3FVUA

Crystal structure of human kynurenine aminotransferase i in complex with indole-3-acetic acid
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
419
structure length
418
Chain Sequence
QLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into the inhibition of human kynurenine aminotransferase I/glutamine transaminase K
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase, transferase
molecule keywords Kynurenine--oxoglutarate transaminase 1
total genus 145
structure length 418
sequence length 419
chains with identical sequence B
ec nomenclature ec 2.6.1.64: Glutamine--phenylpyruvate transaminase.
pdb deposition date 2009-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3fvuA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3fvuA01
3VK2A 5TF5A 5EAAA 2AATA 1GC0A 3Q8NA 4GE4A 4ZSYA 4KYOA 4W1XA 3T32A 1W23A 4CBRA 1N2TA 3VP6A 1WYTA 2W7FA 4MQPA 1AJSA 3TFTA 1IVRA 2VIAA 4A6TA 3GETA 1YNUA 3BCBA 3FDBA 2YCPA 1G4VA 1WYVA 1MDXA 1GCKA 2WK9A 3EI9A 3OP7A 1GC3A 3I5TA 1OXPA 2BI1A 4W5KA 2VI8A 3GSBA 1P3WA 4R5ZA 4JF1A 2O0RA 3NTJA 4MY5A 1W3UA 1B4XA 1DJUA 2EZ1A 1J04A 2ZYJA 1N8PA 1I43A 2VGSA 4RJ0A 2CB1A 1LK9A 3BWNA 4OCAA 1ORDA 2W7IA 2W7HA 1IX8A 1M0OA 1O69A 4WYAA 1E5FA 3QN6A 3WKSA 2CTZA 4Y0DA 1ASNA 1YJYA 4EFFA 4W8IA 3DC1A 2JGTA 2ZSMA 3RBFA 5EIGA 1SVVA 4LNLA 5M46A 1LC8A 4JE5D 1ELQA 2CJGA 3NNKA 3TCMA 1BJ4A 3KE3A 3VAXA 1ASCA 2W8VA 3NRAA 3EZ1A 1AY5A 3CQ4A 2CFBA 2D63A 4E3QA 1CQ8A 3OKSA 2JJFA 1T3IA 2W8WA 4WXFA 3MEBA 3E2ZA 3PDBA 4OC9A 2OATA 2W7MA 1PG8A 3E2ZB 2PB2A 3N75A 2BWPA 4W91A 3A8UX 5E3KA 1LW5A 2Z1YA 1KKPA 1AJSB 1AY8A 4XQ2A 1MLYA 3BS8A 2ZJGA 1S0AA 2BIGA 2Z20A 1DFOA 2BIAA 4K2BA 2AY8A 2VMXA 3E2FA 3JTXA 1I41A 1S09A 1TPLA 4MGRA 1CQ6A 3ASAA 1WKHA 2VMWA 3GBXA 1BKGA 2HUIA 1M6SA 1IAYA 4A0HA 2GSAA 1WYUB 1ZOBA 3PPLA 4NOGA 1VP4A 3K28A 4A6UA 1PMMA 2JJHA 2XH1A 3GJUA 4MKJA 1V2DA 1FC4A 1QGNA 1BQAA 2VGTA 3BCAA 4WLJA 1GD9A 3ACZA 3FVSA 4K2IA 5DJ9A 2AY5A 2V0YA 4IX8A 4JEVA 3EIAA 3UAKA 1C0NA 2Z61A 5AX8A 4M2KA 5G4IA 4R5FA 3EZSA 3FKDA 1J32A 1C9CA 1EJIA 3HDOA 3GWPA 3LY1A 2AY1A 1KKJA 2V1PA 3BWOA 2D7ZA 2YKVA 5FT4A 2AEVA 4ZWVA 1UU2A 3F9TA 2FYFA 3HVYA 3LVKA 3I4JA 3ISLA 2TPLA 1W7NA 4DQ6A 2AY6A 3HLMA 3NYTA 4RIZA 4RKDA 5G0AA 2VMOA 4R2NA 4B98A 2DGMA 1TOKA 3W1JA 4HF8A 1M0PA 2YKYA 1WSTA 3EI7A 5D95A 1DTYA 3ZRRA 1WKGA 5F9SA 4J8LA 1TOJA 2HZPA 4RITA 1SF2A 2FM1A 2PB0A 1LKCA 2ZP7A 3E2YA 4WB0B 2D61A 1GBNA 1SFFA 4IY7A 4KXKA 5EAVA 4IW7A 2HOXA 2OGEA 3EIBA 4XJLA 1X28A 4AO9A 2PO3A 2YCNA 5C6UA 2EH6A 4XEWA 3AEPA 1D7VA 2WK8A 1CS1A 4XJOA 5BJ4A 1TOGA 4A0FA 2RFVA 1C7NA 3KGWA 3AATA 2ZSLA 4RLGA 3QI6A 4LC3A 1DJEA 3MBBA 3AEOA 2VLFA 4F5LA 2CY8A 1KMJA 3AELA 3DR7A 1D7RA 