3FVUA

Crystal structure of human kynurenine aminotransferase i in complex with indole-3-acetic acid
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
419
structure length
418
Chain Sequence
QLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kynurenine--oxoglutarate transaminase 1
publication title Structural insight into the inhibition of human kynurenine aminotransferase I/glutamine transaminase K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase, transferase
total genus 145
structure length 418
sequence length 419
chains with identical sequence B
ec nomenclature ec 2.6.1.64: Glutamine--phenylpyruvate transaminase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3fvuA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3fvuA01
3HQTA 1ASAA 1JS3A 3AOVA 2AY3A 3BS8A 3DXVA 1D7SA 1W7NA 1AX4A 2AY8A 1ASMA 1GEXA 1ASBA 1S0AA 2XH1A 3EIBA 3II0A 1UKJA 1QGNA 2EZ2A 5DX5A 3EI6A 1RVUA 3MEBA 1ARGA 1PMOA 2D5YA 1W7LA 3E2YA 3BWNC 3F6TA 1BS0A 4MSOA 4WXBA 1GEWA 1V2EA 1CZCA 4I8AA 4ZSYA 4DQ6A 1CS1A 4WB0A 4XJMA 3GBXA 4BHDA 4KAMA 4R8DA 3GETA 2VIAA 4AZKA 3AEMA 5HHYA 2AY5A 3I5TA 1SZSA 2C81A 2DGKA 3B1DA 1N31A 1JS6A 3HLMA 1LC5A 2HUUA 1SPAA 2R5CA 5DB5A 2NMPA 3K28A 4A6TA 2ZY5A 1AICA 2BI2A 2W7JA 4WBTA 2VGWA 2HOYA 4ITXA 1D2FA 5DJ9A 4CXRA 1M6SA 4BMKA 3ASBA 2OGEA 3WZFA 3QPGA 3WKRA 1B9HA 3IHJA 4Y0HA 1C0NA 2ZY2A 4RKDA 2EH6A 2YKXA 1TARA 1AJRA 3HL2A 3WKSA 2ZYJA 1M0NA 2X5FA 1PFFA 1I41A 1C7OA 1C7GA 3H7FA 3KKIA 4A72A 5AX8A 3WLXA 2V1PA 1V2DA 2VIBA 1J32A 4JEYA 1H0CA 1BJNA 1OXPA 3DXWA 2CY8A 5JAYA 2X3LA 5G0AA 3I4JA 4HF8A 1AHXA 1LKCA 1WYTB 1IUGA 2ZSMA 3LY1A 2CFBA 2F8JA 2W7FA 3AELA 3PDBB 1QITA 2JG2A 4A00A 1AY4A 1OATA 2G6WA 3NUIA 4Y0IA 1BJOB 2CINA 3E9KA 1SFFA 3EI5A 1DFOA 5C6UA 1AY8A 1UU1A 2CANA 3B46A 2VI8A 2YKVA 5M49A 2AEVA 2Z20A 1FC4A 1S09A 2DKJA 2VMYA 3VK4A 3ZZKA 1WSTA 1OHYA 5FT5A 2FQ6A 1TATA 1GCKA 3CQ4A 4WLJA 3FVSA 1O61A 3EUCA 4Y0DA 3LVLB 1S08A 1DGDA 2FM1A 3B1CA 3FFRA 3JWBA 2VMUA 2FYFA 1V72A 4IX8A 2W7HA 3RBLA 1M4NA 3F0HA 3MC6C 1YIZA 2C7TA 1VEFA 5EAAA 4TN4A 3PGYA 3ASAA 4RLGA 3WY7A 1IX7A 3FKDA 1GBNA 3P6KA 2QB2A 4XJLA 2Z1YA 2WK7A 5D5SA 3PJ0A 2V0YA 1IVRA 4A0RA 4GRXA 1RV4A 1ARHA 2BWPA 3DC1A 1BJ4A 4LW2A 2QA3A 2C0RA 2E7JA 2CJDA 4IYOB 2OATA 4OTLA 3ATHA 2YRRA 1PG8A 3G7QA 3AATA 4ADEA 2DOUA 4MQRA 4ATQA 2GMUA 2Z67A 3FTBA 1B8GA 1WYTA 4TMRA 5I92A 3N75A 1AKCA 2D63A 2VGTA 3KGXA 3PDBA 1Y4IA 3DRDA 3AEPA 2CH1A 1VP4A 2VMOA 4NOGA 1QJ5A 2E7UA 2VLHA 1BJOA 5FT8A 1FG3A 2HOXA 1C9CA 2VGUA 1B9IA 3NYTA 2W7GA 1AMQA 1X0MA 2ZSLA 3KE3A 2Z1ZA 1AMSA 4B98A 2QBTA 1H1CA 3HBXA 3QBOA 4RM1A 2VMZA 3W1JA 3WX9A 3ELPA 4LW4A 1AKAA 2YRIA 4ZWVA 1LS3A 4LNJA 2W8TA 5HDMA 4A0FA 1M0PA 3Q8NA 1YJZA 2D7ZA 3NRAA 4WYFA 1QISA 1SVVA 5G4JA 5M4DA 5LH9A 2ZY3A 3QN6A 1ZODA 4ITGA 3WCNA 3BN1A 2RFVA 3ISLA 5EUEA 2BYLA 1X28A 4GSAA 1AMRA 1SZUA 2BWNA 2C44A 2WK8A 4N0BA 3B1EA 4OMAA 4PVFA 4F4EA 4TV7A 4F5GA 1CL1A 4LNMA 3ELEA 3RUYA 4F5IA 1I43A 2AEUA 4WYEA 1TOJA 4WYDA 2X8UA 1AHEA 5EFSA 1KKPA 1E5FA 3NYUA 3FZ8A 4A0HA 1LC8A 4IYOA 3HMUA 2VMRA 5EUDA 4W1WA 1B5PA 4ZDPA 2X5DA 1IAYA 3A9YA 4GEBA 4RJ0A 3TCMA 4A6RA 2VLFA 2DGLA 3AEJA 3NU8A 5FT6A 4A6UA 5IWQA 3COGA 1Z7DA 4BA5A 2Z9XA 2AY7A 2VMPA 4OYTA 1DJ9A 4F5HA 4UHNA 4JE5A 3AENB 2BIEA 4EB5A 1AKBA 1O69A 4WP0A 1ORDA 3PPLA 3P1TA 4L0OA 2Z9UA 4M2KA 2BHXA 4WLHA 2PB2A 4F5KA 1KMKA 1GEYA 3T32A 3A9XA 1O62A 2AY2A 2VMNA 1C7NA 2BKWA 2W7KA 4JEZA 3RI6A 1CQ6A 4W1XA 3BC8A 2W8UA 1KL2A 3CAIA 3AV7A 1GC0A 1IBJA 4LC3A 4RJYA 2CH2A 2W7LA 2JJHA 2FN6A 3FZ7A 3TFTA 2VGVA 1M7YA 1SZKA 1AJSB 3HVYA 1SF2A 1CJ0A 4DBCA 1TOIA 3CBFA 1M0OA 2VMSA 3PIUA 3EZ1A 3MAUA 4M2MA 1W23A 1MDZA 5E5IA 1ELUA 3G0TA 4W1VA 4W91A 1N8PA 1LW4A 2CTZA 3E2FA 4XAUA 3A9ZA 1OHVA 3ECDA 3MAFB 4Q31A 2CB1A 2D64A 4FFCA 2BI5A 3GZDA 3R4TA 1X29A 2W8WA 3JWAA 4QGRA 5G2PA 4CVQA 3WGCA 3OKSA 1LK9A 2VGSA 1AMAA 4XQ2A 1D7RA 1GC2A 3AENA 1D7UA 4XK1A 1ARIA 3FVXA 1KKJA 4MKKA 2XBNA 4FL0A 3VP6A 1BJWA 2EPJA 1M32A 2VI9A 2Z61A 2FNUA 3BB8A 4ZAHA 1EQBA 1LW5A 2D61A 4F5FA 5BJ4A 2AY9A 3BV0A 3F9TA 3EI7A 1XEYA 3RQ1A 5G09A 1JF9A 3PD6B 2BWOA 4ZASA 1OHWA 3UE8A 3GR9A 4OCAA 1V2FA 4AO4A 4RAEA 4P3MA 4ZDOA 4MY5A 4MGRA 4M2JA 4H51A 1WKGA 3FCRA 3AEMC 3E77A 2HUFA 2BI1A 2JJGA 2W7IA 4K2IA 5FT4A 1TOGA 4WXGA 4AZJA 3BWOA 4JF1A 1MLZA 1T3IA 3FVUA 4R5FA 1G7WA 4UHOA 2VMVA 3HT4A 1PMMA 2BIAA 4JEXA 4PIWA 1EJIA 2ZY4A 1ASDA 4MKJA 1BT4A 4OT8A 2QMAA 2GB3A 4XJPA 2GMSA 3G8MA 4Q76A 4E77A 4ZM4A 5G2QA 1MAQA 2YHKA 3K40A 1TOEA 2VMQA 4BA4A 3EIAA 4O6ZA 3W1IA 3LVMA 1ARSA 2HP1A 1ASGA 3FSLA 2D7YA 3MBBA 4U2HA 4ATPA 2Z9WA 2JJEA 1ASNA 1WKHA 4WYGA 1O4SA 2HP2A 1U08A 1UU2A 1QZ9A 4UOYA 1M0QA 3L8AA 5EAVA 1UU0A 3IF2A 4ADBA 3PDXA 2AY4A 2DKBA 1GC4A 3B8XA 3QHXA 2OKJA 1GC3A 2W7MA 1B4XA 5F8VA 2QB3A 2BI3A 2Q7WA 1AHGA 2EZ1A 2YOBA 4ZLVA 2BI9A 3AEOA 2ZC0A 4ZM3A 2R5CB 3N5MA 4ZWMA 1S06A 1MDOA 1YJSA 3I16A 4EB7A 1WYUB 2CJHA 3NX3A 3EI9A 1W3UA 1CL2A 1TPLA 4W5KA 4F5MA 2HOZA 4PFFA 2W7DA 5EIGB 4OBUA 3A8UX 1CQ7A 8AATA 5EUNA 2R0TA 1ZC9A 3ZRPA 3GJUA 1VJOA 3K7YA 3HDOA 3JTXA 1ASLA 1C4KA 5HXXA 1YNUA 4WD2A 3RBFA 3NTJA 3USFA 1E5EA 5E4ZA 5E3KA 4ADDA 3JW9A 1DKAA 3TFUA 3BCBA 3EZSA 3VOMA 5BJ3A 4GE9A 1XI9A 4E3QA 1DJUA 4LNLA 3MC6A 1KMJA 4OBVA 4AOAA 2JISA 3LWSA 1BQDA 1WYVB 4JEVA 4W8IA 2CSTA 2OGAA 2VYCA 2ZUKA 1DJEA 1ARTA 4UQVA 2FNIA 1AAMA 1JG8A 4MQQA 1ASEA 3EI8A 4IY7A 2GQNA 1G4XA 3NUBA 4K2BA 3OP7A 4U1TA 4ISYA 3JZLA 2WKAA 2WK9A 3H14A 3QGUA 1IX8A 3ZRQA 2BIGA 2HZPA 3D6KA 1MLYA 4KYOA 4R5ZA 3CQ6A 4XJOA 1AIBA 1BKGA 4WXFA 3MKJA 1WYUA 4KXKA 4JF0A 2PO3A 1YJYA 4F5LA 3FRKA 5EIGA 2W7EA 1TOKA 1QIRA 3CQ5A 3FFHA 3FQ8A 4EMYA 2QLRA 3PAAA 1CZEA 4JE5D 2YKYA 3QI6A 4ZDLA 4IXOA 2R2NA 2VMTA 3QM2A 2AY1A 3MADA 3RCHB 4RIZA 4CBRA 1RVYA 3E2ZB 2EGYA 2Z9VA 4F5JA 2CJGA 4B9BA 7AATA 1P3WA 9AATA 4E1OA 1ELQA 2DGMA 4Q6RA 1MAPA 3WCOA 4UHMA 3WGBA 4AO9A 3FQAA 3ZZJA 3GSBA 4PFNA 1MGVA 1ASCA 5G4IA 2YCNA 1LC7A 4K2MA 1AIAA 1WYVA 1Z3ZA 3NDNA 1IJIA 2ZP7A 3NYSA 4WYCA 1ECXA 2YCTA 3NU7A 3AEJC 4R2NA 3L44A 4A0GA 