1ELUA 4Z5TB 1GC4A 3W98C 4H9OB 3AZMD 2X3LA 2FNUA 5TF5A 2YFVA 5AX8A 4F5KA 3DODA 5AV8C 5AV6D 5B2ID 1M18A 3NU7A 3CBFA 3MNND 2ORDA 1ASCA 3MBBA 3AFAB 2E7UA 3RUYA 1M19C 1BQDA 4F5MA 4WU9C 1AKBA 3QN6A 3LG0A 3N0LA 3X1TD 3WTPA 3MAUA 2XBNA 3REKA 3HT4A 2ZY2A 4P3MA 1E5EA 3N4SA 4A6TA 1BH9B 4WU8D 3AV7A 2BWOA 1WYTB 1S32A 4CSRA 3IP4C 1U35C 4Z5TD 3C1CA 1SFFA 2YKYA 4UUZA 1X0MA 5DNNC 3EZSA 1KL1A 3AZEC 3AV2A 2C0RA 3MAFB 2WB6A 1P3MD 1TARA 3AFAD 2VQRA 3W97C 2VMUA 2C44A 1ZLAB 3LZ0B 2XD5A 3I4JA 1ARIA 4WXBA 4BHDA 5B1LA 2HUUA 4DRAA 4JJNC 3WTPE 5GT3A 3LZ1D 1DGDA 1TATA 5B0YA 4KUDA 2PYOA 5B40B 3F9TA 3G0TA 3E6GA 4AWLB 5B33A 3REIB 1AJRA 3ZRRA 2QMAA 3FCRA 2W8WA 5C6UA 2EZ2A 1AJSA 2YKVA 3W96C 5G0AA 4ZSYA 4K2MA 1ZLAD 1P34C 1IVRA 3LZ0D 1B5OA 4XZQB 3DC1A 3EI7A 1D7SA 3X1UC 4Q6RA 3N7NA 5AV5C 2VGSA 3QI6A 4XUJA 5B40D 2BWNA 3A1KA 4G92B 4G91B 1IUGA 2NZDC 3UE8A 3REJA 5F99A 3VP6A 4F5LA 2HUEB 2ZY3A 4LNMA 3O62A 4JEXA 5JA4B 1TASA 1M0PA 1F66C 2BI2A 3DU4A 1MDOA 1S06A 1I41A 1EQZB 3VK3A 3B6GA 2CV5B 1ID3A 3RCHA 3PDBB 1LW5A 4QGRA 5CP6A 3JTXA 3PIUA 1DTYA 3MGPB 1P3AA 2YKXA 3QGUA 1XI9A 1AOIA 4HF8A 5AY8B 3DXWA 3I5TA 3QM2A 5M4DA 1EQBA 3E2ZB 3WCNA 3AENA 2VMOA 1KX3B 3FVSA 5BO0B 4ZLVA 5FUGB 4DQYB 1EQZD 2KFPA 2CV5D 4J8VC 3JZLA 4WYCA 4X23C 5B32B 1V72A 4EFFA 1Q9CA 3JWAA 1AY4A 3AN2D 3DRDA 2BYMA 4J8WC 4OMAA 4PIWA 2QSRA 5AY8D 4KHAB 2OATA 3H0RC 3WKJC 2BI9A 5GXQA 1P3BC 4CVQA 5GSUC 4KGCD 3A6NC 3AZNB 4WYAA 3WKSA 4ZM3A 4ZDLA 4ZBJC 4K2IA 2FFFB 1P3IC 4ATQA 4H9NB 1M1AD 4Z66C 1O4SA 2HIOB 4Y0IA 3PJ0A 3X1VD 2VGUA 5F99D 4AZKA 5E5AB 2O1BA 5B32D 3PAAA 1BJOB 4J8UA 5CPKC 2DKBA 3LJAD 2CWEA 4R8PB 4GEBA 4WYFA 3KUYA 4E77A 3NUBA 2AY7A 4F5IA 2FJ7B 4H9PA 3AZND 3IHJA 1ZOBA 3W98B 1BJNA 1H3OB 1TZYC 2W8VA 3B0CT 2DGKA 3LELA 3BC8A 5AV8B 1V2EA 2YRRA 1WYUB 2HIOD 4KAMA 5BJ4A 3LY1A 1M19B 4EB7A 5E5AD 5M46A 1B5PA 2WK7A 5F8VA 4WU9B 4E1OA 3AZKC 5GT0A 3AZJC 4LW4A 3KWQD 1O61A 1PMOA 1AKAA 1N8PA 3B6FA 2W8SA 5EUEA 1OATA 2WK9A 2Z9VA 1U35B 1GEXA 3W98D 2ZSMA 4CXQA 5AVBA 5G4IA 5CPIA 2BIEA 3FD0A 3PPLA 5DNNB 2BYKB 2WK8A 3AZEB 5AV8D 2CTZA 1P3LC 3AZLA 3F0HA 1M19D 3W97B 5AV9A 4WU9D 3UT9C 2EZ1A 1IAYA 5CPJA 3NDNA 4ZDPA 4JJNB 2CY8A 3VH5T 1P3GB 1KX4A 1AIAA 3BV0A 4LD9C 1G7WA 3W99C 1U35D 4H9SC 1FG7A 3AYWA 3EIAA 5B1MC 4BA5A 3ASAA 3KXBA 3R9AA 1N2TA 3AZED 2CJGA 3DR7A 4H63Q 4RM1A 2FNIA 1B67A 1C7GA 3EPHA 3W96B 2Z9WA 3MKJA 2CB1A 2FN6A 1TAFB 1P34B 1AIBA 3TFUA 4UHMA 3VK2A 3ASBA 1ASFA 1QGNA 2CANA 5JAYA 3X1UB 2YCTA 3WTPC 2GQNA 3REKC 1P3GD 5AV5B 4XQ2A 4IX8A 1C9CA 1GDEA 1E5FA 3AZFA 3Q8NA 3GSBA 4Q75A 5B0ZD 1ASBA 3P1TA 3GZDA 1GEYA 2NZDB 1YJZA 2BG1A 2YOBA 3HMUA 4ADDA 2QB2A 1P34D 2X5FA 3NQUA 4J5UA 1F66B 1SZSA 3AEMC 3B0CW 3X1UD 1V2FA 3T32A 1Z3ZA 3OP7A 1HQ3A 2D64A 1Y4IA 3E77A 1LC8A 4EO5C 5AV5D 3B0BA 2Y2PA 4ZUXC 3AV1A 2X5DA 4KUDC 2HORA 2BYLA 3D6KA 4Z2MG 2AEUA 4ATPA 2NZDD 4WB0B 1MDXA 3AZMA 1ASLA 1P3WA 3AEJA 4ADCA 4CAYB 5AV6A 5B2IA 3ELPA 3UTBA 5BT1C 4EMYA 3TFTA 4R5ZA 4J8VB 1DKAA 2R5CB 4X23B 1BH8A 1Z7DA 3REHC 1C7NA 2TPLA 3X1TA 3EPLA 4DGTA 4J8WB 4A72A 2Y2OA 4WU8A 4M2MA 2RFVA 1ARSA 1KMJA 3WKJB 1P3BB 5GSUB 1PZRA 3KFUG 3A6NB 3N4RA 4Z5TA 5BJ3A 4H9OA 3AEPA 1TOGA 3B1EA 4ZBJB 3VH5W 1P3IB 1RV4A 2EPJA 3AATA 3REJC 1AY5A 3WAAC 3LVKA 3MEBA 4Z66B 4WYEA 2CJDA 1P3MA 3AFAA 2W7IA 1XEYA 3PGYA 3MGRC 1VP4A 4X23D 3R45B 3BWOA 3RQ1A 3BCAA 4MQQA 5CPKB 4J8WD 3NTJA 5BNVB 3WKJD 1P3AC 1WYTA 2JJGA 4YM6C 1P3BD 1AY8A 5GSUD 1AOIC 1B9IA 2HUFA 3A6ND 1TZYB 5EIGB 1P3ID 5B31C 1CL1A 3MAFA 4B9BA 1KX5C 5KDMA 3EI5A 5G2QA 1WYVB 3MGSC 1ZLAA 1D7VA 2ZC0A 3LZ0A 4AOAA 3AZKB 3UTBD 5B24C 4J8XC 1CL2A 2F8JA 3AZJB 2AROC 3VH5A 1P3OC 3G7QA 4W1XA 5B2JD 3WLXA 4XK1A 2JJEA 3MVDD 1UU2A 4GSAA 2PB2A 2NQBD 1P3PC 1TZYD 5B40A 2RIQA 2VMPA 1MDZA 1KMKA 1LW4A 3REIA 3FQ7A 3WCOA 1ECXA 1P3LB 3WGCA 3TU4C 3FSLA 1YOOA 5AVCC 4ZWVA 1QJ5A 3FFHA 3UT9B 4XZQA 1IJIA 4Z2MH 3AZJD 4HGAC 3A9YA 1TOJA 3VH6T 1J32A 2AY1A 4LD9B 1BS0A 2EH6A 3W99B 5B32G 2JCHA 2VLHA 5FT8A 3QPGA 1W7MA 5B1MB 1S08A 3AZGC 2QLRA 3GJUA 1RV3A 1H1CA 1LC5A 4RKDA 4MQRA 1JS6A 2ZSLA 5JA4A 3UT9D 3EG5B 1QITA 1ASGA 3NX3A 2D61A 1EQZA 1P3FC 2CV5A 3WTPB 1YNUA 4BQ0A 3REKB 4ZWMA 3NQJB 1BFMA 1M32A 3LVJA 3PDBA 3AN2A 3MC6A 4LD9D 3ZZKA 4ITGA 2WKAA 2OGEA 2XD1A 5M4BA 1ZODA 1SZUA 5B1MD 4PVFA 5AY8A 2W7MA 3WKRA 4XAUA 5CPIC 4KGCA 3E2ZA 1B4XA 3UTAC 2AY4A 1CQ6A 1QZ9A 2ZYJA 3REID 4M2KA 3W1IA 1M1AA 5BO0A 4E45A 5EUDA 5AV9C 2VMSA 5FUGA 3X1VA 3EI6A 5CPJC 4E3QA 5G09A 1VEFA 1YAAA 5B32A 4H9QB 4P7YA 4XZQD 4EO5B 4QLCC 1DGEA 4CBRA 3LJAA 4ZUXB 5BNXB 4KHAA 1AICA 1AX4A 3AZNA 2C81A 4NE5A 1IX7A 4W5KA 1BJWA 3VOMA 5G49B 4H9NA 3H0LC 2F8NB 5KTBA 2HIOA 4N0WA 2E7JA 5BS7C 1ARGA 1W7NA 2D65A 5E5AA 2AY6A 5K8BA 2V1PA 3REHB 2GMUA 1BJOA 1FG3A 1N31A 2EO5A 4WBTA 3KWQA 4ZUXD 2DQNC 4YS3C 2Y2KA 3KE3A 1YIZA 4E3RA 4A6RA 3W98A 5D95A 2Z9UA 3MGPD 3M5UA 4GE4A 2RVQC 3VH6W 3MGQC 4RJ0A 3WAAB 3E2YA 4GDYA 5AV8A 1WWSA 2F8ND 1WYUA 1KL2A 2W8TA 3AL0C 5BT1D 1CZEA 4EU1A 4IY7A 1M19A 1KKPA 3NU8A 3MGRB 5G4JA 1KX3D 4A00A 4WU9A 5HXXA 3REHD 4WZSB 1AMSA 3WA9C 1HQ3C 4IYOB 2UWXA 1GC0A 2DOUA 2D66A 4RKCA 4WV4B 3EIBA 3N75A 4YM6B 1AOIB 4OTLA 1HTAA 1U35A 3FVUA 5I92A 2FM1A 4WYDA 4A0RA 5B31B 1DJ9A 2EYQA 3AELA 5DNMC 3WAAD 3L44A 2BYKA 3AZEA 1R4VA 1YJYA 1KX5B 5FT6A 3WX9A 3MNNC 3ZRPA 3MGSB 2Y2NA 4Q76A 4NE3A 5EAVA 5B24B 4J8XB 2AY5A 2VMTA 4WXGA 4FL0A 4KYOA 1CZCA 2AROB 1P3OB 4JJNA 3USFA 3VH6A 4WJ3C 3EI9A 3RELC 1P3GA 4OYTA 4W1VA 1TOIA 4WNNB 3C1BC 4YM6D 3AOWA 1P3PB 4R8PD 1P3KC 3X1SC 5B0ZA 2Y2IA 4HVKA 5B31D 1QISA 2X8UA 4H9RB 2FJ7D 1PFFA 2VGTA 5JRGC 2FQ6A 2YFWB 3TU4B 1P3MC 5AVCB 3MGSD 3PDXA 1P34A 3PD6B 1SVVA 3BS8A 4ADEA 3BWNC 1TOEA 4PFFA 5B24D 2DF4C 4J8XD 4OBVA 1H0CA 4RIZA 2Z1YA 3UAKA 1BJ4A 2AROD 3AZIC 4HGAB 3X1UA 1P3OD 4GE9A 3COGA 1W3UA 3RI6A 3LZ1C 5AV5A 3AZHC 1P3PD 2V0YA 9AATA 3AZGB 5C3IC 4E44A 2NZDA 4MKKA 4RITA 2GB3A 3TU4D 5AVCD 4CXRA 4MY5A 5DNND 1S09A 3A1IA 1B9HA 3FVXA 1M18C 4H51A 1P3FB 3W97D 4F5JA 3N4XA 1DJUA 3HLMA 4CBSA 4TMRA 3W1HA 4JJND 1OHWA 2JGTA 3AZGD 4Y0DA 4LC3A 5CPIB 4WB0A 1S32C 3UTAB 4LNLA 3C1CC 5DJ9A 2ZJGA 4CAYA 2DGMA 5AV9B 3GETA 3FFRA 