7AATA 1B5OA 2C0RA 2C81A 2YRIA 3E77A 5DJ1A 5G2QA 1OATA 3USFA 3AEMA 3WGBA 2VGWA 5FT6A 3PD6A 4A6RA 2W7LA 1M4NA 3JWAA 4AZKA 1BJWA 2YKUA 3L44A 4JEXA 4Q75A 4UOYA 1IX6A 2YCTA 4WYEA 1YJZA 1RVUA 2BHXA 2X5FA 3MADA 3COGA 3JZLA 2GMUA 1AIAA 1YIYA 3FFHA 1OHWA 3W1HA 2CSTA 1I29A 2R2NA 5E5IA 4IYOA 3TQXA 1TOEA 1B9HA 1AHXA 1AKBA 5K8BA 1MAQA 4UHNA 1AAWA 1MAPA 3KGXA 4WBTA 4ATQA 5M4BA 4ZDLA 2VMYA 3FRKA 2DGKA 4K2MA 1BJNA 2ORDA 1YAAA 2G6WA 2W7GA 2EO5A 3ASBA 3NDNA 4GE7A 1AIBA 4H51A 4N0BA 3E6GA 4BMKA 3F6TA 3B1EA 2R5EA 4U1TA 1C7GA 4FFCA 2WKAA 1BT4A 4JEWA 1X29A 3G0TA 4A0RA 1TOIA 5EQCA 8AATA 5HXXA 3D6KA 4BQ0A 3FSLA 1XI9A 3PA9A 4WXBA 4UHMA 4EU1A 1ARHA 1O61A 1W7MA 5FT8A 5EIGB 4WLHA 2HUFA 4HVKA 1D7SA 2C44A 4CVQA 2QBTA 3DZZA 3A9ZA 3GZCA 5G4JA 2HP1A 5EUEA 3AEJA 4ZASA 4DBCA 3LVJA 3RBLA 1ASFA 1BS0A 4IXSA 3MAFB 2FN6A 2W8JA 4XJMA 2XBNA 2OGAA 4O6ZA 2QB2A 2X3LA 3AEJC 1JF9A 4ISYA 1IJIA 4WB0A 1JS3A 3JWBA 2Z9UA 3PDBB 1VEFA 2VI9A 4OTLA 3ZRQA 4ZDPA 4J5UA 2DR1A 9AATA 2VYCA 1VJOA 3H7FA 2OKKA 1LS3A 1S06A 2EPJA 1GC4A 1V2EA 4ZSWA 2O7CA 1RVYA 2BKWA 2HORA 1ASAA 1IAXA 2DGLA 3LG0A 3GR9A 3FZ7A 5DB5A 1KMKA 4F5JA 2VMNA 4QGRA 4EB5A 2DKJA 4GDYA 3B8XA 4A00A 2CANA 4AZJA 1M32A 2VMPA 4E3RA 4F5GA 1ASDA 5LHAA 2HOYA 4OT8A 3RI6A 3IHJA 4UHOA 4OBUA 4U2HA 3F0HA 4E77A 3A2BA 1ZC9A 4F4EA 1SZKA 1EQBA 3G8MA 1ASGA 4WYCA 1GEWA 3PAAA 3PIUA 3NYUA 1ASLA 2Z67A 2O1BA 1AMAA 1AICA 2VIBA 4TN4A 5IWQA 1EG5A 2D65A 2DOUA 4MQQA 4LW2A 4PFFA 5J8QA 3AV7A 3UWCA 4F5HA 3BB8A 4ZDOA 5E4ZA 3FQ7A 1B5PA 4M2JA 2AY3A 2CINA 1FG3A 2E7UA 3EI5A 3I16A 2YKXA 2ZUKA 1BW0A 3PJ0A 3H14A 3FZ6A 1ZODA 1LC7A 2D5YA 3AENA 3WLXA 1GC2A 3DYDA 1D7UA 1S07A 2AY9A 2VMZA 1GDEA 4R8DA 1U08A 2E7IA 4PIWA 4PFNA 4EMYA 3CQ6A 2BI5A 1GEYA 4MSOA 4ADBA 5JAYA 1YOOA 1MDOA 1ASMA 1QIRA 1BJOB 4BHDA 1E5EA 3HL2A 1CZCA 3FTBA 4OBVA 1YIZA 3TATA 3NUIA 2BIEA 3P1TA 4P7YA 1AMQA 4GEBA 4JEYA 1DJ9A 4B9BA 2VMUA 5HDMA 1ASBA 3FQAA 2R5CA 3ELEA 1TATA 2GMSA 2X5DA 4F5IA 4XJPA 1KL1A 3PDXA 2DKBA 1N31A 4ZAHA 1JS6A 1O62A 3LVMA 3RCHB 1X0MA 2CJHA 4BA4A 4OYTA 4F5MA 4W1VA 2E7JA 2ZY3A 1KL2A 2W8TA 3FD0A 1QISA 1AMSA 1AAMA 1Y4IA 2VGUA 3BWNC 3ZZKA 4UQVA 1C7OA 3ATHA 2BI9A 4MQRA 5I92A 1ARIA 4A72A 4RKCA 4E1OA 2R0TA 2QLRA 4ITXA 1M0QA 1AKAA 3FFRA 2EGYA 1MDZA 2CH2A 4AOAA 1O4SA 2AY4A 1M0NA 3G7QA 1ELUA 3K7YA 4WXGA 1UU0A 4ATPA 2ZY2A 4JEZA 1G7XA 1H1CA 3NU7A 1TASA 3FZ8A 4GE9A 4WYGA 4F5FA 2GQNA 1PMOA 3RQ1A 1CZEA 2D66A 4ADDA 3DXWA 1JG8A 2CH1A 4Q6RA 3FDDA 1OXOA 1Z7DA 3K40A 3WCNA 5HHYA 3NYSA 3M5UA 1WYVB 3P6KA 4ZM4A 3GZDC 2JG2A 2HUUA 1AKCA 1ASEA 1BJOA 1CL1A 1FG7A 4I8AA 1YJSA 4XAUA 4Y0HA 4AH3A 3TFUA 2D64A 2BI3A 3AEMC 3L8AA 4M2MA 1AHGA 2VLHA 2Z9XA 1IX7A 2VGVA 1AMRA 4TMRA 2YOBA 3B1DA 1RV4A 1UU1A 