4IXZA 4E3RA 4HVKA 1X2AA 2AY6A 2ZJGA 3NNKA 1N2TA 3BWNA 2YCPA 3LVJA 5D95A 4CXQA 3VAXA 5LHAA 3DODA 3AOWA 2HUIA 1D7VA 2E54A 3DR7A 3DZZA 2W8JA 4Q75A 4AH3A 1AJSA 1G4VA 3E6GA 3KGWA 4ZSWA 4GE4A 3ZRRA 4JEWA 1RV3A 3TQXA 4EFFA 3LG0A 1S07A 2O7CA 4OC9A 4IW7A 3FDBA 3LVKA 4DGTA 4BQ0A 2TPLA 3RCHA 1G7XA 3TATA 2VGZA 2GSAA 2JGTA 5DJ1A 2DR1A 5M46A 4J5UA 4MQPA 1AHYA 3DU4A 2D65A 3E2ZA 3MAFA 1AY5A 4J8LA 4CBSA 2EO5A 2ORDA 5J8QA 4WYAA 2BYJA 3A2BA 2HORA 3BCAA 1YOOA 2JJFA 5TF5A 1J04A 2YKUA 4WB0B 2D66A 1BQAA 3VK2A 2VMWA 3GWPA 2AATA 3FQ7A 4GE7A 2W8VA 1QJ3A 3BCXA 3FZ6A 4N0WA 1W7MA 3PA9A 4XEWA 2OKKA 3M5UA 1BW0A 3VK3A 4IXSA 1GDEA 1ASFA 3W1HA 3R9AA 2O0RA 2VMXA 1B5OA 3FD0A 3PD6A 5F9SA 1I29A 5K8BA 3N0LA 4P7YA 3DYDA 1IX6A 1FG7A 1MDXA 1ZOBA 1DGEA 1AHFA 3GZDC 3LV2A 1AAWA 1OXOA 2OQXA 3ACZA 1YAAA 1IAXA 1DTYA 2O1BA 3UWCA 1YIYA 1GD9A 1I48A 5EQCA 2PB0A 3FDDA 1KL1A 4ADCA 2E7IA 3DR4A 5M4BA 1EG5A 4EU1A 1CQ8A 3JU7A 4RITA 3UAKA 2R5EA 4RKCA 3GZCA 1TASA 4GDYA
chains in the Genus database with same CATH superfamily
3HQTA 1ASAA 1JS3A 3AOVA 2AY3A 3BS8A 3DXVA 1D7SA 1W7NA 1AX4A 2AY8A 1ASMA 1GEXA 1ASBA 1S0AA 2XH1A 3EIBA 3II0A 1UKJA 1QGNA 2EZ2A 5DX5A 3EI6A 1RVUA 3MEBA 1ARGA 1PMOA 2D5YA 1W7LA 3E2YA 3BWNC 3F6TA 1BS0A 4MSOA 4WXBA 1GEWA 1V2EA 1CZCA 4I8AA 4ZSYA 4DQ6A 1CS1A 1KAFA 4WB0A 4XJMA 3GBXA 4BHDA 4KAMA 4R8DA 3GETA 2VIAA 4AZKA 3AEMA 5HHYA 2AY5A 3I5TA 1SZSA 2C81A 2DGKA 3B1DA 1N31A 1JS6A 3HLMA 5KTBA 1LC5A 2HUUA 1SPAA 2R5CA 5DB5A 2NMPA 3K28A 4A6TA 2ZY5A 1AICA 2BI2A 2W7JA 4WBTA 2VGWA 2HOYA 4ITXA 1D2FA 5DJ9A 4CXRA 1M6SA 4BMKA 3ASBA 2OGEA 3WZFA 3QPGA 3WKRA 1B9HA 3IHJA 4Y0HA 1C0NA 2ZY2A 4RKDA 2EH6A 2YKXA 1TARA 1AJRA 3N4SA 3HL2A 3WKSA 2ZYJA 1M0NA 2X5FA 1PFFA 1I41A 1C7OA 1C7GA 3H7FA 3KKIA 4A72A 5AX8A 3WLXA 2V1PA 1V2DA 2VIBA 1J32A 4JEYA 1H0CA 1BJNA 1OXPA 3DXWA 2CY8A 5JAYA 2X3LA 5G0AA 3I4JA 4HF8A 1AHXA 1LKCA 1WYTB 1IUGA 2ZSMA 3LY1A 2CFBA 2F8JA 2W7FA 3AELA 3PDBB 1QITA 2JG2A 4A00A 1AY4A 1OATA 2G6WA 3NUIA 4Y0IA 1BJOB 2CINA 3E9KA 1SFFA 3EI5A 1DFOA 5C6UA 1AY8A 1UU1A 2CANA 3B46A 2VI8A 2YKVA 5M49A 2AEVA 2Z20A 1FC4A 1S09A 2DKJA 2VMYA 3VK4A 3ZZKA 1WSTA 1OHYA 5FT5A 2FQ6A 1TATA 1GCKA 3CQ4A 4WLJA 3FVSA 1O61A 3EUCA 4Y0DA 3LVLB 1S08A 1DGDA 2FM1A 3B1CA 3FFRA 3JWBA 2VMUA 2FYFA 1V72A 4IX8A 2W7HA 3RBLA 2G7JA 1M4NA 3F0HA 3MC6C 1YIZA 2C7TA 1VEFA 5EAAA 4TN4A 3PGYA 3ASAA 4RLGA 3WY7A 1IX7A 3FKDA 1GBNA 3P6KA 2QSRA 2QB2A 4XJLA 2Z1YA 2WK7A 5D5SA 3PJ0A 2V0YA 1IVRA 4A0RA 4GRXA 1RV4A 1ARHA 2BWPA 3DC1A 1BJ4A 4LW2A 2QA3A 2C0RA 2E7JA 2CJDA 4IYOB 2OATA 4OTLA 3ATHA 2YRRA 1PG8A 3G7QA 3AATA 4ADEA 2DOUA 4MQRA 4ATQA 2GMUA 2Z67A 3FTBA 1B8GA 1WYTA 4TMRA 5I92A 3N75A 1AKCA 2D63A 2VGTA 3KGXA 3PDBA 1Y4IA 3DRDA 3AEPA 2CH1A 1VP4A 2VMOA 4NOGA 1QJ5A 2E7UA 2VLHA 1BJOA 5FT8A 1FG3A 2HOXA 1C9CA 2VGUA 1B9IA 3NYTA 2W7GA 1AMQA 1X0MA 2ZSLA 3KE3A 2Z1ZA 1AMSA 4B98A 2QBTA 1H1CA 3HBXA 3QBOA 4RM1A 2VMZA 3W1JA 3WX9A 3ELPA 4LW4A 1AKAA 2YRIA 4ZWVA 1LS3A 4LNJA 2W8TA 5HDMA 4A0FA 1M0PA 3Q8NA 1YJZA 2D7ZA 3NRAA 4WYFA 1QISA 1SVVA 5G4JA 5M4DA 5LH9A 2ZY3A 3QN6A 1ZODA 4ITGA 3WCNA 3BN1A 2RFVA 3ISLA 5EUEA 2BYLA 1X28A 4GSAA 1AMRA 1SZUA 2BWNA 2C44A 2WK8A 4N0BA 3B1EA 4OMAA 4PVFA 4F4EA 4TV7A 4F5GA 1CL1A 4LNMA 3ELEA 3RUYA 4F5IA 1I43A 2KFPA 2AEUA 4WYEA 1TOJA 4WYDA 2X8UA 1AHEA 5EFSA 1KKPA 1E5FA 3NYUA 3FZ8A 4A0HA 1LC8A 4IYOA 3HMUA 2VMRA 5EUDA 4W1WA 1B5PA 4ZDPA 2X5DA 1IAYA 3A9YA 4GEBA 4RJ0A 3TCMA 4A6RA 2VLFA 2DGLA 3AEJA 3NU8A 5FT6A 4A6UA 5IWQA 3COGA 1Z7DA 4BA5A 2Z9XA 2AY7A 2VMPA 4OYTA 1DJ9A 4F5HA 4UHNA 4JE5A 3AENB 2BIEA 4EB5A 1AKBA 1O69A 4WP0A 1ORDA 3PPLA 3P1TA 4L0OA 2Z9UA 4M2KA 2BHXA 4WLHA 2PB2A 4F5KA 1KMKA 1GEYA 3T32A 3A9XA 1O62A 2AY2A 2VMNA 1C7NA 2BKWA 2W7KA 4JEZA 3RI6A 1CQ6A 4W1XA 3BC8A 2W8UA 1KL2A 2WB6A 3CAIA 3AV7A 1GC0A 1IBJA 4LC3A 4RJYA 2CH2A 2W7LA 2JJHA 2FN6A 3FZ7A 3TFTA 2VGVA 1M7YA 1SZKA 1AJSB 3HVYA 1SF2A 1CJ0A 4DBCA 1TOIA 3CBFA 1M0OA 2VMSA 3PIUA 3EZ1A 3MAUA 4M2MA 1W23A 1MDZA 5E5IA 1ELUA 3G0TA 4W1VA 4W91A 1N8PA 1LW4A 2CTZA 3E2FA 4XAUA 3A9ZA 1OHVA 3ECDA 3MAFB 4Q31A 2CB1A 2D64A 4FFCA 2BI5A 3GZDA 3R4TA 1X29A 2W8WA 3JWAA 4QGRA 5G2PA 4CVQA 3WGCA 3OKSA 1LK9A 2VGSA 1AMAA 4XQ2A 1D7RA 1GC2A 3AENA 1D7UA 4XK1A 1ARIA 3FVXA 1KKJA 4MKKA 2XBNA 4FL0A 3VP6A 1BJWA 2EPJA 1M32A 2VI9A 2Z61A 2FNUA 3BB8A 4ZAHA 1EQBA 1LW5A 2D61A 4F5FA 5BJ4A 2AY9A 3BV0A 3F9TA 3EI7A 1XEYA 3RQ1A 5G09A 1JF9A 3PD6B 3H9XA 2BWOA 4ZASA 1OHWA 3UE8A 3GR9A 4OCAA 1V2FA 4AO4A 4RAEA 4P3MA 4ZDOA 4MY5A 4MGRA 4M2JA 4H51A 1WKGA 3FCRA 3AEMC 3E77A 2HUFA 2BI1A 2JJGA 2W7IA 4K2IA 5FT4A 1TOGA 4WXGA 4AZJA 3BWOA 4JF1A 1MLZA 1T3IA 3FVUA 4R5FA 1G7WA 4UHOA 2VMVA 3HT4A 1PMMA 2BIAA 4JEXA 4PIWA 1EJIA 2ZY4A 1ASDA 4MKJA 1BT4A 4OT8A 2QMAA 2GB3A 4XJPA 2GMSA 3G8MA 4Q76A 4E77A 4ZM4A 5G2QA 1MAQA 2YHKA 3K40A 1TOEA 2VMQA 4BA4A 3EIAA 4O6ZA 3W1IA 3LVMA 1ARSA 2HP1A 1ASGA 3FSLA 2D7YA 3MBBA 4U2HA 4ATPA 2Z9WA 2JJEA 1ASNA 1WKHA 4WYGA 1O4SA 2HP2A 1U08A 1UU2A 1QZ9A 4UOYA 1M0QA 3L8AA 5EAVA 1UU0A 3IF2A 4ADBA 3PDXA 2AY4A 2DKBA 1GC4A 3B8XA 3QHXA 2OKJA 1GC3A 2W7MA 1B4XA 5F8VA 2QB3A 2BI3A 2Q7WA 1AHGA 2EZ1A 2YOBA 4ZLVA 2BI9A 3AEOA 2ZC0A 4ZM3A 2R5CB 3N5MA 4ZWMA 1S06A 1MDOA 1YJSA 3I16A 4EB7A 1WYUB 2CJHA 3NX3A 3EI9A 1W3UA 1CL2A 1TPLA 4W5KA 4F5MA 2HOZA 4PFFA 2W7DA 5EIGB 4OBUA 3A8UX 1CQ7A 8AATA 5EUNA 2R0TA 1ZC9A 3ZRPA 3GJUA 3N4XA 1VJOA 3K7YA 3HDOA 3JTXA 1ASLA 1C4KA 5HXXA 1YNUA 4WD2A 3RBFA 3NTJA 3USFA 1E5EA 5E4ZA 5E3KA 4ADDA 3JW9A 1DKAA 3TFUA 3BCBA 3EZSA 3VOMA 5BJ3A 4GE9A 1XI9A 4E3QA 1DJUA 4LNLA 3MC6A 4K05A 1KMJA 4OBVA 4AOAA 2JISA 2EYQA 3LWSA 1BQDA 1WYVB 4JEVA 4W8IA 2CSTA 2OGAA 2VYCA 2ZUKA 3N4RA 1DJEA 1ARTA 4UQVA 2FNIA 1AAMA 1JG8A 4MQQA 1ASEA 3EI8A 4IY7A 2GQNA 1G4XA 3NUBA 4K2BA 3OP7A 4U1TA 4ISYA 3JZLA 2WKAA 2WK9A 3H14A 3QGUA 1IX8A 3ZRQA 2BIGA 2HZPA 3D6KA 1MLYA 4KYOA 4R5ZA 3CQ6A 4XJOA 2FKIA 1AIBA 1BKGA 4WXFA 3MKJA 1WYUA 4KXKA 4JF0A 2PO3A 1YJYA 4F5LA 3FRKA 5EIGA 2W7EA 1TOKA 1QIRA 3CQ5A 3FFHA 3FQ8A 4EMYA 2QLRA 3PAAA 1CZEA 4JE5D 2YKYA 3QI6A 4ZDLA 4IXOA 2R2NA 