4KXKA 1BT4A 3B1CA 4XJPA 4WP0A 3AV2C 1WWIA 3W96D 1D2FA 1P3FD 5CPJB 4J8VA 1B8GA 4X23A 3GBXA 3B46A 4QLCB 3ATHA 4J8WA 2BIAA 1N1JB 5B1LC 4OBUA 2W7HA 3WKJA 5GT3C 1P3BA 3NYUA 4UPKA 5GSUA 2VI8A 3H9XA 1ULYA 3A6NA 3HL2A 3KSYA 1IX6A 3UTAD 2HOYA 3CAIA 5B0YC 1P3IA 2PYOC 1AMAA 1G4VA 5B33C 2JJFA 3HQTA 3II0A 1GEWA 1J04A 3FDDA 3R45A 3NYSA 1AHGA 2HP2A 2CV5C 1F66D 4QLCD 2CH2A 5CHLB 3AN2C 1BQAA 3MC6C 2BWPA 3HBXA 1IX8A 4YS3B 5B2JA 2AEVA 2D7ZA 4U1TA 1MLYA 4RLGA 3MVDA 3EZ1A 2NQBA 1TZYA 4KGCC 3FQ8A 3AEOA 5EIGA 4O6ZA 4XUJC 4M2JA 3MGQB 1GC2A 3BCBA 2YHKA 1SPAA 1OHYA 4J8LA 2Z1ZA 2AATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S08 A;  2D5Y A;  4AO4 A;  1W7L A;  2VI9 A;  3BN1 A;  3DRD A;  3FKD A;  4JF0 A;  1MAP A;  2QLR A;  3MAD A;  1WYV A;  4OMA A;  4PIW A;  3WY7 A;  3GR9 A;  3JW9 A;  3LVL B;  3GJU A;  5EQC A;  1RV3 A;  1H1C A;  1ORD A;  4JEY A;  2VMQ A;  1LC5 A;  3FTB A;  1WKG A;  2W7G A;  2D63 A;  2OAT A;  2VMZ A;  2JG2 A;  5M49 A;  3WGB A;  2BI9 A;  4RKD A;  4MQR A;  1ELQ A;  1ART A;  4CVQ A;  1JS6 A;  3CQ5 A;  4W1W A;  4WYA A;  3WKS A;  2ZSL A;  4ZM3 A;  4ZDL A;  3H7F A;  1QIT A;  4K2I A;  2CH1 A;  4ZSW A;  3A9X A;  3BCX A;  5EFS A;  1ASG A;  3A2B A;  3NX3 A;  2D61 A;  4ATQ A;  1I43 A;  2VMN A;  1O69 A;  1MAQ A;  4IXO A;  1YNU A;  1O4S A;  4BQ0 A;  4Y0I A;  2BI1 A;  4ZWM A;  4R8D A;  4XJO A;  3PJ0 A;  1G4X A;  2VGU A;  1M32 A;  3LVJ A;  1VJO A;  3PDB A;  5G2P A;  3MC6 A;  4AZK A;  3ZZK A;  2O1B A;  4ITG A;  4IXZ A;  1M4N A;  2WKA A;  2OGE A;  1GBN A;  3TCM A;  5M4B A;  1ZOD A;  1SZU A;  3JWB A;  4PFN A;  4PVF A;  3PAA A;  1BJO B;  4RJY A;  2W7M A;  4W91 A;  2DKB A;  1IAX A;  5DX5 A;  3WKR A;  3CQ6 A;  4XAU A;  3VK4 A;  3K7Y A;  3P6K A;  4GEB A;  4WYF A;  2QB3 A;  3E2Z A;  2HP1 A;  2QBT A;  4E77 A;  3CQ4 A;  3NUB A;  1B4X A;  2AY7 A;  4F5I A;  1JG8 A;  2AY4 A;  1CQ6 A;  1QZ9 A;  2R5C A;  2ZYJ A;  3FRK A;  3KKI A;  4RAE A;  3AOV A;  5F9S A;  3N5M A;  3IHJ A;  4M2K A;  1ZOB A;  1BJN A;  2AY2 A;  3LVM A;  2W8V A;  5EUD A;  2VMS A;  1GD9 A;  1LS3 A;  3EI6 A;  1AAM A;  2PB0 A;  3BC8 A;  3OKS A;  1DFO A;  5HDM A;  1V2E A;  2YRR A;  4E3Q A;  1WYU B;  2PO3 A;  3ACZ A;  4KAM A;  5G09 A;  1VEF A;  1YAA A;  2CST A;  5BJ4 A;  2W7F A;  4P7Y A;  3LY1 A;  4EB7 A;  1AHF A;  5M46 A;  1B5P A;  1DGE A;  2WK7 A;  3FDB A;  4CBR A;  4ITX A;  5F8V A;  3NYT A;  4A0G A;  2VGZ A;  2YCN A;  4E1O A;  1CQ7 A;  1V2D A;  1YIY A;  1AIC A;  5J8Q A;  1AX4 A;  1OHV A;  4LW4 A;  4U2H A;  2W7D A;  1O61 A;  1LKC A;  4ZDO A;  1AKA A;  2C81 A;  1N8P A;  2VMX A;  5FT4 A;  1IX7 A;  8AAT A;  5EUE A;  1OAT A;  4W5K A;  2WK9 A;  1BJW A;  2AY9 A;  2Z9V A;  4IXS A;  4R2N A;  4XJL A;  3VOM A;  1GEX A;  3ECD A;  5DJ1 A;  2ZSM A;  4CXQ A;  5G4I A;  3F6T A;  1DJE A;  4N0W A;  4ZAS A;  2E7J A;  2BIE A;  1ARG A;  1ARH A;  1W7N A;  2G6W A;  3PPL A;  1MGV A;  1WST A;  2D65 A;  3ELE A;  2WK8 A;  1AKC A;  1ZC9 A;  3E2F A;  2CTZ A;  2AY6 A;  4LNJ A;  1I48 A;  5K8B A;  2OGA A;  1AHY A;  2V1P A;  2OQX A;  2VIB A;  2VYC A;  1D7U A;  2GMU A;  5EUN A;  3F0H A;  1BJO A;  1FG3 A;  1CQ8 A;  1N31 A;  1U08 A;  1JS3 A;  2EO5 A;  2C7T A;  1AMR A;  4WBT A;  2HOZ A;  2EZ1 A;  3DYD A;  1T3I A;  3E9K A;  1IAY A;  2YCP A;  4WD2 A;  1MLZ A;  1CS1 A;  1EG5 A;  1QIR A;  3R4T A;  1OXP A;  1X2A A;  2D7Y A;  1IBJ A;  5E3K A;  3NDN A;  4ZDP A;  1GC3 A;  3KE3 A;  4DQ6 A;  5E4Z A;  1YIZ A;  4E3R A;  2CY8 A;  4A6R A;  5D95 A;  1AIA A;  2Z9U A;  3KGX A;  1ASD A;  3TQX A;  3BV0 A;  7AAT A;  2BIG A;  3AEM A;  2R0T A;  3M5U A;  4GE4 A;  1G7W A;  3B8X A;  4GRX A;  4ADB A;  1YJS A;  2HZP A;  3E2Y A;  1GCK A;  4GDY A;  4JEV A;  3VAX A;  2VGV A;  1AMQ A;  1SZK A;  1C4K A;  1FG7 A;  1G7X A;  1KL2 A;  1WYU A;  2W8T A;  3EIA A;  1S07 A;  2Z61 A;  3K40 A;  4JEZ A;  4BA5 A;  3DXV A;  1CZE A;  4XJM A;  3ASA A;  4EU1 A;  4IY7 A;  3R9A A;  1M0N A;  4OCA A;  2BHX A;  1N2T A;  1KKP A;  3DR7 A;  2CJG A;  3NU8 A;  5G4J A;  4A00 A;  2BI5 A;  5HXX A;  2FNI A;  1C7G A;  1AMS A;  4L0O A;  4ZAH A;  4TN4 A;  2Z9W A;  4F5H A;  1X29 A;  4AO9 A;  3MKJ A;  2CB1 A;  1WKH A;  2FN6 A;  4IYO B;  1D7R A;  1BKG A;  4XEW A;  1AIB A;  3TFU A;  1GC0 A;  4UHM A;  2DOU A;  1SF2 A;  1UKJ A;  2D66 A;  4MQP A;  2VLF A;  3VK2 A;  3NUI A;  2VMV A;  3BWN A;  3ASB A;  1ASF A;  4RKC A;  1QGN A;  2BKW A;  2VIA A;  3EIB A;  2CAN A;  1RVY A;  3N75 A;  4WXF A;  5JAY A;  4UHO A;  4OTL A;  3A9Z A;  4F4E A;  2YCT A;  2JJH A;  3FVU A;  5I92 A;  2GQN A;  2HOX A;  3RBF A;  1AAW A;  4BA4 A;  1ASA A;  1KKJ A;  1AY4 A;  2FM1 A;  2XH1 A;  3A8U X;  4WYD A;  1FC4 A;  4XQ2 A;  3K28 A;  4FFC A;  4A0R A;  1DJ9 A;  4IX8 A;  4ISY A;  3AEL A;  1C9C A;  1GDE A;  3WZF A;  1E5F A;  3FQA A;  3L44 A;  3Q8N A;  3GSB A;  3LWS A;  4Q75 A;  1YJY A;  2CFB A;  4ZM4 A;  3DZZ A;  3BB8 A;  3RBL A;  4I8A A;  4F5F A;  4AH3 A;  2Q7W A;  1ASB A;  5FT6 A;  3WX9 A;  3P1T A;  1OXO A;  1I29 A;  3ZRP A;  3GZD A;  3UWC A;  4WLJ A;  1GEY A;  4JF1 A;  1LK9 A;  1YJZ A;  4MSO A;  2DR1 A;  4Q76 A;  4UOY A;  2W7L A;  2W7E A;  2YOB A;  1QJ3 A;  3EUC A;  5EAV A;  3HMU A;  3EI8 A;  4W8I A;  1ELU A;  2QB2 A;  4JEW A;  4NOG A;  4ADD A;  2AY5 A;  2VMT A;  1M6S A;  2W8U A;  4WXG A;  4FL0 A;  2X5F A;  4KYO A;  1GC4 A;  1CZC A;  3ZRQ A;  3B1D A;  4J5U A;  3USF A;  2FNU A;  3EI9 A;  4OYT A;  1CJ0 A;  1SZS A;  3AEM C;  4W1V A;  5TF5 A;  5AX8 A;  4IW7 A;  1BW0 A;  1TOI A;  4F5K A;  3DOD A;  1V2F A;  3AOW A;  3T32 A;  1Z3Z A;  3NU7 A;  3OP7 A;  5EAA A;  2D64 A;  3CBF A;  1ASM A;  2ORD A;  1ASC A;  3G8M A;  3MBB A;  4A0F A;  1Y4I A;  3E77 A;  1LC8 A;  4MKJ A;  2E7U A;  3RUY A;  1RVU A;  4HVK A;  1BQD A;  1QIS A;  2R2N A;  2X8U A;  1PFF A;  2VGT A;  4F5M A;  2GSA A;  1AKB A;  2QA3 A;  3QN6 A;  1AJS B;  2FQ6 A;  2X5D A;  4GE7 A;  2HOR A;  3LG0 A;  2BYL A;  2O0R A;  3N0L A;  3D6K A;  3MAU A;  2XBN A;  4P3M A;  4ATP A;  2ZY2 A;  4DBC A;  1E5E A;  3PDX A;  4IYO A;  4A6T A;  1EJI A;  3PD6 B;  4WB0 B;  3AV7 