3DR4A 4ADCA 2BYLA 3FQ8A 3KKIA 2WK7A 5EFSA 4RJYA 2W8UA 3CQ5A 1SZUA 3DRDA 3DU4A 3AOWA 2FNUA 1M7YA 2C7TA 2AEUA 2Z9WA 1V72A 3MAUA 4JF0A 1S08A 1DKAA 5EUDA 1Z3ZA 3VK4A 5BJ3A 2Z9VA 2BWOA 3LV2A 1B8GA 4CXQA 2FNIA 3II0A 1I48A 3JW9A 1QJ3A 2VGZA 1OHVA 3A9XA 4IXZA 4ZWMA 4CBSA 2VMQA 2W7KA 2HOZA 4Q31A 3ELPA 2VMRA 3VK3A 4XK1A 4ITGA 3FVXA 4L0OA 4CXRA 5FT5A 4DGTA 3PGYA 3DXVA 1IBJA 4GRXA 1MLZA 3JU7A 1PFFA 2BWNA 1SPAA 1AX4A 3BV0A 1X2AA 1IUGA 3QHXA 3AOVA 2FQ6A 1AHFA 2VMSA 3IF2A 1LW4A 1G4XA 2BI2A 4PVFA 4WP0A 2W7DA 3NUBA 2ZY5A 4LNMA 3EI6A 4RAEA 4WYFA 2X8UA 3WY7A 3LVLB 2YHKA 3N5MA 3RCHA 2AY2A 3W1IA 1XEYA 4IYOB 1ECXA 3ECDA 1CQ7A 2ZC0A 2W7EA 1QITA 3NU8A 1CJ0A 5DX5A 3QGUA 2HP2A 2AY7A 4ZLVA 1C4KA 2BYJA 3R4TA 4KAMA 1AHEA 1H0CA 1SZSA 1W7LA 2D7YA 4WD2A 3WGCA 4AO4A 1LC5A 3WKRA 4IXOA 3WZFA 3QM2A 3ZRPA 2QB3A 1D2FA 3AENB 2Z1ZA 2JJGA 3LWSA 1AY4A 3DODA 3CBFA 3MC6C 3QBOA 5LH9A 5F8VA 2ZY4A 2QA3A 1BQDA 1OHYA 3MAFA 2E54A 4GSAA 3A9YA 4W1WA 2OKJA 4JE5A 4BA5A 1GEXA 5D5SA 3MC6A 1CL2A 3RUYA 3HBXA 3ZZJA 4P3MA 3HQTA 3HT4A 4OMAA 2NMPA 3EI8A 1AJRA 2GB3A 1B9IA 3FCRA 3GZDA 1TARA 3E9KA 2VMTA 2EZ2A 3PD6B 3R9AA 4Y0IA 3FVUA 1ARSA 4N0WA 2YRRA 2CJDA 2W7JA 4LW4A 2R5CB 3BN1A 3VOMA 4F5KA 4LNJA 2VMVA 1QZ9A 1UKJA 2Q7WA 3BCXA 1ARGA 4FL0A 1WYUA 1G7WA 1RV3A 2JJEA 4RM1A 4WYDA 3HMUA 4ZM3A 3MKJA 1ARTA 3B46A 1WYTB 3B1CA 3NX3A 5G09A 1MGVA 4Q76A 2F8JA 1DGEA 1QJ5A 4ADEA 4EB7A 5EUNA 3WX9A 2JISA 2OQXA 4A0GA 5G2PA 4MKKA 3N0LA 3WCOA 1V2FA 1DGDA 2QMAA 3QPGA 4TV7A 1AHYA 3EUCA 5M4DA 5M49A 3CAIA 3UE8A 3BC8A
chains in the Genus database with same CATH superfamily
3VK2A 5TF5A 5EAAA 2AATA 1GC0A 3Q8NA 4GE4A 4ZSYA 4KYOA 4W1XA 3T32A 1W23A 4CBRA 1N2TA 3VP6A 1WYTA 2W7FA 4MQPA 1AJSA 3TFTA 1IVRA 2VIAA 4A6TA 3GETA 1YNUA 3BCBA 3FDBA 2YCPA 1G4VA 1WYVA 1MDXA 1GCKA 2WK9A 3EI9A 3OP7A 1GC3A 3I5TA 1OXPA 2BI1A 4W5KA 2VI8A 3GSBA 1P3WA 4R5ZA 2KFPA 4JF1A 2EYQA 2O0RA 3NTJA 4MY5A 1W3UA 1B4XA 1DJUA 2EZ1A 1J04A 2ZYJA 1N8PA 1I43A 2VGSA 4RJ0A 2CB1A 1LK9A 3BWNA 4OCAA 1ORDA 2W7IA 2W7HA 1IX8A 1M0OA 1O69A 4WYAA 1E5FA 3QN6A 3WKSA 2CTZA 4Y0DA 1ASNA 1YJYA 4EFFA 4W8IA 3DC1A 2JGTA 2ZSMA 3RBFA 5EIGA 1SVVA 4LNLA 5M46A 1LC8A 4JE5D 1ELQA 2CJGA 3NNKA 3TCMA 1BJ4A 3KE3A 3VAXA 1ASCA 2W8VA 3NRAA 3N4RA 3EZ1A 1AY5A 3CQ4A 2CFBA 2D63A 4E3QA 1CQ8A 3OKSA 2JJFA 1T3IA 2W8WA 4WXFA 3N4XA 3MEBA 3E2ZA 3PDBA 4OC9A 2OATA 2W7MA 1PG8A 3E2ZB 2PB2A 3N75A 2BWPA 4W91A 3A8UX 5E3KA 1LW5A 2Z1YA 1KKPA 1AJSB 1AY8A 4XQ2A 1MLYA 3BS8A 2ZJGA 1S0AA 2BIGA 2Z20A 1DFOA 2BIAA 4K2BA 2AY8A 2VMXA 3E2FA 3JTXA 1I41A 1S09A 1TPLA 4MGRA 1CQ6A 3ASAA 1WKHA 2VMWA 3GBXA 1BKGA 2HUIA 1M6SA 1IAYA 4A0HA 2GSAA 1WYUB 1ZOBA 3PPLA 4NOGA 1VP4A 3K28A 4A6UA 1PMMA 2JJHA 2XH1A 3GJUA 