2VMTA 3QM2A 2AY1A 3MADA 3RCHB 4RIZA 4CBRA 1RVYA 3E2ZB 2EGYA 2Z9VA 4F5JA 2CJGA 3N7NA 4B9BA 7AATA 1P3WA 9AATA 4E1OA 1ELQA 2DGMA 4Q6RA 1MAPA 3WCOA 4UHMA 3WGBA 4AO9A 3FQAA 3ZZJA 3GSBA 4PFNA 1MGVA 1ASCA 5G4IA 2YCNA 1LC7A 4K2MA 1AIAA 1WYVA 1Z3ZA 3NDNA 1IJIA 2ZP7A 3NYSA 4H63Q 4WYCA 1ECXA 2YCTA 3NU7A 3AEJC 4R2NA 3L44A 4A0GA 4IXZA 4E3RA 4HVKA 1X2AA 2AY6A 2ZJGA 3NNKA 1N2TA 3BWNA 2YCPA 3LVJA 5D95A 4CXQA 3VAXA 5LHAA 3DODA 3AOWA 2HUIA 1D7VA 2E54A 3DR7A 3DZZA 2W8JA 4Q75A 4AH3A 1AJSA 1G4VA 3E6GA 3KGWA 4ZSWA 4GE4A 3ZRRA 4JEWA 1RV3A 3TQXA 4EFFA 3LG0A 1S07A 2O7CA 4OC9A 4IW7A 3FDBA 3LVKA 4DGTA 4BQ0A 2TPLA 3RCHA 1G7XA 3TATA 2VGZA 2GSAA 2JGTA 5DJ1A 2DR1A 5M46A 4J5UA 4MQPA 1AHYA 3DU4A 2D65A 3E2ZA 3MAFA 1AY5A 4J8LA 4CBSA 2EO5A 2ORDA 5J8QA 4WYAA 2BYJA 3A2BA 2HORA 3BCAA 1YOOA 2JJFA 5TF5A 1J04A 2YKUA 4WB0B 2D66A 1BQAA 3VK2A 2VMWA 3GWPA 2AATA 3FQ7A 4GE7A 2W8VA 1QJ3A 3BCXA 3FZ6A 4N0WA 1W7MA 3PA9A 4XEWA 2OKKA 3M5UA 1BW0A 3VK3A 4IXSA 1GDEA 1ASFA 3W1HA 3R9AA 2O0RA 2VMXA 1B5OA 3FD0A 3PD6A 5F9SA 1I29A 5K8BA 3N0LA 4P7YA 3DYDA 1IX6A 2A1VA 1FG7A 1MDXA 1ZOBA 1DGEA 1AHFA 3GZDC 3LV2A 1AAWA 1OXOA 2OQXA 3ACZA 1YAAA 1IAXA 1DTYA 2O1BA 3UWCA 1YIYA 1GD9A 1I48A 5EQCA 2PB0A 3FDDA 1KL1A 4ADCA 2E7IA 3DR4A 5M4BA 1EG5A 4EU1A 1CQ8A 3JU7A 4RITA 3UAKA 2R5EA 4RKCA 3GZCA 1TASA 4GDYA
chains in the Genus database with same CATH topology
3HQTA 1ASAA 1JS3A 3AOVA 2AY3A 3BS8A 3DXVA 1D7SA 1W7NA 1AX4A 2AY8A 1ASMA 1GEXA 1ASBA 1S0AA 2XH1A 3EIBA 3II0A 1UKJA 1QGNA 2EZ2A 5DX5A 3EI6A 1RVUA 3MEBA 1ARGA 1PMOA 2D5YA 1W7LA 3E2YA 3BWNC 3F6TA 1BS0A 4MSOA 4WXBA 1GEWA 1V2EA 1CZCA 4I8AA 4ZSYA 4DQ6A 1CS1A 4WB0A 4XJMA 3GBXA 4BHDA 4KAMA 4R8DA 3GETA 2VIAA 4AZKA 3AEMA 5HHYA 2AY5A 3I5TA 1SZSA 2C81A 2DGKA 3B1DA 1N31A 1JS6A 3HLMA 5KTBA 1LC5A 2HUUA 1SPAA 2R5CA 5DB5A 2NMPA 3K28A 4A6TA 2ZY5A 1AICA 2BI2A 2W7JA 4WBTA 2VGWA 2HOYA 4ITXA 1D2FA 5DJ9A 4CXRA 1M6SA 4BMKA 3ASBA 2OGEA 3WZFA 3QPGA 3WKRA 1B9HA 3IHJA 4Y0HA 1C0NA 2ZY2A 4RKDA 2EH6A 2YKXA 1TARA 1AJRA 3N4SA 3HL2A 3WKSA 2ZYJA 1M0NA 2X5FA 1PFFA 1I41A 1C7OA 1C7GA 3H7FA 3KKIA 4A72A 5AX8A 3WLXA 2V1PA 1V2DA 2VIBA 1J32A 4JEYA 1H0CA 1BJNA 1OXPA 3DXWA 2CY8A 5JAYA 2X3LA 5G0AA 3I4JA 4HF8A 1AHXA 1LKCA 1WYTB 1IUGA 2ZSMA 3LY1A 2CFBA 2F8JA 2W7FA 3AELA 3PDBB 1QITA 2JG2A 4A00A 1AY4A 1OATA 2G6WA 3NUIA 4Y0IA 1BJOB 2CINA 3E9KA 1SFFA 3EI5A 1DFOA 5C6UA 1AY8A 1UU1A 2CANA 3B46A 2VI8A 2YKVA 5M49A 2AEVA 2Z20A 1FC4A 1S09A 2DKJA 2VMYA 3VK4A 3ZZKA 1WSTA 1OHYA 5FT5A 2FQ6A 1TATA 1GCKA 3CQ4A 4WLJA 3FVSA 1O61A 3EUCA 4Y0DA 3LVLB 1S08A 1DGDA 2FM1A 3B1CA 3FFRA 3JWBA 2VMUA 2FYFA 1V72A 4IX8A 2W7HA 3RBLA 2G7JA 1M4NA 3F0HA 3MC6C 1YIZA 2C7TA 1VEFA 5EAAA 4TN4A 3PGYA 3ASAA 4RLGA 3WY7A 1IX7A 3FKDA 1GBNA 3P6KA 2QSRA 2QB2A 4XJLA 2Z1YA 2WK7A 5D5SA 3PJ0A 2V0YA 1IVRA 4A0RA 4GRXA 1RV4A 1ARHA 2BWPA 3DC1A 1BJ4A 4LW2A 2QA3A 2C0RA 2E7JA 2CJDA 4IYOB 2OATA 4OTLA 3ATHA 2YRRA 1PG8A 3G7QA 3AATA 4ADEA 2DOUA 4MQRA 4ATQA 2GMUA 2Z67A 3FTBA 1B8GA 1WYTA 4TMRA 5I92A 3N75A 1AKCA 2D63A 2VGTA 3KGXA 3PDBA 1Y4IA 3DRDA 3AEPA 2CH1A 1VP4A 2VMOA 4NOGA 1QJ5A 2E7UA 2VLHA 1BJOA 5FT8A 1FG3A 2HOXA 1C9CA 2VGUA 1B9IA 3NYTA 2W7GA 1AMQA 1X0MA 2ZSLA 3KE3A 2Z1ZA 1AMSA 4B98A 2QBTA 1H1CA 3HBXA 3QBOA 4RM1A 2VMZA 3W1JA 3WX9A 3ELPA 4LW4A 1AKAA 2YRIA 4ZWVA 1LS3A 4LNJA 2W8TA 5HDMA 4A0FA 1M0PA 3Q8NA 1YJZA 2D7ZA 3NRAA 4WYFA 1QISA 1SVVA 5G4JA 5M4DA 5LH9A 2ZY3A 3QN6A 1ZODA 4ITGA 3WCNA 3BN1A 2RFVA 3ISLA 5EUEA 2BYLA 1X28A 4GSAA 1AMRA 1SZUA 2BWNA 2C44A 2WK8A 4N0BA 3B1EA 4OMAA 4PVFA 4F4EA 4TV7A 4F5GA 1CL1A 4LNMA 3ELEA 3RUYA 4F5IA 1I43A 2KFPA 2AEUA 4WYEA 1TOJA 4WYDA 2X8UA 1AHEA 5EFSA 1KKPA 1E5FA 3NYUA 3FZ8A 4A0HA 1LC8A 4IYOA 3HMUA 2VMRA 5EUDA 4W1WA 1B5PA 4ZDPA 2X5DA 1IAYA 3A9YA 4GEBA 4RJ0A 3TCMA 4A6RA 2VLFA 2DGLA 3AEJA 3NU8A 5FT6A 4A6UA 5IWQA 3COGA 1Z7DA 4BA5A 2Z9XA 2AY7A 2VMPA 4OYTA 1DJ9A 4F5HA 4UHNA 4JE5A 3AENB 2BIEA 4EB5A 1AKBA 1O69A 4WP0A 1ORDA 3PPLA 3P1TA 4L0OA 2Z9UA 4M2KA 2BHXA 4WLHA 2PB2A 4F5KA 1KMKA 1GEYA 3T32A 3A9XA 1O62A 2AY2A 2VMNA 1C7NA 2BKWA 2W7KA 4JEZA 3RI6A 1CQ6A 4W1XA 3BC8A 2W8UA 1KL2A 2WB6A 3CAIA 3AV7A 1GC0A 1IBJA 4LC3A 4RJYA 2CH2A 2W7LA 2JJHA 2FN6A 3FZ7A 3TFTA 2VGVA 1M7YA 1SZKA 1AJSB 3HVYA 1SF2A 1CJ0A 4DBCA 1TOIA 3CBFA 1M0OA 2VMSA 3PIUA 3EZ1A 3MAUA 4M2MA 1W23A 1MDZA 5E5IA 1ELUA 3G0TA 4W1VA 4W91A 1N8PA 1LW4A 2CTZA 3E2FA 4XAUA 3A9ZA 1OHVA 3ECDA 3MAFB 4Q31A 2CB1A 2D64A 4FFCA 2BI5A 3GZDA 3R4TA 1X29A 2W8WA 3JWAA 4QGRA 5G2PA 4CVQA 3WGCA 3OKSA 1LK9A 2VGSA 1AMAA 4XQ2A 1D7RA 1GC2A 3AENA 1D7UA 4XK1A 1ARIA 3FVXA 1KKJA 4MKKA 2XBNA 4FL0A 3VP6A 1BJWA 2EPJA 1M32A 2VI9A 2Z61A 2FNUA 3BB8A 4ZAHA 1EQBA 1LW5A 2D61A 4F5FA 5BJ4A 2AY9A 3BV0A 3F9TA 3EI7A 1XEYA 3RQ1A 5G09A 1JF9A 3PD6B 3H9XA 2BWOA 4ZASA 1OHWA 3UE8A 3GR9A 4OCAA 1V2FA 4AO4A 4RAEA 4P3MA 4ZDOA 4MY5A 4MGRA 4M2JA 4H51A 1WKGA 3FCRA 3AEMC 3E77A 2HUFA 2BI1A 2JJGA 2W7IA 4K2IA 5FT4A 1TOGA 4WXGA 4AZJA 3BWOA 4JF1A 1MLZA 1T3IA 3FVUA 4R5FA 1G7WA 4UHOA 2VMVA 3HT4A 1PMMA 2BIAA 4JEXA 4PIWA 1EJIA 2ZY4A 1ASDA 4MKJA 1BT4A 4OT8A 2QMAA 2GB3A 4XJPA 2GMSA 3G8MA 4Q76A 4E77A 4ZM4A 5G2QA 1MAQA 2YHKA 3K40A 1TOEA 2VMQA 4BA4A 3EIAA 4O6ZA 3W1IA 3LVMA 1ARSA 2HP1A 1ASGA 3FSLA 2D7YA 3MBBA 4U2HA 4ATPA 2Z9WA 2JJEA 1ASNA 1WKHA 4WYGA 1O4SA 2HP2A 1U08A 1UU2A 1QZ9A 4UOYA 1M0QA 3L8AA 5EAVA 1UU0A 3IF2A 4ADBA 3PDXA 2AY4A 2DKBA 1GC4A 3B8XA 3QHXA 2OKJA 1GC3A 2W7MA 1B4XA 5F8VA 2QB3A 2BI3A 2Q7WA 1AHGA 2EZ1A 2YOBA 4ZLVA 2BI9A 3AEOA 2ZC0A 4ZM3A 2R5CB 3N5MA 4ZWMA 1S06A 1MDOA 1YJSA 3I16A 4EB7A 1WYUB 2CJHA 3NX3A 3EI9A 1W3UA 1CL2A 1TPLA 4W5KA 4F5MA 2HOZA 4PFFA 2W7DA 5EIGB 4OBUA 3A8UX 1CQ7A 8AATA 5EUNA 2R0TA 1ZC9A 3ZRPA 3GJUA 3N4XA 1VJOA 3K7YA 3HDOA 3JTXA 1ASLA 1C4KA 5HXXA 1YNUA 4WD2A 3RBFA 3NTJA 3USFA 1E5EA 5E4ZA 5E3KA 4ADDA 3JW9A 1DKAA 3TFUA 3BCBA 3EZSA 3VOMA 5BJ3A 4GE9A 1XI9A 4E3QA 1DJUA 4LNLA 3MC6A 4K05A 1KMJA 4OBVA 4AOAA 2JISA 2EYQA 3LWSA 1BQDA 1WYVB 4JEVA 4W8IA 2CSTA 2OGAA 2VYCA 2ZUKA 3N4RA 1DJEA 1ARTA 4UQVA 2FNIA 1AAMA 1JG8A 4MQQA 1ASEA 3EI8A 