A;  1SVV A;  1M7Y A;  2BWO A;  3BS8 A;  1MDX A;  3BWN C;  4ADE A;  1ASL A;  1TOE A;  1WYT B;  4EB5 A;  1TOK A;  1P3W A;  4PFF A;  3AEJ A;  1H0C A;  2HUI A;  2Z1Y A;  3UAK A;  1BJ4 A;  4ADC A;  4GE9 A;  1SFF A;  3COG A;  3ELP A;  1W3U A;  1W23 A;  2YKY A;  3RI6 A;  1X0M A;  4EMY A;  4Y0H A;  5DB5 A;  1JF9 A;  3EZS A;  1KL1 A;  4R5Z A;  3ISL A;  3TFT A;  1DKA A;  2C0R A;  2R5C B;  3MAF B;  1Z7D A;  2O7C A;  1TAR A;  4WLH A;  1C7N A;  2V0Y A;  3GZC A;  2VMU A;  2TPL A;  2C44 A;  3GZD C;  9AAT A;  4DGT A;  4A6U A;  1UU1 A;  3I4J A;  4A72 A;  1M0Q A;  1ARI A;  4M2M A;  4MKK A;  4WXB A;  4BHD A;  4LW2 A;  2RFV A;  2GB3 A;  2HUU A;  1ARS A;  1KMJ A;  2ZUK A;  5E5I A;  4CXR A;  4MY5 A;  5BJ3 A;  3AEP A;  1TOG A;  3TAT A;  3B1E A;  4F5G A;  1S09 A;  1DGD A;  2EGY A;  1B9H A;  1S0A A;  1TAT A;  1RV4 A;  3FVX A;  3LV2 A;  2EPJ A;  4H51 A;  4UQV A;  3AAT A;  3LVK A;  1AY5 A;  1M0O A;  3MEB A;  4F5J A;  4WYE A;  3F9T A;  3RCH B;  3E6G A;  1TPL A;  2CJD A;  1DJU A;  3HLM A;  1AJR A;  2W7I A;  3DR4 A;  3NNK A;  3ZRR A;  2QMA A;  3PGY A;  4CBS A;  2YRI A;  4TMR A;  3HDO A;  3FCR A;  1VP4 A;  2W8W A;  5C6U A;  2JGT A;  1OHW A;  2EZ2 A;  3BWO A;  3RQ1 A;  1AJS A;  2YKV A;  2BYJ A;  2E7I A;  3BCA A;  5G0A A;  4MQQ A;  1C7O A;  4ZSY A;  4K2M A;  4OT8 A;  1IVR A;  4Y0D A;  4LC3 A;  3NTJ A;  1B5O A;  2VMY A;  2W7K A;  3PD6 A;  4WB0 A;  3AEN B;  3AEJ C;  4LNL A;  3DC1 A;  3EI7 A;  1WYT A;  2JJG A;  2YKU A;  3QBO A;  1D7S A;  1AY8 A;  1B9I A;  2HUF A;  5DJ9 A;  4Q6R A;  2ZJG A;  2Z20 A;  5EIG B;  3GET A;  3FFR A;  4KXK A;  1BT4 A;  3B1C A;  4XJP A;  1CL1 A;  2VGS A;  4WP0 A;  3QI6 A;  3NRA A;  1D2F A;  4R5F A;  5FT5 A;  1ASN A;  1B8G A;  2BWN A;  4UHN A;  3MAF A;  4B9B A;  2ZY4 A;  5IWQ A;  3GBX A;  2BI3 A;  1IUG A;  3EI5 A;  4WYG A;  3B46 A;  5G2Q A;  1WYV B;  3ATH A;  3QHX A;  3PA9 A;  1D7V A;  2ZC0 A;  3UE8 A;  2BIA A;  2ZY5 A;  2DKJ A;  4AOA A;  2W7H A;  4F5L A;  2AY3 A;  1CL2 A;  3L8A A;  2F8J A;  2ZY3 A;  4LNM A;  4JEX A;  3NYU A;  1LC7 A;  4OC9 A;  1TAS A;  2VI8 A;  3HL2 A;  1M0P A;  3G7Q A;  5HHY A;  4W1X A;  2BI2 A;  1AHE A;  3WLX A;  3DU4 A;  2ZP7 A;  1IX6 A;  1MDO A;  4XK1 A;  2HOY A;  3CAI A;  1S06 A;  1I41 A;  3VK3 A;  2JJE A;  1UU2 A;  1AMA A;  4AZJ A;  4GSA A;  2PB2 A;  1G4V A;  2JJF A;  1AHX A;  1ASE A;  3HQT A;  4B98 A;  3RCH A;  3PDB B;  1LW5 A;  4QGR A;  2VMP A;  1MDZ A;  1KMK A;  1LW4 A;  3JTX A;  3II0 A;  1GEW A;  2AY8 A;  2CIN A;  3PIU A;  3FQ7 A;  4K2B A;  1C0N A;  1J04 A;  1ECX A;  1DTY A;  2YKX A;  3FDD A;  2E54 A;  2CJH A;  1XI9 A;  3QGU A;  3NYS A;  1AHG A;  1O62 A;  4HF8 A;  2VGW A;  3KGW A;  2HP2 A;  3WGC A;  4BMK A;  3DXW A;  2VMR A;  3I5T A;  3QM2 A;  4Q31 A;  3FSL A;  5D5S A;  1YOO A;  5M4D A;  4ZWV A;  1QJ5 A;  3FFH A;  1EQB A;  2CH2 A;  2W7J A;  3E2Z B;  1BQA A;  2R5E A;  3MC6 C;  2BWP A;  2NMP A;  1IX8 A;  3AEN A;  2VMO A;  2VMW A;  2W8J A;  1IJI A;  2D7Z A;  4U1T A;  1MLY A;  2GMS A;  1X28 A;  2FYF A;  3EZ1 A;  3FVS A;  1PG8 A;  4ZLV A;  3A9Y A;  1TOJ A;  3ZZJ A;  1UU0 A;  2Z9X A;  4A0H A;  1J32 A;  3FQ8 A;  3AEO A;  5EIG A;  2AY1 A;  4O6Z A;  1BS0 A;  2EH6 A;  4M2J A;  1GC2 A;  4WYC A;  3BCB A;  2YHK A;  1V72 A;  2VLH A;  1SPA A;  5FT8 A;  1OHY A;  3QPG A;  4EFF A;  2Z1Z A;  1W7M A;  3JWA A;  2AAT A; 
#chains in the Genus database with same CATH topology
 1M1A C;  2VI9 A;  3BN1 A;  1MAP A;  3MAD A;  1WYV A;  3GR9 A;  3LVL B;  3X1V C;  5EQC A;  1ORD A;  5F99 C;  4JEY A;  2VMQ A;  3FTB A;  2JG2 A;  1KU5 A;  3WA9 B;  1HQ3 B;  3O62 C;  1ELQ A;  1ART A;  3AZJ A;  4J8V D;  4YS3 D;  2CH1 A;  4ZSW A;  3LJA C;  3B6G C;  5EFS A;  3A2B A;  1ID3 C;  1I43 A;  5CP6 C;  2BI1 A;  4R8D A;  4XJO A;  1G4X A;  1BH9 A;  1VJO A;  5G2P A;  2RVQ D;  4IXZ A;  3MGQ D;  1T3U A;  5DNM B;  1GBN A;  3TCM A;  3JWB A;  4RJY A;  4W91 A;  2HIO C;  3MNN B;  5DX5 A;  3VK4 A;  3K7Y A;  3P6K A;  2QB3 A;  2QBT A;  3UT9 A;  3CQ4 A;  4Z66 D;  3WA9 D;  3FRK A;  3KKI A;  4RAE A;  3AOV A;  2AY2 A;  3REL B;  3KWQ C;  1LS3 A;  3C1B B;  4LD9 A;  3W99 A;  5CPK D;  2PO3 A;  2CST A;  4H9S A;  1P3K B;  3X1S B;  2W7F A;  5B1M A;  3V9R B;  5DNM D;  3FDB A;  4ITX A;  4A0G A;  5JRG B;  1CQ7 A;  5GXQ C;  5J8Q A;  1OHV A;  2W7D A;  1P3M B;  2IO5 C;  5FT4 A;  4R2N A;  3ECD A;  3AZI B;  2F8N G;  5DJ1 A;  1DJE A;  4ZAS A;  3REL D;  3NQJ A;  3LZ1 B;  1ARH A;  3C1B D;  3AZK D;  1WST A;  1AKC A;  1ZC9 A;  3AZH B;  2L5A A;  1I48 A;  2VIB A;  1P3K D;  1D7U A;  3X1S D;  4J8U C;  3I16 A;  2JE5 A;  1JFI B;  1U08 A;  1JS3 A;  3KUY C;  1AMR A;  5C3I B;  3DYD A;  1Z2C B;  1T3I A;  3E9K A;  2YCP A;  5JRG D;  4WD2 A;  1CS1 A;  1OXP A;  1X2A A;  2D7Y A;  1IBJ A;  5E3K A;  2Y2J A;  5E4Z A;  5KDM B;  2OKJ A;  2F8N K;  3KGX A;  2YFV B;  3LEL C;  1P3L D;  3AEM A;  2R0T A;  1M18 B;  3B8X A;  4GRX A;  1YJS A;  2HZP A;  3AZI D;  1GCK A;  4JEV A;  1C4K A;  4H9Q A;  1M0N A;  4OCA A;  2BHX A;  1P3G C;  3AZH D;  2BI5 A;  5GT0 C;  4ZUX A;  4ZAH A;  5BNX A;  4F5H A;  1X29 A;  1WKH A;  3FZ8 A;  1D7R A;  1BKG A;  5B0Z C;  3B6F C;  3W99 D;  1S32 B;  3NUI A;  2VMV A;  4CSR B;  3MGP A;  2BKW A;  2VIA A;  3GWP A;  4WXF A;  4UHO A;  3C1C B;  3A9Z A;  4F4E A;  5G49 A;  2JJH A;  5AVB C;  2HOX A;  4NFT A;  2F8N A;  1ASA A;  4UUZ B;  2XH1 A;  3A8U X;  5B31 G;  3K28 A;  2G5I C;  1M18 D;  3AV2 B;  3WZF A;  3FQA A;  3AZL C;  1KX3 A;  4ZM4 A;  4I8A A;  4AH3 A;  3REH A;  1OXO A;  1I29 A;  4WLJ A;  2DGL A;  2Y2G A;  2DR1 A;  4UOY A;  5B1L B;  2W7L A;  2W7E A;  2Y2M A;  3WTP D;  3EI8 A;  4JEW A;  4NOG A;  3REK D;  1M6S A;  2W8U A;  5GT3 B;  3ZRQ A;  1KX4 C;  3B1D A;  1S32 D;  1CJ0 A;  3EPJ A;  4IW7 A;  5B0Y B;  1BW0 A;  4KUD B;  3C1C D;  2PYO B;  2Y2Q A;  5EAA A;  3AYW C;  3WAA A;  1ASM A;  3G8M A;  5B33 B;  4A0F A;  4MKJ A;  3KXB C;  1RVU A;  2R2N A;  3AV2 D;  3P5J B;  2GSA A;  3MGR A;  2QA3 A;  1AJS B;  4GE7 A;  2O0R A;  4DBC A;  4IYO A;  1EJI A;  1B6W A;  1M7Y A;  3AN2 B;  5B1L