4MKJA 1V2DA 1FC4A 1QGNA 1BQAA 2VGTA 3BCAA 4WLJA 1GD9A 3ACZA 3FVSA 4K2IA 5DJ9A 2AY5A 2V0YA 4IX8A 4JEVA 3EIAA 3UAKA 1C0NA 2Z61A 5AX8A 4M2KA 4H63Q 5G4IA 4R5FA 3EZSA 3FKDA 1J32A 1C9CA 1EJIA 3HDOA 3GWPA 3LY1A 2AY1A 1KKJA 2V1PA 3BWOA 2D7ZA 2YKVA 5FT4A 2AEVA 4ZWVA 1UU2A 3F9TA 2FYFA 3HVYA 3LVKA 3I4JA 3ISLA 2TPLA 1W7NA 4DQ6A 2AY6A 3HLMA 3NYTA 4RIZA 4RKDA 5G0AA 2VMOA 4R2NA 4B98A 2DGMA 1TOKA 3W1JA 4HF8A 1M0PA 2YKYA 1WSTA 3EI7A 5D95A 1DTYA 3ZRRA 2A1VA 1WKGA 5F9SA 4J8LA 1TOJA 2HZPA 4RITA 1SF2A 2FM1A 2PB0A 1LKCA 2ZP7A 3E2YA 4WB0B 2D61A 1GBNA 1SFFA 4IY7A 4KXKA 5EAVA 4IW7A 2HOXA 2OGEA 3EIBA 4XJLA 1X28A 4AO9A 2PO3A 2YCNA 5C6UA 2EH6A 4XEWA 3AEPA 1D7VA 2WK8A 1CS1A 4XJOA 5BJ4A 1TOGA 4A0FA 2RFVA 1C7NA 3KGWA 3AATA 2ZSLA 4RLGA 3QI6A 4LC3A 1DJEA 3MBBA 3AEOA 2VLFA 4F5LA 2CY8A 1KMJA 3AELA 3DR7A 1D7RA 7AATA 1B5OA 2C0RA 2C81A 2YRIA 3E77A 5DJ1A 5G2QA 1OATA 3USFA 3AEMA 3WGBA 2VGWA 5FT6A 3PD6A 4A6RA 2W7LA 1M4NA 3JWAA 4AZKA 1BJWA 2YKUA 3L44A 4JEXA 4Q75A 4UOYA 1IX6A 2YCTA 4WYEA 1YJZA 1RVUA 2BHXA 2X5FA 3MADA 3COGA 3JZLA 2GMUA 1AIAA 1YIYA 3FFHA 1OHWA 3W1HA 2CSTA 1I29A 2R2NA 5E5IA 4IYOA 3TQXA 1TOEA 1B9HA 1AHXA 1AKBA 5K8BA 1MAQA 4UHNA 1AAWA 1MAPA 3KGXA 4WBTA 4ATQA 5M4BA 4ZDLA 2VMYA 3FRKA 2DGKA 4K2MA 1BJNA 2ORDA 1YAAA 2G6WA 2W7GA 2EO5A 3ASBA 3NDNA 4GE7A 1AIBA 4H51A 4N0BA 3E6GA 4BMKA 3N4SA 3F6TA 3B1EA 2R5EA 4U1TA 1C7GA 4FFCA 2WKAA 1BT4A 4JEWA 1X29A 3G0TA 4A0RA 2FKIA 1TOIA 5EQCA 8AATA 5HXXA 3D6KA 4BQ0A 3FSLA 1XI9A 3PA9A 4WXBA 4UHMA 4EU1A 1ARHA 1O61A 1W7MA 5FT8A 5EIGB 4WLHA 2HUFA 4HVKA 1D7SA 2C44A 4CVQA 2QBTA 3DZZA 3A9ZA 3GZCA 5G4JA 2HP1A 5EUEA 3AEJA 4ZASA 4DBCA 3LVJA 3RBLA 1ASFA 1BS0A 4IXSA 3MAFB 2FN6A 2W8JA 4XJMA 2XBNA 2OGAA 4O6ZA 2QB2A 2X3LA 3AEJC 1JF9A 4ISYA 1IJIA 4WB0A 1JS3A 3JWBA 2Z9UA 3PDBB 1VEFA 2VI9A 4OTLA 3ZRQA 4ZDPA 4J5UA 2DR1A 9AATA 2VYCA 1VJOA 3H7FA 2OKKA 1LS3A 1S06A 2EPJA 1GC4A 1V2EA 4ZSWA 2O7CA 1RVYA 2BKWA 2HORA 1ASAA 1IAXA 2DGLA 3LG0A 3GR9A 3FZ7A 5DB5A 1KMKA 4F5JA 2VMNA 4QGRA 4EB5A 2DKJA 4GDYA 3B8XA 4A00A 2CANA 4AZJA 1M32A 2VMPA 4E3RA 4F5GA 1ASDA 5LHAA 2HOYA 4OT8A 3RI6A 3IHJA 4UHOA 4OBUA 4U2HA 3F0HA 4E77A 3A2BA 1ZC9A 4F4EA 1SZKA 1EQBA 3G8MA 1ASGA 4WYCA 1GEWA 3PAAA 3PIUA 3NYUA 1ASLA 2Z67A 2O1BA 1AMAA 1AICA 2VIBA 4TN4A 5IWQA 1EG5A 2D65A 2DOUA 4MQQA 4LW2A 4PFFA 5J8QA 3AV7A 3UWCA 4F5HA 3BB8A 4ZDOA 5E4ZA 3FQ7A 1B5PA 4M2JA 2AY3A 2CINA 1FG3A 2E7UA 3EI5A 3I16A 2YKXA 2ZUKA 1BW0A 3PJ0A 3H14A 3FZ6A 1ZODA 1LC7A 2D5YA 3AENA 3WLXA 1GC2A 3DYDA 1D7UA 1S07A 2AY9A 2VMZA 1GDEA 4R8DA 1U08A 2E7IA 4PIWA 4PFNA 4EMYA 3CQ6A 2BI5A 1GEYA 4MSOA 4ADBA 5JAYA 1YOOA 1MDOA 1ASMA 1QIRA 1BJOB 4BHDA 1E5EA 3HL2A 1CZCA 3FTBA 4OBVA 1YIZA 3TATA 3NUIA 2BIEA 3P1TA 4P7YA 1AMQA 