4IY7A 2GQNA 1G4XA 3NUBA 4K2BA 3OP7A 4U1TA 4ISYA 3JZLA 2WKAA 2WK9A 3H14A 3QGUA 1IX8A 3ZRQA 2BIGA 2HZPA 3D6KA 1MLYA 4KYOA 4R5ZA 3CQ6A 4XJOA 2FKIA 1AIBA 1BKGA 4WXFA 3MKJA 1WYUA 4KXKA 4JF0A 2PO3A 1YJYA 4F5LA 3FRKA 5EIGA 2W7EA 1TOKA 1QIRA 3CQ5A 3FFHA 3FQ8A 4EMYA 2QLRA 3PAAA 1CZEA 4JE5D 2YKYA 3QI6A 4ZDLA 4IXOA 2R2NA 2VMTA 3QM2A 2AY1A 3MADA 3RCHB 4RIZA 4CBRA 1RVYA 3E2ZB 2EGYA 2Z9VA 4F5JA 2CJGA 3N7NA 4B9BA 7AATA 1P3WA 9AATA 4E1OA 1ELQA 2DGMA 4Q6RA 1MAPA 3WCOA 4UHMA 3WGBA 4AO9A 3FQAA 3ZZJA 3GSBA 4PFNA 1MGVA 1ASCA 5G4IA 2YCNA 1LC7A 4K2MA 1AIAA 1WYVA 1Z3ZA 3NDNA 1IJIA 2ZP7A 3NYSA 4H63Q 4WYCA 1ECXA 2YCTA 3NU7A 3AEJC 4R2NA 3L44A 4A0GA 4IXZA 4E3RA 4HVKA 1X2AA 2AY6A 2ZJGA 3NNKA 1N2TA 3BWNA 2YCPA 3LVJA 5D95A 4CXQA 3VAXA 5LHAA 3DODA 3AOWA 2HUIA 1D7VA 2E54A 3DR7A 3DZZA 2W8JA 4Q75A 4AH3A 1AJSA 1G4VA 3E6GA 3KGWA 4ZSWA 4GE4A 3ZRRA 4JEWA 1RV3A 3TQXA 4EFFA 3LG0A 1S07A 2O7CA 4OC9A 4IW7A 3FDBA 3LVKA 4DGTA 4BQ0A 2TPLA 3RCHA 1G7XA 3TATA 2VGZA 2GSAA 2JGTA 5DJ1A 2DR1A 5M46A 4J5UA 4MQPA 1AHYA 3DU4A 2D65A 3E2ZA 3MAFA 1AY5A 4J8LA 4CBSA 2EO5A 2ORDA 5J8QA 4WYAA 2BYJA 3A2BA 2HORA 3BCAA 1YOOA 2JJFA 5TF5A 1J04A 2YKUA 4WB0B 2D66A 1BQAA 3VK2A 2VMWA 3GWPA 2AATA 3FQ7A 4GE7A 2W8VA 1QJ3A 3BCXA 3FZ6A 4N0WA 1W7MA 3PA9A 4XEWA 2OKKA 3M5UA 1BW0A 3VK3A 4IXSA 1GDEA 1ASFA 3W1HA 3R9AA 2O0RA 2VMXA 1B5OA 3FD0A 3PD6A 5F9SA 1I29A 5K8BA 3N0LA 4P7YA 3DYDA 1IX6A 2A1VA 1FG7A 1MDXA 1ZOBA 1DGEA 1AHFA 3GZDC 3LV2A 1AAWA 1OXOA 2OQXA 3ACZA 1YAAA 1IAXA 1DTYA 2O1BA 3UWCA 1YIYA 1GD9A 1I48A 5EQCA 2PB0A 3FDDA 1KL1A 4ADCA 2E7IA 3DR4A 5M4BA 1EG5A 4EU1A 1CQ8A 3JU7A 4RITA 3UAKA 2R5EA 4RKCA 3GZCA 1TASA 4GDYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HQT A;  1ASA A;  1JS3 A;  3AOV A;  2AY3 A;  3BS8 A;  3DXV A;  1D7S A;  1W7N A;  1AX4 A;  2AY8 A;  1ASM A;  1GEX A;  1ASB A;  1S0A A;  2XH1 A;  3EIB A;  3II0 A;  1UKJ A;  1QGN A;  2EZ2 A;  5DX5 A;  3EI6 A;  1RVU A;  3MEB A;  1ARG A;  1PMO A;  2D5Y A;  1W7L A;  3E2Y A;  3BWN C;  3F6T A;  1BS0 A;  4MSO A;  4WXB A;  1GEW A;  1V2E A;  1CZC A;  4I8A A;  4ZSY A;  4DQ6 A;  1CS1 A;  4WB0 A;  4XJM A;  3GBX A;  4BHD A;  4KAM A;  4R8D A;  3GET A;  2VIA A;  4AZK A;  3AEM A;  5HHY A;  2AY5 A;  3I5T A;  1SZS A;  2C81 A;  2DGK A;  3B1D A;  1N31 A;  1JS6 A;  3HLM A;  1LC5 A;  2HUU A;  1SPA A;  2R5C A;  5DB5 A;  2NMP A;  3K28 A;  4A6T A;  2ZY5 A;  1AIC A;  2BI2 A;  2W7J A;  4WBT A;  2VGW A;  2HOY A;  4ITX A;  1D2F A;  5DJ9 A;  4CXR A;  1M6S A;  4BMK A;  3ASB A;  2OGE A;  3WZF A;  3QPG A;  3WKR A;  1B9H A;  3IHJ A;  4Y0H A;  1C0N A;  2ZY2 A;  4RKD A;  2EH6 A;  2YKX A;  1TAR A;  1AJR A;  3HL2 A;  3WKS A;  2ZYJ A;  1M0N A;  2X5F A;  1PFF A;  1I41 A;  1C7O A;  1C7G A;  3H7F A;  3KKI A;  4A72 A;  5AX8 A;  3WLX A;  2V1P A;  1V2D A;  2VIB A;  1J32 A;  4JEY A;  1H0C A;  1BJN A;  1OXP A;  3DXW A;  2CY8 A;  5JAY A;  2X3L A;  5G0A A;  3I4J A;  4HF8 A;  1AHX A;  1LKC A;  1WYT B;  1IUG A;  2ZSM A;  3LY1 A;  2CFB A;  2F8J A;  2W7F A;  3AEL A;  3PDB B;  1QIT A;  2JG2 A;  4A00 A;  1AY4 A;  1OAT A;  2G6W A;  3NUI A;  4Y0I A;  1BJO B;  2CIN A;  3E9K A;  1SFF A;  3EI5 A;  1DFO A;  5C6U A;  1AY8 A;  1UU1 A;  2CAN A;  3B46 A;  2VI8 A;  2YKV A;  5M49 A;  2AEV A;  2Z20 A;  1FC4 A;  1S09 A;  2DKJ A;  2VMY A;  3VK4 A;  3ZZK A;  1WST A;  1OHY A;  5FT5 A;  2FQ6 A;  1TAT A;  1GCK A;  3CQ4 A;  4WLJ A;  3FVS A;  1O61 A;  3EUC A;  4Y0D A;  3LVL B;  1S08 A;  1DGD A;  2FM1 A;  3B1C A;  3FFR A;  3JWB A;  2VMU A;  2FYF A;  1V72 A;  4IX8 A;  2W7H A;  3RBL A;  1M4N A;  3F0H A;  3MC6 C;  1YIZ A;  2C7T A;  1VEF A;  5EAA A;  4TN4 A;  3PGY A;  3ASA A;  4RLG A;  3WY7 A;  1IX7 A;  3FKD A;  1GBN A;  3P6K A;  2QB2 A;  4XJL A;  2Z1Y A;  2WK7 A;  5D5S A;  3PJ0 A;  2V0Y A;  1IVR A;  4A0R A;  4GRX A;  1RV4 A;  1ARH A;  2BWP A;  3DC1 A;  1BJ4 A;  4LW2 A;  2QA3 A;  2C0R A;  2E7J A;  2CJD A;  4IYO B;  2OAT A;  4OTL A;  3ATH A;  2YRR A;  1PG8 A;  3G7Q A;  3AAT A;  4ADE A;  2DOU A;  4MQR A;  4ATQ A;  2GMU A;  2Z67 A;  3FTB A;  1B8G A;  1WYT A;  4TMR A;  5I92 A;  3N75 A;  1AKC A;  2D63 A;  2VGT A;  3KGX A;  3PDB A;  1Y4I A;  3DRD A;  3AEP A;  2CH1 A;  1VP4 A;  2VMO A;  4NOG A;  1QJ5 A;  2E7U A;  2VLH A;  1BJO A;  5FT8 A;  1FG3 A;  2HOX A;  1C9C A;  2VGU A;  1B9I A;  3NYT A;  2W7G A;  1AMQ A;  1X0M A;  2ZSL A;  3KE3 A;  2Z1Z A;  1AMS A;  4B98 A;  2QBT A;  1H1C A;  3HBX A;  3QBO A;  4RM1 A;  2VMZ A;  3W1J A;  3WX9 A;  3ELP A;  4LW4 A;  1AKA A;  2YRI A;  4ZWV A;  1LS3 A;  4LNJ A;  2W8T A;  5HDM A;  4A0F A;  1M0P A;  3Q8N A;  1YJZ A;  2D7Z A;  3NRA A;  4WYF A;  1QIS A;  1SVV A;  5G4J A;  5M4D A;  5LH9 A;  2ZY3 A;  3QN6 A;  1ZOD A;  4ITG A;  3WCN A;  3BN1 A;  2RFV A;  3ISL A;  5EUE A;  2BYL A;  1X28 A;  4GSA A;  1AMR A;  1SZU A;  2BWN A;  2C44 A;  2WK8 A;  4N0B A;  3B1E A;  4OMA A;  4PVF A;  4F4E A;  4TV7 A;  4F5G A;  1CL1 A;  4LNM A;  3ELE A;  3RUY A;  4F5I A;  1I43 A;  2AEU A;  4WYE A;  1TOJ A;  4WYD A;  2X8U A;  1AHE A;  5EFS A;  1KKP A;  1E5F A;  3NYU A;  3FZ8 A;  4A0H A;  1LC8 A;  4IYO A;  3HMU A;  2VMR A;  5EUD A;  4W1W A;  1B5P A;  4ZDP A;  2X5D A;  1IAY A;  3A9Y A;  4GEB A;  4RJ0 A;  3TCM A;  4A6R A;  2VLF A;  2DGL A;  3AEJ A;  3NU8 A;  5FT6 A;  4A6U A;  5IWQ A;  3COG A;  1Z7D A;  4BA5 A;  2Z9X A;  2AY7 A;  2VMP A;  4OYT A;  1DJ9 A;  4F5H A;  4UHN A;  4JE5 A;  3AEN B;  2BIE A;  4EB5 A;  1AKB A;  1O69 A;  4WP0 A;  1ORD A;  3PPL A;  3P1T A;  4L0O A;  2Z9U A;  4M2K A;  2BHX A;  4WLH A;  2PB2 A;  4F5K A;  1KMK A;  1GEY A;  3T32 A;  3A9X A;  1O62 A;  2AY2 A;  2VMN A;  1C7N A;  2BKW A;  2W7K A;  4JEZ A;  3RI6 A;  1CQ6 A;  4W1X A;  3BC8 A;  2W8U A;  1KL2 A;  3CAI A;  3AV7 A;  1GC0 A;  1IBJ A;  4LC3 A;  4RJY A;  2CH2 A;  2W7L A;  2JJH A;  2FN6 A;  3FZ7 A;  3TFT A;  2VGV A;  1M7Y A;  1SZK A;  1AJS B;  3HVY A;  1SF2 A;  1CJ0 A;  4DBC A;  1TOI A;  3CBF A;  1M0O A;  2VMS A;  3PIU A;  3EZ1 A;  3MAU A;  4M2M A;  1W23 