D;  4EB5 A;  1TOK A;  2HUI A;  5GT3 D;  4YM6 A;  3B0D C;  1W23 A;  4R8P A;  4KGC B;  5B0Y D;  4KUD D;  4Y0H A;  5DB5 A;  1JF9 A;  3AZF C;  4XUJ B;  5B31 A;  3ISL A;  2PYO D;  2FJ7 A;  5B33 D;  2F8N H;  2O7C A;  4WLH A;  3GZC A;  1H3O A;  1M1A B;  1KX5 A;  3GZD C;  4A6U A;  1UU1 A;  3MGS A;  3X1V B;  1M0Q A;  3REJ B;  5F99 B;  4LW2 A;  3O62 B;  2ZUK A;  5B24 A;  4J8X A;  5E5I A;  2ARO A;  1P3O A;  3TAT A;  4F5G A;  2EGY A;  1S0A A;  3LJA B;  3B6G B;  4DRB A;  3LV2 A;  4UQV A;  4WNN A;  1ID3 B;  1M0O A;  3RCH B;  1TPL A;  1P3P A;  5CP6 B;  4K05 A;  3DR4 A;  3NNK A;  4XUJ D;  2YRI A;  4H9R A;  3HDO A;  1P3A B;  3AV1 C;  2BYJ A;  2E7I A;  2YFW A;  1C7O A;  4OT8 A;  3TU4 A;  5AVC A;  3AZM C;  2VMY A;  2W7K A;  3PD6 A;  3REJ D;  3AEN B;  5DNN A;  2ZM5 A;  3AEJ C;  2YKU A;  3O62 D;  3QBO A;  5AV6 C;  5B2I C;  3W97 A;  3UTB C;  3MGR D;  2Z20 A;  3B6G D;  3KWQ B;  3NRA A;  1ID3 D;  5B2J C;  4R5F A;  5FT5 A;  1ASN A;  4UHN A;  2ZY4 A;  5CP6 D;  3MVD C;  5IWQ A;  3X1T C;  2BI3 A;  4WYG A;  2NQB C;  2BYM B;  3AZG A;  3QHX A;  3PA9 A;  1P3A D;  4WU8 C;  2ZY5 A;  1AOI D;  2DKJ A;  3W1J A;  5GXQ B;  2AY3 A;  3L8A A;  4Z5T C;  1LC7 A;  4OC9 A;  2IO5 B;  5HHY A;  1AHE A;  2ZP7 A;  1KX5 D;  4AZJ A;  3W96 A;  1F1E A;  1P3F A;  1AHX A;  1TAF A;  1ASE A;  4B98 A;  3AFA C;  4K2B A;  2AY8 A;  4M6B A;  2CIN A;  1C0N A;  3HVY A;  2E54 A;  2CJH A;  1O62 A;  2VGW A;  3KGW A;  4BMK A;  4J8U B;  2VMR A;  4Q31 A;  5D5S A;  3KUY B;  2W7J A;  2R5E A;  2NMP A;  5GXQ D;  2VMW A;  2W8J A;  4H9P B;  3UTA A;  2GMS A;  1X28 A;  2FYF A;  1PG8 A;  3ZZJ A;  1UU0 A;  2Z9X A;  4A0H A;  2G7J A;  3LEL B;  2G6W A;  2D5Y A;  4AO4 A;  1W7L A;  1F66 A;  3FKD A;  1ZLA C;  4JF0 A;  3LZ0 C;  4QLC A;  3WY7 A;  3JW9 A;  1N1J A;  1WKG A;  2W7G A;  2D63 A;  2VMZ A;  5GT0 B;  5M49 A;  3WGB A;  4J8U D;  2F2A C;  4W1W A;  3CQ5 A;  2Y2L A;  3KUY D;  5B0Z B;  3B6F B;  3H7F A;  3A9X A;  3BCX A;  2VMN A;  1O69 A;  5B40 C;  1MAQ A;  4IXO A;  5AVB B;  4AWL C;  3LEL D;  3REI C;  5BS7 A;  1M4N A;  3EPK A;  3AZL B;  3H0M C;  4NE6 A;  4PFN A;  1IAX A;  3CQ6 A;  4XZQ C;  2HP1 A;  5GT0 D;  1JG8 A;  2R5C A;  4YS3 A;  2J8P A;  5F9S A;  3N5M A;  1KX4 B;  3B6F D;  3LVM A;  1GD9 A;  1AAM A;  2PB0 A;  3OKS A;  1DFO A;  5HDM A;  3MGQ A;  3AYW B;  5AVB D;  3ACZ A;  5CPI D;  4G92 C;  4G91 C;  3KXB B;  1AHF A;  2LY8 A;  3FZ7 A;  3NYT A;  3AZL D;  2VGZ A;  2YCN A;  1V2D A;  4Z66 A;  1YIY A;  2HUE C;  3WA9 A;  5AV9 D;  4U2H A;  1LKC A;  4ZDO A;  2OKK A;  5CPJ D;  2VMX A;  8AAT A;  1EQZ C;  2AY9 A;  4IXS A;  4XJL A;  3B0D B;  1KX4 D;  2G5H C;  5CPK A;  3F6T A;  3FZ6 A;  1MGV A;  3ELE A;  3AZF B;  3E2F A;  5BNV A;  5DNM A;  3MGP C;  4LNJ A;  3AYW D;  2OGA A;  1AHY A;  2VYC A;  2OQX A;  5AY8 C;  5EUN A;  3KXB D;  1CQ8 A;  3MNN A;  2C7T A;  2HOZ A;  1MLZ A;  1EG5 A;  1QIR A;  3R4T A;  1KX3 C;  3NQU B;  2JSS A;  1GC3 A;  4DQ6 A;  2A1V A;  2JIS A;  1ASD A;  3TQX A;  7AAT A;  3REL A;  2BIG A;  4ADB A;  3C1B A;  3AZK A;  3VAX A;  5B32 C;  2VGV A;  1AMQ A;  1SZK A;  1G7X A;  1S07 A;  2Z61 A;  3K40 A;  4JEZ A;  1P3K A;  3DXV A;  4XJM A;  3X1S A;  1PMM A;  3AZF D;  3V9R A;  3AV1 B;  5JRG A;  4L0O A;  4TN4 A;  1W2E A;  4AO9 A;  3AZN C;  4XEW A;  2FKI A;  3AZM B;  1SF2 A;  1UKJ A;  4MQP A;  2VLF A;  3BWN A;  1RVY A;  1P3L A;  5AV6 B;  5B2I B;  3AZI A;  3UTB B;  3RBF A;  1AAW A;  4BA4 A;  1KKJ A;  1FC4 A;  4FFC A;  5E5A C;  2Y2H A;  3LZ1 A;  4ISY A;  1HQ3 D;  5B2J B;  1BH8 B;  3LWS A;  3AZH A;  2CFB A;  3DZZ A;  3BB8 A;  3RBL A;  4F5F A;  3MVD B;  2Q7W A;  3X1T B;  2NQB B;  1A7W A;  3UWC A;  4R8P C;  1JFI A;  4JF1 A;  4WU8 B;  3AV1 D;  1LK9 A;  4MSO A;  1QJ3 A;  3EUC A;  2FJ7 C;  4W8I A;  1ELU A;  4Z5T B;  1GC4 A;  3W98 C;  4H9O B;  3AZM D;  2X3L A;  2FNU A;  5TF5 A;  2YFV A;  5AX8 A;  4F5K A;  3DOD A;  5AV8 C;  5AV6 D;  5B2I D;  1M18 A;  3NU7 A;  3CBF A;  3MNN D;  2ORD A;  1ASC A;  3MBB A;  3AFA B;  2E7U A;  3RUY A;  1M19 C;  1BQD A;  4F5M A;  4WU9 C;  1AKB A;  3QN6 A;  3LG0 A;  3N0L A;  3X1T D;  3WTP A;  3MAU A;  2XBN A;  3REK A;  3HT4 A;  2ZY2 A;  4P3M A;  1E5E A;  3N4S A;  4A6T A;  1BH9 B;  4WU8 D;  3AV7 A;  2BWO A;  1WYT B;  1S32 A;  4CSR A;  3IP4 C;  1U35 C;  4Z5T D;  3C1C A;  1SFF A;  2YKY A;  4UUZ A;  1X0M A;  5DNN C;  3EZS A;  1KL1 A;  3AZE C;  3AV2 A;  2C0R A;  3MAF B;  2WB6 A;  1P3M D;  1TAR A;  3AFA D;  2VQR A;  3W97 C;  2VMU A;  2C44 A;  1ZLA B;  3LZ0 B;  2XD5 A;  3I4J A;  1ARI A;  4WXB A;  4BHD A;  5B1L A;  2HUU A;  4DRA A;  4JJN C;  3WTP E;  5GT3 A;  3LZ1 D;  1DGD A;  1TAT A;  5B0Y A;  4KUD A;  2PYO A;  5B40 B;  3F9T A;  3G0T A;  3E6G A;  4AWL B;  5B33 A;  3REI B;  1AJR A;  3ZRR A;  2QMA A;  3FCR A;  2W8W A;  5C6U A;  2EZ2 A;  1AJS A;  2YKV A;  3W96 C;  5G0A A;  4ZSY A;  4K2M A;  1ZLA D;  1P34 C;  1IVR A;  3LZ0 D;  1B5O A;  4XZQ B;  3DC1 A;  3EI7 A;  1D7S A;  3X1U C;  4Q6R A;  3N7N A;  5AV5 C;  2VGS A;  3QI6 A;  4XUJ A;  5B40 D;  2BWN A;  3A1K A;  4G92 B;  4G91 B;  1IUG A;  2NZD C;  3UE8 A;  3REJ A;  5F99 A;  3VP6 A;  4F5L A;  2HUE B;  2ZY3 A;  4LNM A;  3O62 A;  4JEX A;  5JA4 B;  1TAS A;  1M0P A;  1F66 C;  2BI2 A;  3DU4 A;  1MDO A;  1S06 A;  1I41 A;  1EQZ B;  3VK3 A;  3B6G A;  2CV5 B;  1ID3 A;  1KAF A;  3RCH A;  3PDB B;  1LW5 A;  4QGR A;  5CP6 A;  3JTX A;  3PIU A;  1DTY A;  3MGP B;  1P3A A;  2YKX A;  3QGU A;  1XI9 A;  1AOI A;  4HF8 A;  5AY8 B;  3DXW A;  3I5T A;  3QM2 A;  5M4D A;  1EQB A;  3E2Z B;  3WCN A;  3AEN A;  2VMO A;  1KX3 B;  3FVS A;  5BO0 B;  4ZLV A;  5FUG B;  4DQY B;  1EQZ D;  2KFP A;  2CV5 D;  4J8V C;  3JZL A;  4WYC A;  4X23 C;  5B32 B;  1V72 A;  4EFF A;  1Q9C A;  3JWA A;  1AY4 A;  3AN2 D;  3DRD A;  2BYM A;  4J8W C;  4OMA A;  4PIW A;  2QSR A;  5AY8 D;  4KHA B;  2OAT A;  3H0R C;  3WKJ C;  2BI9 A;  5GXQ A;  1P3B C;  4CVQ A;  5GSU C;  4KGC D;  3A6N C;  3AZN B;  4WYA A;  3WKS A;  4ZM3 A;  4ZDL A;  4ZBJ C;  4K2I A;  2FFF B;  1P3I C;  4ATQ A;  4H9N B;  1M1A D;  4Z66 