4GEBA 4JEYA 1DJ9A 4B9BA 2VMUA 5HDMA 1ASBA 3FQAA 2R5CA 3ELEA 1TATA 2GMSA 2X5DA 4F5IA 4XJPA 1KL1A 3PDXA 2DKBA 1N31A 4ZAHA 1JS6A 1O62A 3LVMA 3RCHB 1X0MA 2CJHA 4BA4A 4OYTA 4F5MA 4W1VA 2E7JA 2ZY3A 1KL2A 2W8TA 3FD0A 1QISA 1AMSA 1AAMA 1Y4IA 2VGUA 3BWNC 3ZZKA 4UQVA 1C7OA 3ATHA 2BI9A 4MQRA 5I92A 1ARIA 4A72A 4RKCA 4E1OA 2R0TA 2QLRA 4ITXA 1M0QA 1AKAA 3FFRA 2EGYA 1MDZA 2CH2A 4AOAA 1O4SA 2AY4A 1M0NA 3G7QA 1ELUA 3K7YA 4WXGA 1UU0A 4ATPA 2ZY2A 4JEZA 1G7XA 1H1CA 3NU7A 1TASA 3FZ8A 4GE9A 4WYGA 4F5FA 2GQNA 4K05A 1PMOA 3RQ1A 1CZEA 2D66A 4ADDA 3DXWA 3N7NA 1JG8A 2CH1A 4Q6RA 3FDDA 1OXOA 1Z7DA 3K40A 3WCNA 2G7JA 5HHYA 3NYSA 3M5UA 1WYVB 3P6KA 4ZM4A 3GZDC 2JG2A 2HUUA 1AKCA 1ASEA 1BJOA 1CL1A 1FG7A 4I8AA 1YJSA 4XAUA 4Y0HA 4AH3A 5KTBA 3TFUA 2D64A 2BI3A 3AEMC 3L8AA 4M2MA 1AHGA 2VLHA 2Z9XA 1IX7A 2VGVA 1AMRA 4TMRA 2YOBA 3B1DA 1RV4A 1UU1A 3DR4A 4ADCA 3H9XA 2BYLA 3FQ8A 3KKIA 2WK7A 5EFSA 4RJYA 2W8UA 3CQ5A 1SZUA 3DRDA 3DU4A 3AOWA 2FNUA 1M7YA 2C7TA 2AEUA 2Z9WA 1V72A 3MAUA 4JF0A 1S08A 1DKAA 5EUDA 1Z3ZA 3VK4A 2WB6A 5BJ3A 2Z9VA 2BWOA 3LV2A 1B8GA 4CXQA 2FNIA 3II0A 1I48A 3JW9A 1QJ3A 2VGZA 1OHVA 3A9XA 4IXZA 4ZWMA 4CBSA 2VMQA 2W7KA 2HOZA 4Q31A 3ELPA 2VMRA 3VK3A 4XK1A 4ITGA 3FVXA 4L0OA 4CXRA 5FT5A 4DGTA 3PGYA 3DXVA 1IBJA 4GRXA 1MLZA 3JU7A 1PFFA 2BWNA 1SPAA 1AX4A 3BV0A 1X2AA 1IUGA 3QHXA 3AOVA 2FQ6A 1AHFA 2VMSA 3IF2A 1LW4A 1G4XA 2BI2A 4PVFA 4WP0A 2W7DA 3NUBA 2ZY5A 4LNMA 3EI6A 4RAEA 4WYFA 2X8UA 3WY7A 3LVLB 2YHKA 3N5MA 3RCHA 2QSRA 2AY2A 3W1IA 1XEYA 4IYOB 1ECXA 3ECDA 1CQ7A 2ZC0A 2W7EA 1QITA 3NU8A 1CJ0A 5DX5A 3QGUA 2HP2A 2AY7A 4ZLVA 1C4KA 2BYJA 3R4TA 4KAMA 1AHEA 1H0CA 1SZSA 1W7LA 2D7YA 4WD2A 3WGCA 4AO4A 1LC5A 3WKRA 4IXOA 3WZFA 3QM2A 3ZRPA 2QB3A 1D2FA 3AENB 2Z1ZA 2JJGA 3LWSA 1AY4A 3DODA 3CBFA 3MC6C 3QBOA 5LH9A 5F8VA 2ZY4A 2QA3A 1BQDA 1OHYA 3MAFA 2E54A 4GSAA 3A9YA 4W1WA 2OKJA 4JE5A 4BA5A 1GEXA 5D5SA 3MC6A 1CL2A 3RUYA 3HBXA 3ZZJA 4P3MA 3HQTA 3HT4A 4OMAA 1KAFA 2NMPA 3EI8A 1AJRA 2GB3A 1B9IA 3FCRA 3GZDA 1TARA 3E9KA 2VMTA 2EZ2A 3PD6B 3R9AA 4Y0IA 3FVUA 1ARSA 4N0WA 2YRRA 2CJDA 2W7JA 4LW4A 2R5CB 3BN1A 3VOMA 4F5KA 4LNJA 2VMVA 1QZ9A 1UKJA 2Q7WA 3BCXA 1ARGA 4FL0A 1WYUA 1G7WA 1RV3A 2JJEA 4RM1A 4WYDA 3HMUA 4ZM3A 3MKJA 1ARTA 3B46A 1WYTB 3B1CA 3NX3A 5G09A 1MGVA 4Q76A 2F8JA 1DGEA 1QJ5A 4ADEA 4EB7A 5EUNA 3WX9A 2JISA 2OQXA 4A0GA 5G2PA 4MKKA 3N0LA 3WCOA 1V2FA 1DGDA 2QMAA 3QPGA 4TV7A 1AHYA 3EUCA 5M4DA 5M49A 3CAIA 3UE8A 3BC8A
chains in the Genus database with same CATH topology