A;  1MDZ A;  5E5I A;  1ELU A;  3G0T A;  4W1V A;  4W91 A;  1N8P A;  1LW4 A;  2CTZ A;  3E2F A;  4XAU A;  3A9Z A;  1OHV A;  3ECD A;  3MAF B;  4Q31 A;  2CB1 A;  2D64 A;  4FFC A;  2BI5 A;  3GZD A;  3R4T A;  1X29 A;  2W8W A;  3JWA A;  4QGR A;  5G2P A;  4CVQ A;  3WGC A;  3OKS A;  1LK9 A;  2VGS A;  1AMA A;  4XQ2 A;  1D7R A;  1GC2 A;  3AEN A;  1D7U A;  4XK1 A;  1ARI A;  3FVX A;  1KKJ A;  4MKK A;  2XBN A;  4FL0 A;  3VP6 A;  1BJW A;  2EPJ A;  1M32 A;  2VI9 A;  2Z61 A;  2FNU A;  3BB8 A;  4ZAH A;  1EQB A;  1LW5 A;  2D61 A;  4F5F A;  5BJ4 A;  2AY9 A;  3BV0 A;  3F9T A;  3EI7 A;  1XEY A;  3RQ1 A;  5G09 A;  1JF9 A;  3PD6 B;  2BWO A;  4ZAS A;  1OHW A;  3UE8 A;  3GR9 A;  4OCA A;  1V2F A;  4AO4 A;  4RAE A;  4P3M A;  4ZDO A;  4MY5 A;  4MGR A;  4M2J A;  4H51 A;  1WKG A;  3FCR A;  3AEM C;  3E77 A;  2HUF A;  2BI1 A;  2JJG A;  2W7I A;  4K2I A;  5FT4 A;  1TOG A;  4WXG A;  4AZJ A;  3BWO A;  4JF1 A;  1MLZ A;  1T3I A;  3FVU A;  4R5F A;  1G7W A;  4UHO A;  2VMV A;  3HT4 A;  1PMM A;  2BIA A;  4JEX A;  4PIW A;  1EJI A;  2ZY4 A;  1ASD A;  4MKJ A;  1BT4 A;  4OT8 A;  2QMA A;  2GB3 A;  4XJP A;  2GMS A;  3G8M A;  4Q76 A;  4E77 A;  4ZM4 A;  5G2Q A;  1MAQ A;  2YHK A;  3K40 A;  1TOE A;  2VMQ A;  4BA4 A;  3EIA A;  4O6Z A;  3W1I A;  3LVM A;  1ARS A;  2HP1 A;  1ASG A;  3FSL A;  2D7Y A;  3MBB A;  4U2H A;  4ATP A;  2Z9W A;  2JJE A;  1ASN A;  1WKH A;  4WYG A;  1O4S A;  2HP2 A;  1U08 A;  1UU2 A;  1QZ9 A;  4UOY A;  1M0Q A;  3L8A A;  5EAV A;  1UU0 A;  3IF2 A;  4ADB A;  3PDX A;  2AY4 A;  2DKB A;  1GC4 A;  3B8X A;  3QHX A;  2OKJ A;  1GC3 A;  2W7M A;  1B4X A;  5F8V A;  2QB3 A;  2BI3 A;  2Q7W A;  1AHG A;  2EZ1 A;  2YOB A;  4ZLV A;  2BI9 A;  3AEO A;  2ZC0 A;  4ZM3 A;  2R5C B;  3N5M A;  4ZWM A;  1S06 A;  1MDO A;  1YJS A;  3I16 A;  4EB7 A;  1WYU B;  2CJH A;  3NX3 A;  3EI9 A;  1W3U A;  1CL2 A;  1TPL A;  4W5K A;  4F5M A;  2HOZ A;  4PFF A;  2W7D A;  5EIG B;  4OBU A;  3A8U X;  1CQ7 A;  8AAT A;  5EUN A;  2R0T A;  1ZC9 A;  3ZRP A;  3GJU A;  1VJO A;  3K7Y A;  3HDO A;  3JTX A;  1ASL A;  1C4K A;  5HXX A;  1YNU A;  4WD2 A;  3RBF A;  3NTJ A;  3USF A;  1E5E A;  5E4Z A;  5E3K A;  4ADD A;  3JW9 A;  1DKA A;  3TFU A;  3BCB A;  3EZS A;  3VOM A;  5BJ3 A;  4GE9 A;  1XI9 A;  4E3Q A;  1DJU A;  4LNL A;  3MC6 A;  1KMJ A;  4OBV A;  4AOA A;  2JIS A;  3LWS A;  1BQD A;  1WYV B;  4JEV A;  4W8I A;  2CST A;  2OGA A;  2VYC A;  2ZUK A;  1DJE A;  1ART A;  4UQV A;  2FNI A;  1AAM A;  1JG8 A;  4MQQ A;  1ASE A;  3EI8 A;  4IY7 A;  2GQN A;  1G4X A;  3NUB A;  4K2B A;  3OP7 A;  4U1T A;  4ISY A;  3JZL A;  2WKA A;  2WK9 A;  3H14 A;  3QGU A;  1IX8 A;  3ZRQ A;  2BIG A;  2HZP A;  3D6K A;  1MLY A;  4KYO A;  4R5Z A;  3CQ6 A;  4XJO A;  1AIB A;  1BKG A;  4WXF A;  3MKJ A;  1WYU A;  4KXK A;  4JF0 A;  2PO3 A;  1YJY A;  4F5L A;  3FRK A;  5EIG A;  2W7E A;  1TOK A;  1QIR A;  3CQ5 A;  3FFH A;  3FQ8 A;  4EMY A;  2QLR A;  3PAA A;  1CZE A;  4JE5 D;  2YKY A;  3QI6 A;  4ZDL A;  4IXO A;  2R2N A;  2VMT A;  3QM2 A;  2AY1 A;  3MAD A;  3RCH B;  4RIZ A;  4CBR A;  1RVY A;  3E2Z B;  2EGY A;  2Z9V A;  4F5J A;  2CJG A;  4B9B A;  7AAT A;  1P3W A;  9AAT A;  4E1O A;  1ELQ A;  2DGM A;  4Q6R A;  1MAP A;  3WCO A;  4UHM A;  3WGB A;  4AO9 A;  3FQA A;  3ZZJ A;  3GSB A;  4PFN A;  1MGV A;  1ASC A;  5G4I A;  2YCN A;  1LC7 A;  4K2M A;  1AIA A;  1WYV A;  1Z3Z A;  3NDN A;  1IJI A;  2ZP7 A;  3NYS A;  4WYC A;  1ECX A;  2YCT A;  3NU7 A;  3AEJ C;  4R2N A;  3L44 A;  4A0G A;  4IXZ A;  4E3R A;  4HVK A;  1X2A A;  2AY6 A;  2ZJG A;  3NNK A;  1N2T A;  3BWN A;  2YCP A;  3LVJ A;  5D95 A;  4CXQ A;  3VAX A;  5LHA A;  3DOD A;  3AOW A;  2HUI A;  1D7V A;  2E54 A;  3DR7 A;  3DZZ A;  2W8J A;  4Q75 A;  4AH3 A;  1AJS A;  1G4V A;  3E6G A;  3KGW A;  4ZSW A;  4GE4 A;  3ZRR A;  4JEW A;  1RV3 A;  3TQX A;  4EFF A;  3LG0 A;  1S07 A;  2O7C A;  4OC9 A;  4IW7 A;  3FDB A;  3LVK A;  4DGT A;  4BQ0 A;  2TPL A;  3RCH A;  1G7X A;  3TAT A;  2VGZ A;  2GSA A;  2JGT A;  5DJ1 A;  2DR1 A;  5M46 A;  4J5U A;  4MQP A;  1AHY A;  3DU4 A;  2D65 A;  3E2Z A;  3MAF A;  1AY5 A;  4J8L A;  4CBS A;  2EO5 A;  2ORD A;  5J8Q A;  4WYA A;  2BYJ A;  3A2B A;  2HOR A;  3BCA A;  1YOO A;  2JJF A;  5TF5 A;  1J04 A;  2YKU A;  4WB0 B;  2D66 A;  1BQA A;  3VK2 A;  2VMW A;  3GWP A;  2AAT A;  3FQ7 A;  4GE7 A;  2W8V A;  1QJ3 A;  3BCX A;  3FZ6 A;  4N0W A;  1W7M A;  3PA9 A;  4XEW A;  2OKK A;  3M5U A;  1BW0 A;  3VK3 A;  4IXS A;  1GDE A;  1ASF A;  3W1H A;  3R9A A;  2O0R A;  2VMX A;  1B5O A;  3FD0 A;  3PD6 A;  5F9S A;  1I29 A;  5K8B A;  3N0L A;  4P7Y A;  3DYD A;  1IX6 A;  1FG7 A;  1MDX A;  1ZOB A;  1DGE A;  1AHF A;  3GZD C;  3LV2 A;  1AAW A;  1OXO A;  2OQX A;  3ACZ A;  1YAA A;  1IAX A;  1DTY A;  2O1B A;  3UWC A;  1YIY A;  1GD9 A;  1I48 A;  5EQC A;  2PB0 A;  3FDD A;  1KL1 A;  4ADC A;  2E7I A;  3DR4 A;  5M4B A;  1EG5 A;  4EU1 A;  1CQ8 A;  3JU7 A;  4RIT A;  3UAK A;  2R5E A;  4RKC A;  3GZC A;  1TAS A;  4GDY A; 
#chains in the Genus database with same CATH topology
 3HQT A;  1ASA A;  1JS3 A;  3AOV A;  2AY3 A;  3BS8 A;  3DXV A;  1D7S A;  1W7N A;  1AX4 A;  2AY8 A;  1ASM A;  1GEX A;  1ASB A;  1S0A A;  2XH1 A;  3EIB A;  3II0 A;  1UKJ A;  1QGN A;  2EZ2 A;  5DX5 A;  3EI6 A;  1RVU A;  3MEB A;  1ARG A;  1PMO A;  2D5Y A;  1W7L A;  3E2Y A;  3BWN C;  3F6T A;  1BS0 A;  4MSO A;  4WXB A;  1GEW A;  1V2E A;  1CZC A;  4I8A A;  4ZSY A;  4DQ6 A;  1CS1 A;  1KAF A;  4WB0 A;  4XJM A;  3GBX A;  4BHD A;  4KAM A;  4R8D A;  3GET A;  2VIA A;  4AZK A;  3AEM A;  5HHY A;  2AY5 A;  3I5T A;  1SZS A;  2C81 A;  2DGK A;  3B1D A;  1N31 A;  1JS6 A;  3HLM A;  5KTB A;  1LC5 A;  2HUU A;  1SPA A;  2R5C A;  5DB5 A;  2NMP A;  3K28 A;  4A6T A;  2ZY5 A;  1AIC A;  2BI2 A;  2W7J A;  4WBT A;  2VGW A;  2HOY A;  4ITX A;  1D2F A;  5DJ9 A;  4CXR A;  1M6S A;  4BMK A;  3ASB A;  2OGE A;  3WZF A;  3QPG A;  3WKR A;  1B9H A;  3IHJ A;  4Y0H A;  1C0N A;  2ZY2 A;  4RKD A;  2EH6 A;  2YKX A;  1TAR A;  