C;  1O4S A;  2HIO B;  4Y0I A;  3PJ0 A;  3X1V D;  2VGU A;  5F99 D;  4AZK A;  5E5A B;  2O1B A;  5B32 D;  3PAA A;  1BJO B;  4J8U A;  5CPK C;  2DKB A;  3LJA D;  2CWE A;  4R8P B;  4GEB A;  4WYF A;  3KUY A;  4E77 A;  3NUB A;  2AY7 A;  4F5I A;  2FJ7 B;  4H9P A;  3AZN D;  3IHJ A;  1ZOB A;  3W98 B;  1BJN A;  1H3O B;  1TZY C;  2W8V A;  3B0C T;  2DGK A;  3LEL A;  3BC8 A;  5AV8 B;  1V2E A;  2YRR A;  1WYU B;  2HIO D;  4KAM A;  5BJ4 A;  3LY1 A;  1M19 B;  4EB7 A;  5E5A D;  5M46 A;  1B5P A;  2WK7 A;  5F8V A;  4WU9 B;  4E1O A;  3AZK C;  5GT0 A;  3AZJ C;  4LW4 A;  3KWQ D;  1O61 A;  1PMO A;  1AKA A;  1N8P A;  3B6F A;  2W8S A;  5EUE A;  1OAT A;  2WK9 A;  2Z9V A;  1U35 B;  1GEX A;  3W98 D;  2ZSM A;  4CXQ A;  5AVB A;  5G4I A;  5CPI A;  2BIE A;  3FD0 A;  3PPL A;  5DNN B;  2BYK B;  2WK8 A;  3AZE B;  5AV8 D;  2CTZ A;  1P3L C;  3AZL A;  3F0H A;  1M19 D;  3W97 B;  5AV9 A;  4WU9 D;  3UT9 C;  2EZ1 A;  1IAY A;  5CPJ A;  3NDN A;  4ZDP A;  4JJN B;  2CY8 A;  3VH5 T;  1P3G B;  1KX4 A;  1AIA A;  3BV0 A;  4LD9 C;  1G7W A;  3W99 C;  1U35 D;  4H9S C;  1FG7 A;  3AYW A;  3EIA A;  5B1M C;  4BA5 A;  3ASA A;  3KXB A;  3R9A A;  1N2T A;  3AZE D;  2CJG A;  3DR7 A;  4H63 Q;  4RM1 A;  2FNI A;  1B67 A;  1C7G A;  3EPH A;  3W96 B;  2Z9W A;  3MKJ A;  2CB1 A;  2FN6 A;  1TAF B;  1P34 B;  1AIB A;  3TFU A;  4UHM A;  3VK2 A;  3ASB A;  1ASF A;  1QGN A;  2CAN A;  5JAY A;  3X1U B;  2YCT A;  3WTP C;  2GQN A;  3REK C;  1P3G D;  5AV5 B;  4XQ2 A;  4IX8 A;  1C9C A;  1GDE A;  1E5F A;  3AZF A;  3Q8N A;  3GSB A;  4Q75 A;  5B0Z D;  1ASB A;  3P1T A;  3GZD A;  1GEY A;  2NZD B;  1YJZ A;  2BG1 A;  2YOB A;  3HMU A;  4ADD A;  2QB2 A;  1P34 D;  2X5F A;  3NQU A;  4J5U A;  1F66 B;  1SZS A;  3AEM C;  3B0C W;  3X1U D;  1V2F A;  3T32 A;  1Z3Z A;  3OP7 A;  1HQ3 A;  2D64 A;  1Y4I A;  3E77 A;  1LC8 A;  4EO5 C;  5AV5 D;  3B0B A;  2Y2P A;  4ZUX C;  3AV1 A;  2X5D A;  4KUD C;  2HOR A;  2BYL A;  3D6K A;  4Z2M G;  2AEU A;  4ATP A;  2NZD D;  4WB0 B;  1MDX A;  3AZM A;  1ASL A;  1P3W A;  3AEJ A;  4ADC A;  4CAY B;  5AV6 A;  5B2I A;  3ELP A;  3UTB A;  5BT1 C;  4EMY A;  3TFT A;  4R5Z A;  4J8V B;  1DKA A;  2R5C B;  4X23 B;  1BH8 A;  1Z7D A;  3REH C;  1C7N A;  2TPL A;  3X1T A;  3EPL A;  4DGT A;  4J8W B;  4A72 A;  2Y2O A;  4WU8 A;  4M2M A;  2RFV A;  1ARS A;  1KMJ A;  3WKJ B;  1P3B B;  5GSU B;  1PZR A;  3KFU G;  3A6N B;  3N4R A;  4Z5T A;  5BJ3 A;  4H9O A;  3AEP A;  1TOG A;  3B1E A;  4ZBJ B;  3VH5 W;  1P3I B;  1RV4 A;  2EPJ A;  3AAT A;  3REJ C;  1AY5 A;  3WAA C;  3LVK A;  3MEB A;  4Z66 B;  4WYE A;  2CJD A;  1P3M A;  3AFA A;  2W7I A;  1XEY A;  3PGY A;  3MGR C;  1VP4 A;  4X23 D;  3R45 B;  3BWO A;  3RQ1 A;  3BCA A;  4MQQ A;  5CPK B;  4J8W D;  3NTJ A;  5BNV B;  3WKJ D;  1P3A C;  1WYT A;  2JJG A;  4YM6 C;  1P3B D;  1AY8 A;  5GSU D;  1AOI C;  1B9I A;  2HUF A;  3A6N D;  1TZY B;  5EIG B;  1P3I D;  5B31 C;  1CL1 A;  3MAF A;  4B9B A;  1KX5 C;  5KDM A;  3EI5 A;  5G2Q A;  1WYV B;  3MGS C;  1ZLA A;  1D7V A;  2ZC0 A;  3LZ0 A;  4AOA A;  3AZK B;  3UTB D;  5B24 C;  4J8X C;  1CL2 A;  2F8J A;  3AZJ B;  2ARO C;  3VH5 A;  1P3O C;  3G7Q A;  4W1X A;  5B2J D;  3WLX A;  4XK1 A;  2JJE A;  3MVD D;  1UU2 A;  4GSA A;  2PB2 A;  2NQB D;  1P3P C;  1TZY D;  5B40 A;  2RIQ A;  2VMP A;  1MDZ A;  1KMK A;  1LW4 A;  3REI A;  3FQ7 A;  3WCO A;  1ECX A;  1P3L B;  3WGC A;  3TU4 C;  3FSL A;  1YOO A;  5AVC C;  4ZWV A;  1QJ5 A;  3FFH A;  3UT9 B;  4XZQ A;  1IJI A;  4Z2M H;  3AZJ D;  4HGA C;  3A9Y A;  1TOJ A;  3VH6 T;  1J32 A;  2AY1 A;  4LD9 B;  1BS0 A;  2EH6 A;  3W99 B;  5B32 G;  2JCH A;  2VLH A;  5FT8 A;  3QPG A;  1W7M A;  5B1M B;  1S08 A;  3AZG C;  2QLR A;  3GJU A;  1RV3 A;  1H1C A;  1LC5 A;  4RKD A;  4MQR A;  1JS6 A;  2ZSL A;  5JA4 A;  3UT9 D;  3EG5 B;  1QIT A;  1ASG A;  3NX3 A;  2D61 A;  1EQZ A;  1P3F C;  2CV5 A;  3WTP B;  1YNU A;  4BQ0 A;  3REK B;  4ZWM A;  3NQJ B;  1BFM A;  1M32 A;  3LVJ A;  3PDB A;  3AN2 A;  3MC6 A;  4LD9 D;  3ZZK A;  4ITG A;  2WKA A;  2OGE A;  2XD1 A;  5M4B A;  1ZOD A;  1SZU A;  5B1M D;  4PVF A;  5AY8 A;  2W7M A;  3WKR A;  4XAU A;  5CPI C;  4KGC A;  3E2Z A;  1B4X A;  3UTA C;  2AY4 A;  1CQ6 A;  1QZ9 A;  2ZYJ A;  3REI D;  4M2K A;  3W1I A;  1M1A A;  5BO0 A;  4E45 A;  5EUD A;  5AV9 C;  2VMS A;  5FUG A;  3X1V A;  3EI6 A;  5CPJ C;  4E3Q A;  5G09 A;  1VEF A;  1YAA A;  5B32 A;  4H9Q B;  4P7Y A;  4XZQ D;  4EO5 B;  4QLC C;  1DGE A;  4CBR A;  3LJA A;  4ZUX B;  5BNX B;  4KHA A;  1AIC A;  1AX4 A;  3AZN A;  2C81 A;  4NE5 A;  1IX7 A;  4W5K A;  1BJW A;  3VOM A;  5G49 B;  4H9N A;  3H0L C;  2F8N B;  5KTB A;  2HIO A;  4N0W A;  2E7J A;  5BS7 C;  1ARG A;  1W7N A;  2D65 A;  5E5A A;  2AY6 A;  5K8B A;  2V1P A;  3REH B;  2GMU A;  1BJO A;  1FG3 A;  1N31 A;  2EO5 A;  4WBT A;  3KWQ A;  4ZUX D;  2DQN C;  4YS3 C;  2Y2K A;  3KE3 A;  1YIZ A;  4E3R A;  4A6R A;  3W98 A;  5D95 A;  2Z9U A;  3MGP D;  3M5U A;  4GE4 A;  2RVQ C;  3VH6 W;  3MGQ C;  4RJ0 A;  3WAA B;  3E2Y A;  4GDY A;  5AV8 A;  1WWS A;  2F8N D;  1WYU A;  1KL2 A;  2W8T A;  3AL0 C;  5BT1 D;  1CZE A;  4EU1 A;  4IY7 A;  1M19 A;  1KKP A;  3NU8 A;  3MGR B;  5G4J A;  1KX3 D;  4A00 A;  4WU9 A;  5HXX A;  3REH D;  4WZS B;  1AMS A;  3WA9 C;  1HQ3 C;  4IYO B;  2UWX A;  1GC0 A;  2DOU A;  2D66 A;  4RKC A;  4WV4 B;  3EIB A;  3N75 A;  4YM6 B;  1AOI B;  4OTL A;  1HTA A;  1U35 A;  3FVU A;  5I92 A;  2FM1 A;  4WYD A;  4A0R A;  5B31 B;  1DJ9 A;  2EYQ A;  3AEL A;  5DNM C;  3WAA D;  3L44 A;  2BYK A;  3AZE A;  1R4V A;  1YJY A;  1KX5 B;  5FT6 A;  3WX9 A;  3MNN C;  3ZRP A;  3MGS B;  2Y2N A;  4Q76 A;  4NE3 A;  5EAV A;  5B24 B;  4J8X B;  2AY5 A;  2VMT A;  4WXG A;  4FL0 A;  4KYO A;  1CZC A;  2ARO B;  1P3O B;  4JJN A;  3USF A;  3VH6 A;  4WJ3 C;  3EI9 A;  3REL C;  1P3G A;  4OYT A;  4W1V A;  1TOI A;  4WNN B;  3C1B C;  4YM6 D;  3AOW A;  1P3P B;  4R8P D;  1P3K C;  3X1S C;  5B0Z A;  2Y2I A;  4HVK A;  5B31 D;  1QIS A;  2X8U A;  4H9R B;  2FJ7 D;  1PFF A;  2VGT A;  5JRG C;  2FQ6 A;  2YFW B;  3TU4 B;  1P3M C;  5AVC B;  