3VK2A 5TF5A 5EAAA 2AATA 1GC0A 3Q8NA 4GE4A 4ZSYA 4KYOA 4W1XA 3T32A 1W23A 4CBRA 1N2TA 3VP6A 1WYTA 2W7FA 4MQPA 1AJSA 3TFTA 1IVRA 2VIAA 4A6TA 3GETA 1YNUA 3BCBA 3FDBA 2YCPA 1G4VA 1WYVA 1MDXA 1GCKA 2WK9A 3EI9A 3OP7A 1GC3A 3I5TA 1OXPA 2BI1A 4W5KA 2VI8A 3GSBA 1P3WA 4R5ZA 2KFPA 4JF1A 2EYQA 2O0RA 3NTJA 4MY5A 1W3UA 1B4XA 1DJUA 2EZ1A 1J04A 2ZYJA 1N8PA 1I43A 2VGSA 4RJ0A 2CB1A 1LK9A 3BWNA 4OCAA 1ORDA 2W7IA 2W7HA 1IX8A 1M0OA 1O69A 4WYAA 1E5FA 3QN6A 3WKSA 2CTZA 4Y0DA 1ASNA 1YJYA 4EFFA 4W8IA 3DC1A 2JGTA 2ZSMA 3RBFA 5EIGA 1SVVA 4LNLA 5M46A 1LC8A 4JE5D 1ELQA 2CJGA 3NNKA 3TCMA 1BJ4A 3KE3A 3VAXA 1ASCA 2W8VA 3NRAA 3N4RA 3EZ1A 1AY5A 3CQ4A 2CFBA 2D63A 4E3QA 1CQ8A 3OKSA 2JJFA 1T3IA 2W8WA 4WXFA 3N4XA 3MEBA 3E2ZA 3PDBA 4OC9A 2OATA 2W7MA 1PG8A 3E2ZB 2PB2A 3N75A 2BWPA 4W91A 3A8UX 5E3KA 1LW5A 2Z1YA 1KKPA 1AJSB 1AY8A 4XQ2A 1MLYA 3BS8A 2ZJGA 1S0AA 2BIGA 2Z20A 1DFOA 2BIAA 4K2BA 2AY8A 2VMXA 3E2FA 3JTXA 1I41A 1S09A 1TPLA 4MGRA 1CQ6A 3ASAA 1WKHA 2VMWA 3GBXA 1BKGA 2HUIA 1M6SA 1IAYA 4A0HA 2GSAA 1WYUB 1ZOBA 3PPLA 4NOGA 1VP4A 3K28A 4A6UA 1PMMA 2JJHA 2XH1A 3GJUA 4MKJA 1V2DA 1FC4A 1QGNA 1BQAA 2VGTA 3BCAA 4WLJA 1GD9A 3ACZA 3FVSA 4K2IA 5DJ9A 2AY5A 2V0YA 4IX8A 4JEVA 3EIAA 3UAKA 1C0NA 2Z61A 5AX8A 4M2KA 4H63Q 5G4IA 4R5FA 3EZSA 3FKDA 1J32A 1C9CA 1EJIA 3HDOA 3GWPA 3LY1A 2AY1A 1KKJA 2V1PA 3BWOA 2D7ZA 2YKVA 5FT4A 2AEVA 4ZWVA 1UU2A 3F9TA 2FYFA 3HVYA 3LVKA 3I4JA 3ISLA 2TPLA 1W7NA 4DQ6A 2AY6A 3HLMA 3NYTA 4RIZA 4RKDA 5G0AA 2VMOA 4R2NA 4B98A 2DGMA 1TOKA 3W1JA 4HF8A 1M0PA 2YKYA 1WSTA 3EI7A 5D95A 1DTYA 3ZRRA 2A1VA 1WKGA 5F9SA 4J8LA 1TOJA 2HZPA 4RITA 1SF2A 2FM1A 2PB0A 1LKCA 2ZP7A 3E2YA 4WB0B 2D61A 1GBNA 1SFFA 4IY7A 4KXKA 5EAVA 4IW7A 2HOXA 2OGEA 3EIBA 4XJLA 1X28A 4AO9A 2PO3A 2YCNA 5C6UA 2EH6A 4XEWA 3AEPA 1D7VA 2WK8A 1CS1A 4XJOA 5BJ4A 1TOGA 4A0FA 2RFVA 1C7NA 3KGWA 3AATA 2ZSLA 4RLGA 3QI6A 4LC3A 1DJEA 3MBBA 3AEOA 2VLFA 4F5LA 2CY8A 1KMJA 3AELA 3DR7A 1D7RA 7AATA 1B5OA 2C0RA 2C81A 2YRIA 3E77A 5DJ1A 5G2QA 1OATA 3USFA 3AEMA 3WGBA 2VGWA 5FT6A 3PD6A 4A6RA 2W7LA 1M4NA 3JWAA 4AZKA 1BJWA 2YKUA 3L44A 4JEXA 4Q75A 4UOYA 1IX6A 2YCTA 4WYEA 1YJZA 1RVUA 2BHXA 2X5FA 3MADA 3COGA 3JZLA 2GMUA 1AIAA 1YIYA 3FFHA 1OHWA 3W1HA 2CSTA 1I29A 2R2NA 5E5IA 4IYOA 3TQXA 1TOEA 1B9HA 1AHXA 1AKBA 5K8BA 1MAQA 4UHNA 1AAWA 1MAPA 3KGXA 4WBTA 4ATQA 5M4BA 4ZDLA 2VMYA 3FRKA 2DGKA 4K2MA 1BJNA 2ORDA 1YAAA 2G6WA 2W7GA 2EO5A 3ASBA 3NDNA 4GE7A 1AIBA 4H51A 4N0BA 3E6GA 4BMKA 3N4SA 3F6TA 3B1EA 2R5EA 4U1TA 1C7GA 4FFCA 2WKAA 1BT4A 4JEWA 1X29A 3G0TA 4A0RA 2FKIA 1TOIA 5EQCA 8AATA 5HXXA 3D6KA 4BQ0A 3FSLA 1XI9A 3PA9A 4WXBA 4UHMA 4EU1A 1ARHA 1O61A 1W7MA 5FT8A 5EIGB 4WLHA 2HUFA 4HVKA 1D7SA 2C44A 4CVQA 2QBTA 3DZZA 3A9ZA 3GZCA 5G4JA 2HP1A 5EUEA 3AEJA 4ZASA 4DBCA 3LVJA 3RBLA 1ASFA 1BS0A 4IXSA 3MAFB 2FN6A 2W8JA 4XJMA 2XBNA 2OGAA 4O6ZA 2QB2A 2X3LA 3AEJC 1JF9A 4ISYA 1IJIA 4WB0A 1JS3A 3JWBA 2Z9UA 3PDBB 1VEFA 2VI9A 4OTLA 3ZRQA 4ZDPA 