1AJR A;  3N4S A;  3HL2 A;  3WKS A;  2ZYJ A;  1M0N A;  2X5F A;  1PFF A;  1I41 A;  1C7O A;  1C7G A;  3H7F A;  3KKI A;  4A72 A;  5AX8 A;  3WLX A;  2V1P A;  1V2D A;  2VIB A;  1J32 A;  4JEY A;  1H0C A;  1BJN A;  1OXP A;  3DXW A;  2CY8 A;  5JAY A;  2X3L A;  5G0A A;  3I4J A;  4HF8 A;  1AHX A;  1LKC A;  1WYT B;  1IUG A;  2ZSM A;  3LY1 A;  2CFB A;  2F8J A;  2W7F A;  3AEL A;  3PDB B;  1QIT A;  2JG2 A;  4A00 A;  1AY4 A;  1OAT A;  2G6W A;  3NUI A;  4Y0I A;  1BJO B;  2CIN A;  3E9K A;  1SFF A;  3EI5 A;  1DFO A;  5C6U A;  1AY8 A;  1UU1 A;  2CAN A;  3B46 A;  2VI8 A;  2YKV A;  5M49 A;  2AEV A;  2Z20 A;  1FC4 A;  1S09 A;  2DKJ A;  2VMY A;  3VK4 A;  3ZZK A;  1WST A;  1OHY A;  5FT5 A;  2FQ6 A;  1TAT A;  1GCK A;  3CQ4 A;  4WLJ A;  3FVS A;  1O61 A;  3EUC A;  4Y0D A;  3LVL B;  1S08 A;  1DGD A;  2FM1 A;  3B1C A;  3FFR A;  3JWB A;  2VMU A;  2FYF A;  1V72 A;  4IX8 A;  2W7H A;  3RBL A;  2G7J A;  1M4N A;  3F0H A;  3MC6 C;  1YIZ A;  2C7T A;  1VEF A;  5EAA A;  4TN4 A;  3PGY A;  3ASA A;  4RLG A;  3WY7 A;  1IX7 A;  3FKD A;  1GBN A;  3P6K A;  2QSR A;  2QB2 A;  4XJL A;  2Z1Y A;  2WK7 A;  5D5S A;  3PJ0 A;  2V0Y A;  1IVR A;  4A0R A;  4GRX A;  1RV4 A;  1ARH A;  2BWP A;  3DC1 A;  1BJ4 A;  4LW2 A;  2QA3 A;  2C0R A;  2E7J A;  2CJD A;  4IYO B;  2OAT A;  4OTL A;  3ATH A;  2YRR A;  1PG8 A;  3G7Q A;  3AAT A;  4ADE A;  2DOU A;  4MQR A;  4ATQ A;  2GMU A;  2Z67 A;  3FTB A;  1B8G A;  1WYT A;  4TMR A;  5I92 A;  3N75 A;  1AKC A;  2D63 A;  2VGT A;  3KGX A;  3PDB A;  1Y4I A;  3DRD A;  3AEP A;  2CH1 A;  1VP4 A;  2VMO A;  4NOG A;  1QJ5 A;  2E7U A;  2VLH A;  1BJO A;  5FT8 A;  1FG3 A;  2HOX A;  1C9C A;  2VGU A;  1B9I A;  3NYT A;  2W7G A;  1AMQ A;  1X0M A;  2ZSL A;  3KE3 A;  2Z1Z A;  1AMS A;  4B98 A;  2QBT A;  1H1C A;  3HBX A;  3QBO A;  4RM1 A;  2VMZ A;  3W1J A;  3WX9 A;  3ELP A;  4LW4 A;  1AKA A;  2YRI A;  4ZWV A;  1LS3 A;  4LNJ A;  2W8T A;  5HDM A;  4A0F A;  1M0P A;  3Q8N A;  1YJZ A;  2D7Z A;  3NRA A;  4WYF A;  1QIS A;  1SVV A;  5G4J A;  5M4D A;  5LH9 A;  2ZY3 A;  3QN6 A;  1ZOD A;  4ITG A;  3WCN A;  3BN1 A;  2RFV A;  3ISL A;  5EUE A;  2BYL A;  1X28 A;  4GSA A;  1AMR A;  1SZU A;  2BWN A;  2C44 A;  2WK8 A;  4N0B A;  3B1E A;  4OMA A;  4PVF A;  4F4E A;  4TV7 A;  4F5G A;  1CL1 A;  4LNM A;  3ELE A;  3RUY A;  4F5I A;  1I43 A;  2KFP A;  2AEU A;  4WYE A;  1TOJ A;  4WYD A;  2X8U A;  1AHE A;  5EFS A;  1KKP A;  1E5F A;  3NYU A;  3FZ8 A;  4A0H A;  1LC8 A;  4IYO A;  3HMU A;  2VMR A;  5EUD A;  4W1W A;  1B5P A;  4ZDP A;  2X5D A;  1IAY A;  3A9Y A;  4GEB A;  4RJ0 A;  3TCM A;  4A6R A;  2VLF A;  2DGL A;  3AEJ A;  3NU8 A;  5FT6 A;  4A6U A;  5IWQ A;  3COG A;  1Z7D A;  4BA5 A;  2Z9X A;  2AY7 A;  2VMP A;  4OYT A;  1DJ9 A;  4F5H A;  4UHN A;  4JE5 A;  3AEN B;  2BIE A;  4EB5 A;  1AKB A;  1O69 A;  4WP0 A;  1ORD A;  3PPL A;  3P1T A;  4L0O A;  2Z9U A;  4M2K A;  2BHX A;  4WLH A;  2PB2 A;  4F5K A;  1KMK A;  1GEY A;  3T32 A;  3A9X A;  1O62 A;  2AY2 A;  2VMN A;  1C7N A;  2BKW A;  2W7K A;  4JEZ A;  3RI6 A;  1CQ6 A;  4W1X A;  3BC8 A;  2W8U A;  1KL2 A;  2WB6 A;  3CAI A;  3AV7 A;  1GC0 A;  1IBJ A;  4LC3 A;  4RJY A;  2CH2 A;  2W7L A;  2JJH A;  2FN6 A;  3FZ7 A;  3TFT A;  2VGV A;  1M7Y A;  1SZK A;  1AJS B;  3HVY A;  1SF2 A;  1CJ0 A;  4DBC A;  1TOI A;  3CBF A;  1M0O A;  2VMS A;  3PIU A;  3EZ1 A;  3MAU A;  4M2M A;  1W23 A;  1MDZ A;  5E5I A;  1ELU A;  3G0T A;  4W1V A;  4W91 A;  1N8P A;  1LW4 A;  2CTZ A;  3E2F A;  4XAU A;  3A9Z A;  1OHV A;  3ECD A;  3MAF B;  4Q31 A;  2CB1 A;  2D64 A;  4FFC A;  2BI5 A;  3GZD A;  3R4T A;  1X29 A;  2W8W A;  3JWA A;  4QGR A;  5G2P A;  4CVQ A;  3WGC A;  3OKS A;  1LK9 A;  2VGS A;  1AMA A;  4XQ2 A;  1D7R A;  1GC2 A;  3AEN A;  1D7U A;  4XK1 A;  1ARI A;  3FVX A;  1KKJ A;  4MKK A;  2XBN A;  4FL0 A;  3VP6 A;  1BJW A;  2EPJ A;  1M32 A;  2VI9 A;  2Z61 A;  2FNU A;  3BB8 A;  4ZAH A;  1EQB A;  1LW5 A;  2D61 A;  4F5F A;  5BJ4 A;  2AY9 A;  3BV0 A;  3F9T A;  3EI7 A;  1XEY A;  3RQ1 A;  5G09 A;  1JF9 A;  3PD6 B;  3H9X A;  2BWO A;  4ZAS A;  1OHW A;  3UE8 A;  3GR9 A;  4OCA A;  1V2F A;  4AO4 A;  4RAE A;  4P3M A;  4ZDO A;  4MY5 A;  4MGR A;  4M2J A;  4H51 A;  1WKG A;  3FCR A;  3AEM C;  3E77 A;  2HUF A;  2BI1 A;  2JJG A;  2W7I A;  4K2I A;  5FT4 A;  1TOG A;  4WXG A;  4AZJ A;  3BWO A;  4JF1 A;  1MLZ A;  1T3I A;  3FVU A;  4R5F A;  1G7W A;  4UHO A;  2VMV A;  3HT4 A;  1PMM A;  2BIA A;  4JEX A;  4PIW A;  1EJI A;  2ZY4 A;  1ASD A;  4MKJ A;  1BT4 A;  4OT8 A;  2QMA A;  2GB3 A;  4XJP A;  2GMS A;  3G8M A;  4Q76 A;  4E77 A;  4ZM4 A;  5G2Q A;  1MAQ A;  2YHK A;  3K40 A;  1TOE A;  2VMQ A;  4BA4 A;  3EIA A;  4O6Z A;  3W1I A;  3LVM A;  1ARS A;  2HP1 A;  1ASG A;  3FSL A;  2D7Y A;  3MBB A;  4U2H A;  4ATP A;  2Z9W A;  2JJE A;  1ASN A;  1WKH A;  4WYG A;  1O4S A;  2HP2 A;  1U08 A;  1UU2 A;  1QZ9 A;  4UOY A;  1M0Q A;  3L8A A;  5EAV A;  1UU0 A;  3IF2 A;  4ADB A;  3PDX A;  2AY4 A;  2DKB A;  1GC4 A;  3B8X A;  3QHX A;  2OKJ A;  1GC3 A;  2W7M A;  1B4X A;  5F8V A;  2QB3 A;  2BI3 A;  2Q7W A;  1AHG A;  2EZ1 A;  2YOB A;  4ZLV A;  2BI9 A;  3AEO A;  2ZC0 A;  4ZM3 A;  2R5C B;  3N5M A;  4ZWM A;  1S06 A;  1MDO A;  1YJS A;  3I16 A;  4EB7 A;  1WYU B;  2CJH A;  3NX3 A;  3EI9 A;  1W3U A;  1CL2 A;  1TPL A;  4W5K A;  4F5M A;  2HOZ A;  4PFF A;  2W7D A;  5EIG B;  4OBU A;  3A8U X;  1CQ7 A;  8AAT A;  5EUN A;  2R0T A;  1ZC9 A;  3ZRP A;  3GJU A;  3N4X A;  1VJO A;  3K7Y A;  3HDO A;  3JTX A;  1ASL A;  1C4K A;  5HXX A;  1YNU A;  4WD2 A;  3RBF A;  3NTJ A;  3USF A;  1E5E A;  5E4Z A;  5E3K A;  4ADD A;  3JW9 A;  1DKA A;  3TFU A;  3BCB A;  3EZS A;  3VOM A;  5BJ3 A;  4GE9 A;  1XI9 A;  4E3Q A;  1DJU A;  4LNL A;  3MC6 A;  4K05 A;  1KMJ A;  4OBV A;  4AOA A;  2JIS A;  2EYQ A;  3LWS A;  1BQD A;  1WYV B;  4JEV A;  4W8I A;  2CST A;  2OGA A;  2VYC A;  2ZUK A;  3N4R A;  1DJE A;  1ART A;  4UQV A;  2FNI A;  1AAM A;  1JG8 A;  4MQQ A;  1ASE A;  3EI8 A;  4IY7 A;  2GQN A;  1G4X