3MGS D;  3PDX A;  1P34 A;  3PD6 B;  1SVV A;  3BS8 A;  4ADE A;  3BWN C;  1TOE A;  4PFF A;  5B24 D;  2DF4 C;  4J8X D;  4OBV A;  1H0C A;  4RIZ A;  2Z1Y A;  3UAK A;  1BJ4 A;  2ARO D;  3AZI C;  4HGA B;  3X1U A;  1P3O D;  4GE9 A;  3COG A;  1W3U A;  3RI6 A;  3LZ1 C;  5AV5 A;  3AZH C;  1P3P D;  2V0Y A;  9AAT A;  3AZG B;  5C3I C;  4E44 A;  2NZD A;  4MKK A;  4RIT A;  2GB3 A;  3TU4 D;  5AVC D;  4CXR A;  4MY5 A;  5DNN D;  1S09 A;  3A1I A;  1B9H A;  3FVX A;  1M18 C;  4H51 A;  1P3F B;  3W97 D;  4F5J A;  3N4X A;  1DJU A;  3HLM A;  4CBS A;  4TMR A;  3W1H A;  4JJN D;  1OHW A;  2JGT A;  3AZG D;  4Y0D A;  4LC3 A;  5CPI B;  4WB0 A;  1S32 C;  3UTA B;  4LNL A;  3C1C C;  5DJ9 A;  2ZJG A;  4CAY A;  2DGM A;  5AV9 B;  3GET A;  3FFR A;  4KXK A;  1BT4 A;  3B1C A;  4XJP A;  4WP0 A;  3AV2 C;  1WWI A;  3W96 D;  1D2F A;  1P3F D;  5CPJ B;  4J8V A;  1B8G A;  4X23 A;  3GBX A;  3B46 A;  4QLC B;  3ATH A;  4J8W A;  2BIA A;  1N1J B;  5B1L C;  4OBU A;  2W7H A;  3WKJ A;  5GT3 C;  1P3B A;  3NYU A;  4UPK A;  5GSU A;  2VI8 A;  3H9X A;  1ULY A;  3A6N A;  3HL2 A;  3KSY A;  1IX6 A;  3UTA D;  2HOY A;  3CAI A;  5B0Y C;  1P3I A;  2PYO C;  1AMA A;  1G4V A;  5B33 C;  2JJF A;  3HQT A;  3II0 A;  1GEW A;  1J04 A;  3FDD A;  3R45 A;  3NYS A;  1AHG A;  2HP2 A;  2CV5 C;  1F66 D;  4QLC D;  2CH2 A;  5CHL B;  3AN2 C;  1BQA A;  3MC6 C;  2BWP A;  3HBX A;  1IX8 A;  4YS3 B;  5B2J A;  2AEV A;  2D7Z A;  4U1T A;  1MLY A;  4RLG A;  3MVD A;  3EZ1 A;  2NQB A;  1TZY A;  4KGC C;  3FQ8 A;  3AEO A;  5EIG A;  4O6Z A;  4XUJ C;  4M2J A;  3MGQ B;  1GC2 A;  3BCB A;  2YHK A;  1SPA A;  1OHY A;  4J8L A;  2Z1Z A;  2AAT A; 
#chains in the Genus database with same CATH homology
 1M1A C;  2VI9 A;  3BN1 A;  1MAP A;  3MAD A;  1WYV A;  3GR9 A;  3LVL B;  3X1V C;  5EQC A;  1ORD A;  5F99 C;  4JEY A;  2VMQ A;  3FTB A;  2JG2 A;  1KU5 A;  3WA9 B;  1HQ3 B;  3O62 C;  1ELQ A;  1ART A;  3AZJ A;  4J8V D;  4YS3 D;  2CH1 A;  4ZSW A;  3LJA C;  3B6G C;  5EFS A;  3A2B A;  1ID3 C;  1I43 A;  5CP6 C;  2BI1 A;  4R8D A;  4XJO A;  1G4X A;  1BH9 A;  1VJO A;  5G2P A;  2RVQ D;  4IXZ A;  3MGQ D;  1T3U A;  5DNM B;  1GBN A;  3TCM A;  3JWB A;  4RJY A;  4W91 A;  2HIO C;  3MNN B;  5DX5 A;  3VK4 A;  3K7Y A;  3P6K A;  2QB3 A;  2QBT A;  3UT9 A;  3CQ4 A;  4Z66 D;  3WA9 D;  3FRK A;  3KKI A;  4RAE A;  3AOV A;  2AY2 A;  3REL B;  3KWQ C;  1LS3 A;  3C1B B;  4LD9 A;  3W99 A;  5CPK D;  2PO3 A;  2CST A;  4H9S A;  1P3K B;  3X1S B;  2W7F A;  5B1M A;  3V9R B;  5DNM D;  3FDB A;  4ITX A;  4A0G A;  5JRG B;  1CQ7 A;  5GXQ C;  5J8Q A;  1OHV A;  2W7D A;  1P3M B;  2IO5 C;  5FT4 A;  4R2N A;  3ECD A;  3AZI B;  2F8N G;  5DJ1 A;  1DJE A;  4ZAS A;  3REL D;  3NQJ A;  3LZ1 B;  1ARH A;  3C1B D;  3AZK D;  1WST A;  1AKC A;  1ZC9 A;  3AZH B;  2L5A A;  1I48 A;  2VIB A;  1P3K D;  1D7U A;  3X1S D;  4J8U C;  3I16 A;  2JE5 A;  1JFI B;  1U08 A;  1JS3 A;  3KUY C;  1AMR A;  5C3I B;  3DYD A;  1Z2C B;  1T3I A;  3E9K A;  2YCP A;  5JRG D;  4WD2 A;  1CS1 A;  1OXP A;  1X2A A;  2D7Y A;  1IBJ A;  5E3K A;  2Y2J A;  5E4Z A;  5KDM B;  2OKJ A;  2F8N K;  3KGX A;  2YFV B;  3LEL C;  1P3L D;  3AEM A;  2R0T A;  1M18 B;  3B8X A;  4GRX A;  1YJS A;  2HZP A;  3AZI D;  1GCK A;  4JEV A;  1C4K A;  4H9Q A;  1M0N A;  4OCA A;  2BHX A;  1P3G C;  3AZH D;  2BI5 A;  5GT0 C;  4ZUX A;  4ZAH A;  5BNX A;  4F5H A;  1X29 A;  1WKH A;  3FZ8 A;  1D7R A;  1BKG A;  5B0Z C;  3B6F C;  3W99 D;  1S32 B;  3NUI A;  2VMV A;  4CSR B;  3MGP A;  2BKW A;  2VIA A;  3GWP A;  4WXF A;  4UHO A;  3C1C B;  3A9Z A;  4F4E A;  5G49 A;  2JJH A;  5AVB C;  2HOX A;  4NFT A;  2F8N A;  1ASA A;  4UUZ B;  2XH1 A;  3A8U X;  5B31 G;  3K28 A;  2G5I C;  1M18 D;  3AV2 B;  3WZF A;  3FQA A;  3AZL C;  1KX3 A;  4ZM4 A;  4I8A A;  4AH3 A;  3REH A;  1OXO A;  1I29 A;  4WLJ A;  2DGL A;  2Y2G A;  2DR1 A;  4UOY A;  5B1L B;  2W7L A;  2W7E A;  2Y2M A;  3WTP D;  3EI8 A;  4JEW A;  4NOG A;  3REK D;  1M6S A;  2W8U A;  5GT3 B;  3ZRQ A;  1KX4 C;  3B1D A;  1S32 D;  1CJ0 A;  3EPJ A;  4IW7 A;  5B0Y B;  1BW0 A;  4KUD B;  3C1C D;  2PYO B;  2Y2Q A;  5EAA A;  3AYW C;  3WAA A;  1ASM A;  3G8M A;  5B33 B;  4A0F A;  4MKJ A;  3KXB C;  1RVU A;  2R2N A;  3AV2 D;  3P5J B;  2GSA A;  3MGR A;  2QA3 A;  1AJS B;  4GE7 A;  2O0R A;  4DBC A;  4IYO A;  1EJI A;  1B6W A;  1M7Y A;  3AN2 B;  5B1L D;  4EB5 A;  1TOK A;  2HUI A;  5GT3 D;  4YM6 A;  3B0D C;  1W23 A;  4R8P A;  4KGC B;  5B0Y D;  4KUD D;  4Y0H A;  5DB5 A;  1JF9 A;  3AZF C;  4XUJ B;  5B31 A;  3ISL A;  2PYO D;  2FJ7 A;  5B33 D;  2F8N H;  2O7C A;  4WLH A;  3GZC A;  1H3O A;  1M1A B;  1KX5 A;  3GZD C;  4A6U A;  1UU1 A;  3MGS A;  3X1V B;  1M0Q A;  3REJ B;  5F99 B;  4LW2 A;  3O62 B;  2ZUK A;  5B24 A;  4J8X A;  5E5I A;  2ARO A;  1P3O A;  3TAT A;  4F5G A;  2EGY A;  1S0A A;  3LJA B;  3B6G B;  4DRB A;  3LV2 A;  4UQV A;  4WNN A;  1ID3 B;  1M0O A;  3RCH B;  1TPL A;  1P3P A;  5CP6 B;  4K05 A;  3DR4 A;  3NNK A;  4XUJ D;  2YRI A;  4H9R A;  3HDO A;  1P3A B;  3AV1 C;  2BYJ A;  2E7I A;  2YFW A;  1C7O A;  4OT8 A;  3TU4 A;  5AVC A;  3AZM C;  2VMY A;  2W7K A;  3PD6 A;  3REJ D;  3AEN B;  5DNN A;  2ZM5 A;  3AEJ C;  2YKU A;  3O62 D;  3QBO A;  5AV6 C;  5B2I C;  3W97 A;  3UTB C;  3MGR D;  2Z20 A;  3B6G D;  3KWQ B;  3NRA A;  1ID3 D;  5B2J C;  4R5F A;  5FT5 A;  1ASN A;  4UHN A;  2ZY4 A;  5CP6 D;  3MVD C;  5IWQ A;  3X1T C;  2BI3 A;  4WYG A;  2NQB C;  2BYM B;  3AZG A;  3QHX A;  3PA9 A;  1P3A D;  4WU8 C;  2ZY5 A;  1AOI D;  2DKJ A;  3W1J A;  5GXQ B;  2AY3 A;  3L8A A;  4Z5T C;  1LC7 A;  4OC9 A;  2IO5 B;  5HHY A;  1AHE A;  2ZP7 A;  1KX5 D;  4AZJ A;  3W96 A;  1F1E A;  1P3F A;  1AHX A;  1TAF A;  1ASE A;  4B98 A;  3AFA C;  4K2B A;  2AY8 A;  4M6B A;  2CIN A;  1C0N A;  3HVY A;  2E54 A;  2CJH A;  1O62 A;  2VGW A;  3KGW A;  4BMK A;  4J8U B;  2VMR A;  4Q31 A;  5D5S A;  3KUY B;  2W7J A;  2R5E A;  2NMP A;  5GXQ D;  2VMW A;  2W8J A;  4H9P B;  3UTA A;  2GMS A;  1X28 A;  2FYF A;  1PG8 A;  3ZZJ A;  1UU0 A;  2Z9X A;  4A0H A;  2G7J A;  3LEL B;  2G6W A;  2D5Y A;  