4J5UA 2DR1A 9AATA 2VYCA 1VJOA 3H7FA 2OKKA 1LS3A 1S06A 2EPJA 1GC4A 1V2EA 4ZSWA 2O7CA 1RVYA 2BKWA 2HORA 1ASAA 1IAXA 2DGLA 3LG0A 3GR9A 3FZ7A 5DB5A 1KMKA 4F5JA 2VMNA 4QGRA 4EB5A 2DKJA 4GDYA 3B8XA 4A00A 2CANA 4AZJA 1M32A 2VMPA 4E3RA 4F5GA 1ASDA 5LHAA 2HOYA 4OT8A 3RI6A 3IHJA 4UHOA 4OBUA 4U2HA 3F0HA 4E77A 3A2BA 1ZC9A 4F4EA 1SZKA 1EQBA 3G8MA 1ASGA 4WYCA 1GEWA 3PAAA 3PIUA 3NYUA 1ASLA 2Z67A 2O1BA 1AMAA 1AICA 2VIBA 4TN4A 5IWQA 1EG5A 2D65A 2DOUA 4MQQA 4LW2A 4PFFA 5J8QA 3AV7A 3UWCA 4F5HA 3BB8A 4ZDOA 5E4ZA 3FQ7A 1B5PA 4M2JA 2AY3A 2CINA 1FG3A 2E7UA 3EI5A 3I16A 2YKXA 2ZUKA 1BW0A 3PJ0A 3H14A 3FZ6A 1ZODA 1LC7A 2D5YA 3AENA 3WLXA 1GC2A 3DYDA 1D7UA 1S07A 2AY9A 2VMZA 1GDEA 4R8DA 1U08A 2E7IA 4PIWA 4PFNA 4EMYA 3CQ6A 2BI5A 1GEYA 4MSOA 4ADBA 5JAYA 1YOOA 1MDOA 1ASMA 1QIRA 1BJOB 4BHDA 1E5EA 3HL2A 1CZCA 3FTBA 4OBVA 1YIZA 3TATA 3NUIA 2BIEA 3P1TA 4P7YA 1AMQA 4GEBA 4JEYA 1DJ9A 4B9BA 2VMUA 5HDMA 1ASBA 3FQAA 2R5CA 3ELEA 1TATA 2GMSA 2X5DA 4F5IA 4XJPA 1KL1A 3PDXA 2DKBA 1N31A 4ZAHA 1JS6A 1O62A 3LVMA 3RCHB 1X0MA 2CJHA 4BA4A 4OYTA 4F5MA 4W1VA 2E7JA 2ZY3A 1KL2A 2W8TA 3FD0A 1QISA 1AMSA 1AAMA 1Y4IA 2VGUA 3BWNC 3ZZKA 4UQVA 1C7OA 3ATHA 2BI9A 4MQRA 5I92A 1ARIA 4A72A 4RKCA 4E1OA 2R0TA 2QLRA 4ITXA 1M0QA 1AKAA 3FFRA 2EGYA 1MDZA 2CH2A 4AOAA 1O4SA 2AY4A 1M0NA 3G7QA 1ELUA 3K7YA 4WXGA 1UU0A 4ATPA 2ZY2A 4JEZA 1G7XA 1H1CA 3NU7A 1TASA 3FZ8A 4GE9A 4WYGA 4F5FA 2GQNA 4K05A 1PMOA 3RQ1A 1CZEA 2D66A 4ADDA 3DXWA 3N7NA 1JG8A 2CH1A 4Q6RA 3FDDA 1OXOA 1Z7DA 3K40A 3WCNA 2G7JA 5HHYA 3NYSA 3M5UA 1WYVB 3P6KA 4ZM4A 3GZDC 2JG2A 2HUUA 1AKCA 1ASEA 1BJOA 1CL1A 1FG7A 4I8AA 1YJSA 4XAUA 4Y0HA 4AH3A 5KTBA 3TFUA 2D64A 2BI3A 3AEMC 3L8AA 4M2MA 1AHGA 2VLHA 2Z9XA 1IX7A 2VGVA 1AMRA 4TMRA 2YOBA 3B1DA 1RV4A 1UU1A 3DR4A 4ADCA 3H9XA 2BYLA 3FQ8A 3KKIA 2WK7A 5EFSA 4RJYA 2W8UA 3CQ5A 1SZUA 3DRDA 3DU4A 3AOWA 2FNUA 1M7YA 2C7TA 2AEUA 2Z9WA 1V72A 3MAUA 4JF0A 1S08A 1DKAA 5EUDA 1Z3ZA 3VK4A 2WB6A 5BJ3A 2Z9VA 2BWOA 3LV2A 1B8GA 4CXQA 2FNIA 3II0A 1I48A 3JW9A 1QJ3A 2VGZA 1OHVA 3A9XA 4IXZA 4ZWMA 4CBSA 2VMQA 2W7KA 2HOZA 4Q31A 3ELPA 2VMRA 3VK3A 4XK1A 4ITGA 3FVXA 4L0OA 4CXRA 5FT5A 4DGTA 3PGYA 3DXVA 1IBJA 4GRXA 1MLZA 3JU7A 1PFFA 2BWNA 1SPAA 1AX4A 3BV0A 1X2AA 1IUGA 3QHXA 3AOVA 2FQ6A 1AHFA 2VMSA 3IF2A 1LW4A 1G4XA 2BI2A 4PVFA 4WP0A 2W7DA 3NUBA 2ZY5A 4LNMA 3EI6A 4RAEA 4WYFA 2X8UA 3WY7A 3LVLB 2YHKA 3N5MA 3RCHA 2QSRA 2AY2A 3W1IA 1XEYA 4IYOB 1ECXA 3ECDA 1CQ7A 2ZC0A 2W7EA 1QITA 3NU8A 1CJ0A 5DX5A 3QGUA 2HP2A 2AY7A 4ZLVA 1C4KA 2BYJA 3R4TA 4KAMA 1AHEA 1H0CA 1SZSA 1W7LA 2D7YA 4WD2A 3WGCA 4AO4A 1LC5A 3WKRA 4IXOA 3WZFA 3QM2A 3ZRPA 2QB3A 1D2FA 3AENB 2Z1ZA 2JJGA 3LWSA 1AY4A 3DODA 3CBFA 3MC6C 3QBOA 5LH9A 5F8VA 2ZY4A 2QA3A 1BQDA 