A;  3NUB A;  4K2B A;  3OP7 A;  4U1T A;  4ISY A;  3JZL A;  2WKA A;  2WK9 A;  3H14 A;  3QGU A;  1IX8 A;  3ZRQ A;  2BIG A;  2HZP A;  3D6K A;  1MLY A;  4KYO A;  4R5Z A;  3CQ6 A;  4XJO A;  2FKI A;  1AIB A;  1BKG A;  4WXF A;  3MKJ A;  1WYU A;  4KXK A;  4JF0 A;  2PO3 A;  1YJY A;  4F5L A;  3FRK A;  5EIG A;  2W7E A;  1TOK A;  1QIR A;  3CQ5 A;  3FFH A;  3FQ8 A;  4EMY A;  2QLR A;  3PAA A;  1CZE A;  4JE5 D;  2YKY A;  3QI6 A;  4ZDL A;  4IXO A;  2R2N A;  2VMT A;  3QM2 A;  2AY1 A;  3MAD A;  3RCH B;  4RIZ A;  4CBR A;  1RVY A;  3E2Z B;  2EGY A;  2Z9V A;  4F5J A;  2CJG A;  3N7N A;  4B9B A;  7AAT A;  1P3W A;  9AAT A;  4E1O A;  1ELQ A;  2DGM A;  4Q6R A;  1MAP A;  3WCO A;  4UHM A;  3WGB A;  4AO9 A;  3FQA A;  3ZZJ A;  3GSB A;  4PFN A;  1MGV A;  1ASC A;  5G4I A;  2YCN A;  1LC7 A;  4K2M A;  1AIA A;  1WYV A;  1Z3Z A;  3NDN A;  1IJI A;  2ZP7 A;  3NYS A;  4H63 Q;  4WYC A;  1ECX A;  2YCT A;  3NU7 A;  3AEJ C;  4R2N A;  3L44 A;  4A0G A;  4IXZ A;  4E3R A;  4HVK A;  1X2A A;  2AY6 A;  2ZJG A;  3NNK A;  1N2T A;  3BWN A;  2YCP A;  3LVJ A;  5D95 A;  4CXQ A;  3VAX A;  5LHA A;  3DOD A;  3AOW A;  2HUI A;  1D7V A;  2E54 A;  3DR7 A;  3DZZ A;  2W8J A;  4Q75 A;  4AH3 A;  1AJS A;  1G4V A;  3E6G A;  3KGW A;  4ZSW A;  4GE4 A;  3ZRR A;  4JEW A;  1RV3 A;  3TQX A;  4EFF A;  3LG0 A;  1S07 A;  2O7C A;  4OC9 A;  4IW7 A;  3FDB A;  3LVK A;  4DGT A;  4BQ0 A;  2TPL A;  3RCH A;  1G7X A;  3TAT A;  2VGZ A;  2GSA A;  2JGT A;  5DJ1 A;  2DR1 A;  5M46 A;  4J5U A;  4MQP A;  1AHY A;  3DU4 A;  2D65 A;  3E2Z A;  3MAF A;  1AY5 A;  4J8L A;  4CBS A;  2EO5 A;  2ORD A;  5J8Q A;  4WYA A;  2BYJ A;  3A2B A;  2HOR A;  3BCA A;  1YOO A;  2JJF A;  5TF5 A;  1J04 A;  2YKU A;  4WB0 B;  2D66 A;  1BQA A;  3VK2 A;  2VMW A;  3GWP A;  2AAT A;  3FQ7 A;  4GE7 A;  2W8V A;  1QJ3 A;  3BCX A;  3FZ6 A;  4N0W A;  1W7M A;  3PA9 A;  4XEW A;  2OKK A;  3M5U A;  1BW0 A;  3VK3 A;  4IXS A;  1GDE A;  1ASF A;  3W1H A;  3R9A A;  2O0R A;  2VMX A;  1B5O A;  3FD0 A;  3PD6 A;  5F9S A;  1I29 A;  5K8B A;  3N0L A;  4P7Y A;  3DYD A;  1IX6 A;  2A1V A;  1FG7 A;  1MDX A;  1ZOB A;  1DGE A;  1AHF A;  3GZD C;  3LV2 A;  1AAW A;  1OXO A;  2OQX A;  3ACZ A;  1YAA A;  1IAX A;  1DTY A;  2O1B A;  3UWC A;  1YIY A;  1GD9 A;  1I48 A;  5EQC A;  2PB0 A;  3FDD A;  1KL1 A;  4ADC A;  2E7I A;  3DR4 A;  5M4B A;  1EG5 A;  4EU1 A;  1CQ8 A;  3JU7 A;  4RIT A;  3UAK A;  2R5E A;  4RKC A;  3GZC A;  1TAS A;  4GDY A; 
#chains in the Genus database with same CATH homology
 3HQT A;  1ASA A;  1JS3 A;  3AOV A;  2AY3 A;  3BS8 A;  3DXV A;  1D7S A;  1W7N A;  1AX4 A;  2AY8 A;  1ASM A;  1GEX A;  1ASB A;  1S0A A;  2XH1 A;  3EIB A;  3II0 A;  1UKJ A;  1QGN A;  2EZ2 A;  5DX5 A;  3EI6 A;  1RVU A;  3MEB A;  1ARG A;  1PMO A;  2D5Y A;  1W7L A;  3E2Y A;  3BWN C;  3F6T A;  1BS0 A;  4MSO A;  4WXB A;  1GEW A;  1V2E A;  1CZC A;  4I8A A;  4ZSY A;  4DQ6 A;  1CS1 A;  4WB0 A;  4XJM A;  3GBX A;  4BHD A;  4KAM A;  4R8D A;  3GET A;  2VIA A;  4AZK A;  3AEM A;  5HHY A;  2AY5 A;  3I5T A;  1SZS A;  2C81 A;  2DGK A;  3B1D A;  1N31 A;  1JS6 A;  3HLM A;  5KTB A;  1LC5 A;  2HUU A;  1SPA A;  2R5C A;  5DB5 A;  2NMP A;  3K28 A;  4A6T A;  2ZY5 A;  1AIC A;  2BI2 A;  2W7J A;  4WBT A;  2VGW A;  2HOY A;  4ITX A;  1D2F A;  5DJ9 A;  4CXR A;  1M6S A;  4BMK A;  3ASB A;  2OGE A;  3WZF A;  3QPG A;  3WKR A;  1B9H A;  3IHJ A;  4Y0H A;  1C0N A;  2ZY2 A;  4RKD A;  2EH6 A;  2YKX A;  1TAR A;  1AJR A;  3N4S A;  3HL2 A;  3WKS A;  2ZYJ A;  1M0N A;  2X5F A;  1PFF A;  1I41 A;  1C7O A;  1C7G A;  3H7F A;  3KKI A;  4A72 A;  5AX8 A;  3WLX A;  2V1P A;  1V2D A;  2VIB A;  1J32 A;  4JEY A;  1H0C A;  1BJN A;  1OXP A;  3DXW A;  2CY8 A;  5JAY A;  2X3L A;  5G0A A;  3I4J A;  4HF8 A;  1AHX A;  1LKC A;  1WYT B;  1IUG A;  2ZSM A;  3LY1 A;  2CFB A;  2F8J A;  2W7F A;  3AEL A;  3PDB B;  1QIT A;  2JG2 A;  4A00 A;  1AY4 A;  1OAT A;  2G6W A;  3NUI A;  4Y0I A;  1BJO B;  2CIN A;  3E9K A;  1SFF A;  3EI5 A;  1DFO A;  5C6U A;  1AY8 A;  1UU1 A;  2CAN A;  3B46 A;  2VI8 A;  2YKV A;  5M49 A;  2AEV A;  2Z20 A;  1FC4 A;  1S09 A;  2DKJ A;  2VMY A;  3VK4 A;  3ZZK A;  1WST A;  1OHY A;  5FT5 A;  2FQ6 A;  1TAT A;  1GCK A;  3CQ4 A;  4WLJ A;  3FVS A;  1O61 A;  3EUC A;  4Y0D A;  3LVL B;  1S08 A;  1DGD A;  2FM1 A;  3B1C A;  3FFR A;  3JWB A;  2VMU A;  2FYF A;  1V72 A;  4IX8 A;  2W7H A;  3RBL A;  2G7J A;  1M4N A;  3F0H A;  3MC6 C;  1YIZ A;  2C7T A;  1VEF A;  5EAA A;  4TN4 A;  3PGY A;  3ASA A;  4RLG A;  3WY7 A;  1IX7 A;  3FKD A;  1GBN A;  3P6K A;  2QSR A;  2QB2 A;  4XJL A;  2Z1Y A;  2WK7 A;  5D5S A;  3PJ0 A;  2V0Y A;  1IVR A;  4A0R A;  4GRX A;  1RV4 A;  1ARH A;  2BWP A;  3DC1 A;  1BJ4 A;  4LW2 A;  2QA3 A;  2C0R A;  2E7J A;  2CJD A;  4IYO B;  2OAT A;  4OTL A;  3ATH A;  2YRR A;  1PG8 A;  3G7Q A;  3AAT A;  4ADE A;  2DOU A;  4MQR A;  4ATQ A;  2GMU A;  2Z67 A;  3FTB A;  1B8G A;  1WYT A;  4TMR A;  5I92 A;  3N75 A;  1AKC A;  2D63 A;  2VGT A;  3KGX A;  3PDB A;  1Y4I A;  3DRD A;  3AEP A;  2CH1 A;  1VP4 A;  2VMO A;  4NOG A;  1QJ5 A;  2E7U A;  2VLH A;  1BJO A;  5FT8 A;  1FG3 A;  2HOX A;  1C9C A;  2VGU A;  1B9I A;  3NYT A;  2W7G A;  1AMQ A;  1X0M A;  2ZSL A;  3KE3 A;  2Z1Z A;  1AMS A;  4B98 A;  2QBT A;  1H1C A;  3HBX A;  3QBO A;  4RM1 A;  2VMZ A;  3W1J A;  3WX9 A;  3ELP A;  4LW4 A;  1AKA A;  2YRI A;  4ZWV A;  1LS3 A;  4LNJ A;  2W8T A;  5HDM A;  4A0F A;  1M0P A;  3Q8N A;  1YJZ A;  2D7Z A;  3NRA A;  4WYF A;  1QIS A;  1SVV A;  5G4J A;  5M4D A;  5LH9 A;  2ZY3 A;  3QN6 A;  1ZOD A;  4ITG A;  3WCN A;  3BN1 A;  2RFV A;  3ISL A;  5EUE A;  2BYL A;  1X28 A;  4GSA A;  1AMR A;  1SZU A;  2BWN A;  2C44 A;  2WK8 A;  4N0B A;  3B1E A;  4OMA A;  4PVF A;  4F4E A;  4TV7 A;  4F5G A;  1CL1 A;  4LNM A;  3ELE A;  3RUY A;  4F5I A;  1I43 A;  2KFP A;  2AEU A;  4WYE A;  1TOJ A;  4WYD A;  2X8U A;  1AHE A;  5EFS A;  1KKP A;  1E5F A;  3NYU A;  3FZ8 A;  4A0H A;  1LC8 A;  4IYO A;  3HMU A;  2VMR A;  5EUD A;  