4AO4 A;  1W7L A;  1F66 A;  3FKD A;  1ZLA C;  4JF0 A;  3LZ0 C;  4QLC A;  3WY7 A;  3JW9 A;  1N1J A;  1WKG A;  2W7G A;  2D63 A;  2VMZ A;  5GT0 B;  5M49 A;  3WGB A;  4J8U D;  2F2A C;  4W1W A;  3CQ5 A;  2Y2L A;  3KUY D;  5B0Z B;  3B6F B;  3H7F A;  3A9X A;  3BCX A;  2VMN A;  1O69 A;  5B40 C;  1MAQ A;  4IXO A;  5AVB B;  4AWL C;  3LEL D;  3REI C;  5BS7 A;  1M4N A;  3EPK A;  3AZL B;  3H0M C;  4NE6 A;  4PFN A;  1IAX A;  3CQ6 A;  4XZQ C;  2HP1 A;  5GT0 D;  1JG8 A;  2R5C A;  4YS3 A;  2J8P A;  5F9S A;  3N5M A;  1KX4 B;  3B6F D;  3LVM A;  1GD9 A;  1AAM A;  2PB0 A;  3OKS A;  1DFO A;  5HDM A;  3MGQ A;  3AYW B;  5AVB D;  3ACZ A;  5CPI D;  4G92 C;  4G91 C;  3KXB B;  1AHF A;  2LY8 A;  3FZ7 A;  3NYT A;  3AZL D;  2VGZ A;  2YCN A;  1V2D A;  4Z66 A;  1YIY A;  2HUE C;  3WA9 A;  5AV9 D;  4U2H A;  1LKC A;  4ZDO A;  2OKK A;  5CPJ D;  2VMX A;  8AAT A;  1EQZ C;  2AY9 A;  4IXS A;  4XJL A;  3B0D B;  1KX4 D;  2G5H C;  5CPK A;  3F6T A;  3FZ6 A;  1MGV A;  3ELE A;  3AZF B;  3E2F A;  5BNV A;  5DNM A;  3MGP C;  4LNJ A;  3AYW D;  2OGA A;  1AHY A;  2VYC A;  2OQX A;  5AY8 C;  5EUN A;  3KXB D;  1CQ8 A;  3MNN A;  2C7T A;  2HOZ A;  1MLZ A;  1EG5 A;  1QIR A;  3R4T A;  1KX3 C;  3NQU B;  2JSS A;  1GC3 A;  4DQ6 A;  2A1V A;  2JIS A;  1ASD A;  3TQX A;  7AAT A;  3REL A;  2BIG A;  4ADB A;  3C1B A;  3AZK A;  3VAX A;  5B32 C;  2VGV A;  1AMQ A;  1SZK A;  1G7X A;  1S07 A;  2Z61 A;  3K40 A;  4JEZ A;  1P3K A;  3DXV A;  4XJM A;  3X1S A;  1PMM A;  3AZF D;  3V9R A;  3AV1 B;  5JRG A;  4L0O A;  4TN4 A;  1W2E A;  4AO9 A;  3AZN C;  4XEW A;  2FKI A;  3AZM B;  1SF2 A;  1UKJ A;  4MQP A;  2VLF A;  3BWN A;  1RVY A;  1P3L A;  5AV6 B;  5B2I B;  3AZI A;  3UTB B;  3RBF A;  1AAW A;  4BA4 A;  1KKJ A;  1FC4 A;  4FFC A;  5E5A C;  2Y2H A;  3LZ1 A;  4ISY A;  1HQ3 D;  5B2J B;  1BH8 B;  3LWS A;  3AZH A;  2CFB A;  3DZZ A;  3BB8 A;  3RBL A;  4F5F A;  3MVD B;  2Q7W A;  3X1T B;  2NQB B;  1A7W A;  3UWC A;  4R8P C;  1JFI A;  4JF1 A;  4WU8 B;  3AV1 D;  1LK9 A;  4MSO A;  1QJ3 A;  3EUC A;  2FJ7 C;  4W8I A;  1ELU A;  4Z5T B;  1GC4 A;  3W98 C;  4H9O B;  3AZM D;  2X3L A;  2FNU A;  5TF5 A;  2YFV A;  5AX8 A;  4F5K A;  3DOD A;  5AV8 C;  5AV6 D;  5B2I D;  1M18 A;  3NU7 A;  3CBF A;  3MNN D;  2ORD A;  1ASC A;  3MBB A;  3AFA B;  2E7U A;  3RUY A;  1M19 C;  1BQD A;  4F5M A;  4WU9 C;  1AKB A;  3QN6 A;  3LG0 A;  3N0L A;  3X1T D;  3WTP A;  3MAU A;  2XBN A;  3REK A;  3HT4 A;  2ZY2 A;  4P3M A;  1E5E A;  3N4S A;  4A6T A;  1BH9 B;  4WU8 D;  3AV7 A;  2BWO A;  1WYT B;  1S32 A;  4CSR A;  3IP4 C;  1U35 C;  4Z5T D;  3C1C A;  1SFF A;  2YKY A;  4UUZ A;  1X0M A;  5DNN C;  3EZS A;  1KL1 A;  3AZE C;  3AV2 A;  2C0R A;  3MAF B;  2WB6 A;  1P3M D;  1TAR A;  3AFA D;  2VQR A;  3W97 C;  2VMU A;  2C44 A;  1ZLA B;  3LZ0 B;  2XD5 A;  3I4J A;  1ARI A;  4WXB A;  4BHD A;  5B1L A;  2HUU A;  4DRA A;  4JJN C;  3WTP E;  5GT3 A;  3LZ1 D;  1DGD A;  1TAT A;  5B0Y A;  4KUD A;  2PYO A;  5B40 B;  3F9T A;  3G0T A;  3E6G A;  4AWL B;  5B33 A;  3REI B;  1AJR A;  3ZRR A;  2QMA A;  3FCR A;  2W8W A;  5C6U A;  2EZ2 A;  1AJS A;  2YKV A;  3W96 C;  5G0A A;  4ZSY A;  4K2M A;  1ZLA D;  1P34 C;  1IVR A;  3LZ0 D;  1B5O A;  4XZQ B;  3DC1 A;  3EI7 A;  1D7S A;  3X1U C;  4Q6R A;  3N7N A;  5AV5 C;  2VGS A;  3QI6 A;  4XUJ A;  5B40 D;  2BWN A;  3A1K A;  4G92 B;  4G91 B;  1IUG A;  2NZD C;  3UE8 A;  3REJ A;  5F99 A;  3VP6 A;  4F5L A;  2HUE B;  2ZY3 A;  4LNM A;  3O62 A;  4JEX A;  5JA4 B;  1TAS A;  1M0P A;  1F66 C;  2BI2 A;  3DU4 A;  1MDO A;  1S06 A;  1I41 A;  1EQZ B;  3VK3 A;  3B6G A;  2CV5 B;  1ID3 A;  3RCH A;  3PDB B;  1LW5 A;  4QGR A;  5CP6 A;  3JTX A;  3PIU A;  1DTY A;  3MGP B;  1P3A A;  2YKX A;  3QGU A;  1XI9 A;  1AOI A;  4HF8 A;  5AY8 B;  3DXW A;  3I5T A;  3QM2 A;  5M4D A;  1EQB A;  3E2Z B;  3WCN A;  3AEN A;  2VMO A;  1KX3 B;  3FVS A;  5BO0 B;  4ZLV A;  5FUG B;  4DQY B;  1EQZ D;  2KFP A;  2CV5 D;  4J8V C;  3JZL A;  4WYC A;  4X23 C;  5B32 B;  1V72 A;  4EFF A;  1Q9C A;  3JWA A;  1AY4 A;  3AN2 D;  3DRD A;  2BYM A;  4J8W C;  4OMA A;  4PIW A;  2QSR A;  5AY8 D;  4KHA B;  2OAT A;  3H0R C;  3WKJ C;  2BI9 A;  5GXQ A;  1P3B C;  4CVQ A;  5GSU C;  4KGC D;  3A6N C;  3AZN B;  4WYA A;  3WKS A;  4ZM3 A;  4ZDL A;  4ZBJ C;  4K2I A;  2FFF B;  1P3I C;  4ATQ A;  4H9N B;  1M1A D;  4Z66 C;  1O4S A;  2HIO B;  4Y0I A;  3PJ0 A;  3X1V D;  2VGU A;  5F99 D;  4AZK A;  5E5A B;  2O1B A;  5B32 D;  3PAA A;  1BJO B;  4J8U A;  5CPK C;  2DKB A;  3LJA D;  2CWE A;  4R8P B;  4GEB A;  4WYF A;  3KUY A;  4E77 A;  3NUB A;  2AY7 A;  4F5I A;  2FJ7 B;  4H9P A;  3AZN D;  3IHJ A;  1ZOB A;  3W98 B;  1BJN A;  1H3O B;  1TZY C;  2W8V A;  3B0C T;  2DGK A;  3LEL A;  3BC8 A;  5AV8 B;  1V2E A;  2YRR A;  1WYU B;  2HIO D;  4KAM A;  5BJ4 A;  3LY1 A;  1M19 B;  4EB7 A;  5E5A D;  5M46 A;  1B5P A;  2WK7 A;  5F8V A;  4WU9 B;  4E1O A;  3AZK C;  5GT0 A;  3AZJ C;  4LW4 A;  3KWQ D;  1O61 A;  1PMO A;  1AKA A;  1N8P A;  3B6F A;  2W8S A;  5EUE A;  1OAT A;  2WK9 A;  2Z9V A;  1U35 B;  1GEX A;  3W98 D;  2ZSM A;  4CXQ A;  5AVB A;  5G4I A;  5CPI A;  2BIE A;  3FD0 A;  3PPL A;  5DNN B;  2BYK B;  2WK8 A;  3AZE B;  5AV8 D;  2CTZ A;  1P3L C;  3AZL A;  3F0H A;  1M19 D;  3W97 B;  5AV9 A;  4WU9 D;  3UT9 C;  2EZ1 A;  1IAY A;  5CPJ A;  3NDN A;  4ZDP A;  4JJN B;  2CY8 A;  3VH5 T;  1P3G B;  1KX4 A;  1AIA A;  3BV0 A;  4LD9 C;  1G7W A;  3W99 C;  1U35 D;  4H9S C;  1FG7 A;  3AYW A;  3EIA A;  5B1M C;  4BA5 A;  3ASA A;  3KXB A;  3R9A A;  1N2T A;  3AZE D;  2CJG A;  3DR7 A;  4H63 Q;  4RM1 A;  2FNI A;  1B67 A;  1C7G A;  3EPH A;  3W96 B;  2Z9W A;  3MKJ A;  2CB1 A;  2FN6 A;  1TAF B;  1P34 B;  1AIB A;  3TFU A;  4UHM A;  3VK2 A;  3ASB A;  1ASF A;  1QGN A;  2CAN A;  5JAY A;  3X1U B;  2YCT A;  3WTP C;  2GQN A;  3REK C;  1P3G D;  5AV5 B;  4XQ2 A;  4IX8 A;  1C9C A;  1GDE A;  1E5F A;  3AZF A;  3Q8N A;  3GSB A;  4Q75 A;  5B0Z D;  1ASB A;  3P1T A;  3GZD A;  1GEY A;  2NZD B;  1YJZ A;  2BG1 A;  2YOB A;  3HMU A;  4ADD A;  2QB2 A;  1P34 D;  2X5F A;  3NQU