4W1W A;  1B5P A;  4ZDP A;  2X5D A;  1IAY A;  3A9Y A;  4GEB A;  4RJ0 A;  3TCM A;  4A6R A;  2VLF A;  2DGL A;  3AEJ A;  3NU8 A;  5FT6 A;  4A6U A;  5IWQ A;  3COG A;  1Z7D A;  4BA5 A;  2Z9X A;  2AY7 A;  2VMP A;  4OYT A;  1DJ9 A;  4F5H A;  4UHN A;  4JE5 A;  3AEN B;  2BIE A;  4EB5 A;  1AKB A;  1O69 A;  4WP0 A;  1ORD A;  3PPL A;  3P1T A;  4L0O A;  2Z9U A;  4M2K A;  2BHX A;  4WLH A;  2PB2 A;  4F5K A;  1KMK A;  1GEY A;  3T32 A;  3A9X A;  1O62 A;  2AY2 A;  2VMN A;  1C7N A;  2BKW A;  2W7K A;  4JEZ A;  3RI6 A;  1CQ6 A;  4W1X A;  3BC8 A;  2W8U A;  1KL2 A;  2WB6 A;  3CAI A;  3AV7 A;  1GC0 A;  1IBJ A;  4LC3 A;  4RJY A;  2CH2 A;  2W7L A;  2JJH A;  2FN6 A;  3FZ7 A;  3TFT A;  2VGV A;  1M7Y A;  1SZK A;  1AJS B;  3HVY A;  1SF2 A;  1CJ0 A;  4DBC A;  1TOI A;  3CBF A;  1M0O A;  2VMS A;  3PIU A;  3EZ1 A;  3MAU A;  4M2M A;  1W23 A;  1MDZ A;  5E5I A;  1ELU A;  3G0T A;  4W1V A;  4W91 A;  1N8P A;  1LW4 A;  2CTZ A;  3E2F A;  4XAU A;  3A9Z A;  1OHV A;  3ECD A;  3MAF B;  4Q31 A;  2CB1 A;  2D64 A;  4FFC A;  2BI5 A;  3GZD A;  3R4T A;  1X29 A;  2W8W A;  3JWA A;  4QGR A;  5G2P A;  4CVQ A;  3WGC A;  3OKS A;  1LK9 A;  2VGS A;  1AMA A;  4XQ2 A;  1D7R A;  1GC2 A;  3AEN A;  1D7U A;  4XK1 A;  1ARI A;  3FVX A;  1KKJ A;  4MKK A;  2XBN A;  4FL0 A;  3VP6 A;  1BJW A;  2EPJ A;  1M32 A;  2VI9 A;  2Z61 A;  2FNU A;  3BB8 A;  4ZAH A;  1EQB A;  1LW5 A;  2D61 A;  4F5F A;  5BJ4 A;  2AY9 A;  3BV0 A;  3F9T A;  3EI7 A;  1XEY A;  3RQ1 A;  5G09 A;  1JF9 A;  3PD6 B;  3H9X A;  2BWO A;  4ZAS A;  1OHW A;  3UE8 A;  3GR9 A;  4OCA A;  1V2F A;  4AO4 A;  4RAE A;  4P3M A;  4ZDO A;  4MY5 A;  4MGR A;  4M2J A;  4H51 A;  1WKG A;  3FCR A;  3AEM C;  3E77 A;  2HUF A;  2BI1 A;  2JJG A;  2W7I A;  4K2I A;  5FT4 A;  1TOG A;  4WXG A;  4AZJ A;  3BWO A;  4JF1 A;  1MLZ A;  1T3I A;  3FVU A;  4R5F A;  1G7W A;  4UHO A;  2VMV A;  3HT4 A;  1PMM A;  2BIA A;  4JEX A;  4PIW A;  1EJI A;  2ZY4 A;  1ASD A;  4MKJ A;  1BT4 A;  4OT8 A;  2QMA A;  2GB3 A;  4XJP A;  2GMS A;  3G8M A;  4Q76 A;  4E77 A;  4ZM4 A;  5G2Q A;  1MAQ A;  2YHK A;  3K40 A;  1TOE A;  2VMQ A;  4BA4 A;  3EIA A;  4O6Z A;  3W1I A;  3LVM A;  1ARS A;  2HP1 A;  1ASG A;  3FSL A;  2D7Y A;  3MBB A;  4U2H A;  4ATP A;  2Z9W A;  2JJE A;  1ASN A;  1WKH A;  4WYG A;  1O4S A;  2HP2 A;  1U08 A;  1UU2 A;  1QZ9 A;  4UOY A;  1M0Q A;  3L8A A;  5EAV A;  1UU0 A;  3IF2 A;  4ADB A;  3PDX A;  2AY4 A;  2DKB A;  1GC4 A;  3B8X A;  3QHX A;  2OKJ A;  1GC3 A;  2W7M A;  1B4X A;  5F8V A;  2QB3 A;  2BI3 A;  2Q7W A;  1AHG A;  2EZ1 A;  2YOB A;  4ZLV A;  2BI9 A;  3AEO A;  2ZC0 A;  4ZM3 A;  2R5C B;  3N5M A;  4ZWM A;  1S06 A;  1MDO A;  1YJS A;  3I16 A;  4EB7 A;  1WYU B;  2CJH A;  3NX3 A;  3EI9 A;  1W3U A;  1CL2 A;  1TPL A;  4W5K A;  4F5M A;  2HOZ A;  4PFF A;  2W7D A;  5EIG B;  4OBU A;  3A8U X;  1CQ7 A;  8AAT A;  5EUN A;  2R0T A;  1ZC9 A;  3ZRP A;  3GJU A;  3N4X A;  1VJO A;  3K7Y A;  3HDO A;  3JTX A;  1ASL A;  1C4K A;  5HXX A;  1YNU A;  4WD2 A;  3RBF A;  3NTJ A;  3USF A;  1E5E A;  5E4Z A;  5E3K A;  4ADD A;  3JW9 A;  1DKA A;  3TFU A;  3BCB A;  3EZS A;  3VOM A;  5BJ3 A;  4GE9 A;  1XI9 A;  4E3Q A;  1DJU A;  4LNL A;  3MC6 A;  4K05 A;  1KMJ A;  4OBV A;  4AOA A;  2JIS A;  2EYQ A;  3LWS A;  1BQD A;  1WYV B;  4JEV A;  4W8I A;  2CST A;  2OGA A;  2VYC A;  2ZUK A;  3N4R A;  1DJE A;  1ART A;  4UQV A;  2FNI A;  1AAM A;  1JG8 A;  4MQQ A;  1ASE A;  3EI8 A;  4IY7 A;  2GQN A;  1G4X A;  3NUB A;  4K2B A;  3OP7 A;  4U1T A;  4ISY A;  3JZL A;  2WKA A;  2WK9 A;  3H14 A;  3QGU A;  1IX8 A;  3ZRQ A;  2BIG A;  2HZP A;  3D6K A;  1MLY A;  4KYO A;  4R5Z A;  3CQ6 A;  4XJO A;  2FKI A;  1AIB A;  1BKG A;  4WXF A;  3MKJ A;  1WYU A;  4KXK A;  4JF0 A;  2PO3 A;  1YJY A;  4F5L A;  3FRK A;  5EIG A;  2W7E A;  1TOK A;  1QIR A;  3CQ5 A;  3FFH A;  3FQ8 A;  4EMY A;  2QLR A;  3PAA A;  1CZE A;  4JE5 D;  2YKY A;  3QI6 A;  4ZDL A;  4IXO A;  2R2N A;  2VMT A;  3QM2 A;  2AY1 A;  3MAD A;  3RCH B;  4RIZ A;  4CBR A;  1RVY A;  3E2Z B;  2EGY A;  2Z9V A;  4F5J A;  2CJG A;  3N7N A;  4B9B A;  7AAT A;  1P3W A;  9AAT A;  4E1O A;  1ELQ A;  2DGM A;  4Q6R A;  1MAP A;  3WCO A;  4UHM A;  3WGB A;  4AO9 A;  3FQA A;  3ZZJ A;  3GSB A;  4PFN A;  1MGV A;  1ASC A;  5G4I A;  2YCN A;  1LC7 A;  4K2M A;  1AIA A;  1WYV A;  1Z3Z A;  3NDN A;  1IJI A;  2ZP7 A;  3NYS A;  4H63 Q;  4WYC A;  1ECX A;  2YCT A;  3NU7 A;  3AEJ C;  4R2N A;  3L44 A;  4A0G A;  4IXZ A;  4E3R A;  4HVK A;  1X2A A;  2AY6 A;  2ZJG A;  3NNK A;  1N2T A;  3BWN A;  2YCP A;  3LVJ A;  5D95 A;  4CXQ A;  3VAX A;  5LHA A;  3DOD A;  3AOW A;  2HUI A;  1D7V A;  2E54 A;  3DR7 A;  3DZZ A;  2W8J A;  4Q75 A;  4AH3 A;  1AJS A;  1G4V A;  3E6G A;  3KGW A;  4ZSW A;  4GE4 A;  3ZRR A;  4JEW A;  1RV3 A;  3TQX A;  4EFF A;  3LG0 A;  1S07 A;  2O7C A;  4OC9 A;  4IW7 A;  3FDB A;  3LVK A;  4DGT A;  4BQ0 A;  2TPL A;  3RCH A;  1G7X A;  3TAT A;  2VGZ A;  2GSA A;  2JGT A;  5DJ1 A;  2DR1 A;  5M46 A;  4J5U A;  4MQP A;  1AHY A;  3DU4 A;  2D65 A;  3E2Z A;  3MAF A;  1AY5 A;  4J8L A;  4CBS A;  2EO5 A;  2ORD A;  5J8Q A;  4WYA A;  2BYJ A;  3A2B A;  2HOR A;  3BCA A;  1YOO A;  2JJF A;  5TF5 A;  1J04 A;  2YKU A;  4WB0 B;  2D66 A;  1BQA A;  3VK2 A;  2VMW A;  3GWP A;  2AAT A;  3FQ7 A;  4GE7 A;  2W8V A;  1QJ3 A;  3BCX A;  3FZ6 A;  4N0W A;  1W7M A;  3PA9 A;  4XEW A;  2OKK A;  3M5U A;  1BW0 A;  3VK3 A;  4IXS A;  1GDE A;  1ASF A;  3W1H A;  3R9A A;  2O0R A;  2VMX A;  1B5O A;  3FD0 A;  3PD6 A;  5F9S A;  1I29 A;  5K8B A;  3N0L A;  4P7Y A;  3DYD A;  1IX6 A;  2A1V A;  1FG7 A;  1MDX A;  1ZOB A;  1DGE A;  1AHF A;  3GZD C;  3LV2 A;  1AAW A;  1OXO A;  2OQX A;  3ACZ A;  1YAA A;  1IAX A;  1DTY A;  2O1B A;  3UWC A;  1YIY A;  1GD9 A;  1I48 A;  5EQC A;  2PB0 A;  3FDD A;  1KL1 A;  4ADC A;  2E7I A;  3DR4 A;  5M4B A;  1EG5 A;  4EU1 A;  1CQ8 A;  3JU7 A;  4RIT A;  3UAK A;  2R5E A;  4RKC A;  3GZC A;  1TAS A;  4GDY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...