A;  4J5U A;  1F66 B;  1SZS A;  3AEM C;  3B0C W;  3X1U D;  1V2F A;  3T32 A;  1Z3Z A;  3OP7 A;  1HQ3 A;  2D64 A;  1Y4I A;  3E77 A;  1LC8 A;  4EO5 C;  5AV5 D;  3B0B A;  2Y2P A;  4ZUX C;  3AV1 A;  2X5D A;  4KUD C;  2HOR A;  2BYL A;  3D6K A;  4Z2M G;  2AEU A;  4ATP A;  2NZD D;  4WB0 B;  1MDX A;  3AZM A;  1ASL A;  1P3W A;  3AEJ A;  4ADC A;  4CAY B;  5AV6 A;  5B2I A;  3ELP A;  3UTB A;  5BT1 C;  4EMY A;  3TFT A;  4R5Z A;  4J8V B;  1DKA A;  2R5C B;  4X23 B;  1BH8 A;  1Z7D A;  3REH C;  1C7N A;  2TPL A;  3X1T A;  3EPL A;  4DGT A;  4J8W B;  4A72 A;  2Y2O A;  4WU8 A;  4M2M A;  2RFV A;  1ARS A;  1KMJ A;  3WKJ B;  1P3B B;  5GSU B;  1PZR A;  3KFU G;  3A6N B;  3N4R A;  4Z5T A;  5BJ3 A;  4H9O A;  3AEP A;  1TOG A;  3B1E A;  4ZBJ B;  3VH5 W;  1P3I B;  1RV4 A;  2EPJ A;  3AAT A;  3REJ C;  1AY5 A;  3WAA C;  3LVK A;  3MEB A;  4Z66 B;  4WYE A;  2CJD A;  1P3M A;  3AFA A;  2W7I A;  1XEY A;  3PGY A;  3MGR C;  1VP4 A;  4X23 D;  3R45 B;  3BWO A;  3RQ1 A;  3BCA A;  4MQQ A;  5CPK B;  4J8W D;  3NTJ A;  5BNV B;  3WKJ D;  1P3A C;  1WYT A;  2JJG A;  4YM6 C;  1P3B D;  1AY8 A;  5GSU D;  1AOI C;  1B9I A;  2HUF A;  3A6N D;  1TZY B;  5EIG B;  1P3I D;  5B31 C;  1CL1 A;  3MAF A;  4B9B A;  1KX5 C;  5KDM A;  3EI5 A;  5G2Q A;  1WYV B;  3MGS C;  1ZLA A;  1D7V A;  2ZC0 A;  3LZ0 A;  4AOA A;  3AZK B;  3UTB D;  5B24 C;  4J8X C;  1CL2 A;  2F8J A;  3AZJ B;  2ARO C;  3VH5 A;  1P3O C;  3G7Q A;  4W1X A;  5B2J D;  3WLX A;  4XK1 A;  2JJE A;  3MVD D;  1UU2 A;  4GSA A;  2PB2 A;  2NQB D;  1P3P C;  1TZY D;  5B40 A;  2RIQ A;  2VMP A;  1MDZ A;  1KMK A;  1LW4 A;  3REI A;  3FQ7 A;  3WCO A;  1ECX A;  1P3L B;  3WGC A;  3TU4 C;  3FSL A;  1YOO A;  5AVC C;  4ZWV A;  1QJ5 A;  3FFH A;  3UT9 B;  4XZQ A;  1IJI A;  4Z2M H;  3AZJ D;  4HGA C;  3A9Y A;  1TOJ A;  3VH6 T;  1J32 A;  2AY1 A;  4LD9 B;  1BS0 A;  2EH6 A;  3W99 B;  5B32 G;  2JCH A;  2VLH A;  5FT8 A;  3QPG A;  1W7M A;  5B1M B;  1S08 A;  3AZG C;  2QLR A;  3GJU A;  1RV3 A;  1H1C A;  1LC5 A;  4RKD A;  4MQR A;  1JS6 A;  2ZSL A;  5JA4 A;  3UT9 D;  3EG5 B;  1QIT A;  1ASG A;  3NX3 A;  2D61 A;  1EQZ A;  1P3F C;  2CV5 A;  3WTP B;  1YNU A;  4BQ0 A;  3REK B;  4ZWM A;  3NQJ B;  1BFM A;  1M32 A;  3LVJ A;  3PDB A;  3AN2 A;  3MC6 A;  4LD9 D;  3ZZK A;  4ITG A;  2WKA A;  2OGE A;  2XD1 A;  5M4B A;  1ZOD A;  1SZU A;  5B1M D;  4PVF A;  5AY8 A;  2W7M A;  3WKR A;  4XAU A;  5CPI C;  4KGC A;  3E2Z A;  1B4X A;  3UTA C;  2AY4 A;  1CQ6 A;  1QZ9 A;  2ZYJ A;  3REI D;  4M2K A;  3W1I A;  1M1A A;  5BO0 A;  4E45 A;  5EUD A;  5AV9 C;  2VMS A;  5FUG A;  3X1V A;  3EI6 A;  5CPJ C;  4E3Q A;  5G09 A;  1VEF A;  1YAA A;  5B32 A;  4H9Q B;  4P7Y A;  4XZQ D;  4EO5 B;  4QLC C;  1DGE A;  4CBR A;  3LJA A;  4ZUX B;  5BNX B;  4KHA A;  1AIC A;  1AX4 A;  3AZN A;  2C81 A;  4NE5 A;  1IX7 A;  4W5K A;  1BJW A;  3VOM A;  5G49 B;  4H9N A;  3H0L C;  2F8N B;  5KTB A;  2HIO A;  4N0W A;  2E7J A;  5BS7 C;  1ARG A;  1W7N A;  2D65 A;  5E5A A;  2AY6 A;  5K8B A;  2V1P A;  3REH B;  2GMU A;  1BJO A;  1FG3 A;  1N31 A;  2EO5 A;  4WBT A;  3KWQ A;  4ZUX D;  2DQN C;  4YS3 C;  2Y2K A;  3KE3 A;  1YIZ A;  4E3R A;  4A6R A;  3W98 A;  5D95 A;  2Z9U A;  3MGP D;  3M5U A;  4GE4 A;  2RVQ C;  3VH6 W;  3MGQ C;  4RJ0 A;  3WAA B;  3E2Y A;  4GDY A;  5AV8 A;  1WWS A;  2F8N D;  1WYU A;  1KL2 A;  2W8T A;  3AL0 C;  5BT1 D;  1CZE A;  4EU1 A;  4IY7 A;  1M19 A;  1KKP A;  3NU8 A;  3MGR B;  5G4J A;  1KX3 D;  4A00 A;  4WU9 A;  5HXX A;  3REH D;  4WZS B;  1AMS A;  3WA9 C;  1HQ3 C;  4IYO B;  2UWX A;  1GC0 A;  2DOU A;  2D66 A;  4RKC A;  4WV4 B;  3EIB A;  3N75 A;  4YM6 B;  1AOI B;  4OTL A;  1HTA A;  1U35 A;  3FVU A;  5I92 A;  2FM1 A;  4WYD A;  4A0R A;  5B31 B;  1DJ9 A;  2EYQ A;  3AEL A;  5DNM C;  3WAA D;  3L44 A;  2BYK A;  3AZE A;  1R4V A;  1YJY A;  1KX5 B;  5FT6 A;  3WX9 A;  3MNN C;  3ZRP A;  3MGS B;  2Y2N A;  4Q76 A;  4NE3 A;  5EAV A;  5B24 B;  4J8X B;  2AY5 A;  2VMT A;  4WXG A;  4FL0 A;  4KYO A;  1CZC A;  2ARO B;  1P3O B;  4JJN A;  3USF A;  3VH6 A;  4WJ3 C;  3EI9 A;  3REL C;  1P3G A;  4OYT A;  4W1V A;  1TOI A;  4WNN B;  3C1B C;  4YM6 D;  3AOW A;  1P3P B;  4R8P D;  1P3K C;  3X1S C;  5B0Z A;  2Y2I A;  4HVK A;  5B31 D;  1QIS A;  2X8U A;  4H9R B;  2FJ7 D;  1PFF A;  2VGT A;  5JRG C;  2FQ6 A;  2YFW B;  3TU4 B;  1P3M C;  5AVC B;  3MGS D;  3PDX A;  1P34 A;  3PD6 B;  1SVV A;  3BS8 A;  4ADE A;  3BWN C;  1TOE A;  4PFF A;  5B24 D;  2DF4 C;  4J8X D;  4OBV A;  1H0C A;  4RIZ A;  2Z1Y A;  3UAK A;  1BJ4 A;  2ARO D;  3AZI C;  4HGA B;  3X1U A;  1P3O D;  4GE9 A;  3COG A;  1W3U A;  3RI6 A;  3LZ1 C;  5AV5 A;  3AZH C;  1P3P D;  2V0Y A;  9AAT A;  3AZG B;  5C3I C;  4E44 A;  2NZD A;  4MKK A;  4RIT A;  2GB3 A;  3TU4 D;  5AVC D;  4CXR A;  4MY5 A;  5DNN D;  1S09 A;  3A1I A;  1B9H A;  3FVX A;  1M18 C;  4H51 A;  1P3F B;  3W97 D;  4F5J A;  3N4X A;  1DJU A;  3HLM A;  4CBS A;  4TMR A;  3W1H A;  4JJN D;  1OHW A;  2JGT A;  3AZG D;  4Y0D A;  4LC3 A;  5CPI B;  4WB0 A;  1S32 C;  3UTA B;  4LNL A;  3C1C C;  5DJ9 A;  2ZJG A;  4CAY A;  2DGM A;  5AV9 B;  3GET A;  3FFR A;  4KXK A;  1BT4 A;  3B1C A;  4XJP A;  4WP0 A;  3AV2 C;  1WWI A;  3W96 D;  1D2F A;  1P3F D;  5CPJ B;  4J8V A;  1B8G A;  4X23 A;  3GBX A;  3B46 A;  4QLC B;  3ATH A;  4J8W A;  2BIA A;  1N1J B;  5B1L C;  4OBU A;  2W7H A;  3WKJ A;  5GT3 C;  1P3B A;  3NYU A;  4UPK A;  5GSU A;  2VI8 A;  3H9X A;  1ULY A;  3A6N A;  3HL2 A;  3KSY A;  1IX6 A;  3UTA D;  2HOY A;  3CAI A;  5B0Y C;  1P3I A;  2PYO C;  1AMA A;  1G4V A;  5B33 C;  2JJF A;  3HQT A;  3II0 A;  1GEW A;  1J04 A;  3FDD A;  3R45 A;  3NYS A;  1AHG A;  2HP2 A;  2CV5 C;  1F66 D;  4QLC D;  2CH2 A;  5CHL B;  3AN2 C;  1BQA A;  3MC6 C;  2BWP A;  3HBX A;  1IX8 A;  4YS3 B;  5B2J A;  2AEV A;  2D7Z A;  4U1T A;  1MLY A;  4RLG A;  3MVD A;  3EZ1 A;  2NQB A;  1TZY A;  4KGC C;  3FQ8 A;  3AEO A;  5EIG A;  4O6Z A;  4XUJ C;  4M2J A;  3MGQ B;  1GC2 A;  3BCB A;  2YHK A;  1SPA A;  1OHY A;  4J8L A;  2Z1Z A;  2AAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...