1OHYA 3MAFA 2E54A 4GSAA 3A9YA 4W1WA 2OKJA 4JE5A 4BA5A 1GEXA 5D5SA 3MC6A 1CL2A 3RUYA 3HBXA 3ZZJA 4P3MA 3HQTA 3HT4A 4OMAA 2NMPA 3EI8A 1AJRA 2GB3A 1B9IA 3FCRA 3GZDA 1TARA 3E9KA 2VMTA 2EZ2A 3PD6B 3R9AA 4Y0IA 3FVUA 1ARSA 4N0WA 2YRRA 2CJDA 2W7JA 4LW4A 2R5CB 3BN1A 3VOMA 4F5KA 4LNJA 2VMVA 1QZ9A 1UKJA 2Q7WA 3BCXA 1ARGA 4FL0A 1WYUA 1G7WA 1RV3A 2JJEA 4RM1A 4WYDA 3HMUA 4ZM3A 3MKJA 1ARTA 3B46A 1WYTB 3B1CA 3NX3A 5G09A 1MGVA 4Q76A 2F8JA 1DGEA 1QJ5A 4ADEA 4EB7A 5EUNA 3WX9A 2JISA 2OQXA 4A0GA 5G2PA 4MKKA 3N0LA 3WCOA 1V2FA 1DGDA 2QMAA 3QPGA 4TV7A 1AHYA 3EUCA 5M4DA 5M49A 3CAIA 3UE8A 3BC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VK2 A;  5TF5 A;  5EAA A;  2AAT A;  1GC0 A;  3Q8N A;  4GE4 A;  4ZSY A;  4KYO A;  4W1X A;  3T32 A;  1W23 A;  4CBR A;  1N2T A;  3VP6 A;  1WYT A;  2W7F A;  4MQP A;  1AJS A;  3TFT A;  1IVR A;  2VIA A;  4A6T A;  3GET A;  1YNU A;  3BCB A;  3FDB A;  2YCP A;  1G4V A;  1WYV A;  1MDX A;  1GCK A;  2WK9 A;  3EI9 A;  3OP7 A;  1GC3 A;  3I5T A;  1OXP A;  2BI1 A;  4W5K A;  2VI8 A;  3GSB A;  1P3W A;  4R5Z A;  4JF1 A;  2O0R A;  3NTJ A;  4MY5 A;  1W3U A;  1B4X A;  1DJU A;  2EZ1 A;  1J04 A;  2ZYJ A;  1N8P A;  1I43 A;  2VGS A;  4RJ0 A;  2CB1 A;  1LK9 A;  3BWN A;  4OCA A;  1ORD A;  2W7I A;  2W7H A;  1IX8 A;  1M0O A;  1O69 A;  4WYA A;  1E5F A;  3QN6 A;  3WKS A;  2CTZ A;  4Y0D A;  1ASN A;  1YJY A;  4EFF A;  4W8I A;  3DC1 A;  2JGT A;  2ZSM A;  3RBF A;  5EIG A;  1SVV A;  4LNL A;  5M46 A;  1LC8 A;  4JE5 D;  1ELQ A;  2CJG A;  3NNK A;  3TCM A;  1BJ4 A;  3KE3 A;  3VAX A;  1ASC A;  2W8V A;  3NRA A;  3EZ1 A;  1AY5 A;  3CQ4 A;  2CFB A;  2D63 A;  4E3Q A;  1CQ8 A;  3OKS A;  2JJF A;  1T3I A;  2W8W A;  4WXF A;  3MEB A;  3E2Z A;  3PDB A;  4OC9 A;  2OAT A;  2W7M A;  1PG8 A;  3E2Z B;  2PB2 A;  3N75 A;  2BWP A;  4W91 A;  3A8U X;  5E3K A;  1LW5 A;  2Z1Y A;  1KKP A;  1AJS B;  1AY8 A;  4XQ2 A;  1MLY A;  3BS8 A;  2ZJG A;  1S0A A;  2BIG A;  2Z20 A;  1DFO A;  2BIA A;  4K2B A;  2AY8 A;  2VMX A;  3E2F A;  3JTX A;  1I41 A;  1S09 A;  1TPL A;  4MGR A;  1CQ6 A;  3ASA A;  1WKH A;  2VMW A;  3GBX A;  1BKG A;  2HUI A;  1M6S A;  1IAY A;  4A0H A;  2GSA A;  1WYU B;  1ZOB A;  3PPL A;  4NOG A;  1VP4 A;  3K28 A;  4A6U A;  1PMM A;  2JJH A;  2XH1 A;  3GJU A;  4MKJ A;  1V2D A;  1FC4 A;  1QGN A;  1BQA A;  2VGT A;  3BCA A;  4WLJ A;  1GD9 A;  3ACZ A;  3FVS A;  4K2I A;  5DJ9 A;  2AY5 A;  2V0Y A;  4IX8 A;  4JEV A;  3EIA A;  3UAK A;  1C0N A;  2Z61 A;  5AX8 A;  4M2K A;  5G4I A;  4R5F A;  3EZS A;  3FKD A;  1J32 A;  1C9C A;  1EJI A;  3HDO A;  3GWP A;  3LY1 A;  2AY1 A;  1KKJ A;  2V1P A;  3BWO A;  2D7Z A;  2YKV A;  5FT4 A;  2AEV A;  4ZWV A;  1UU2 A;  3F9T A;  2FYF A;  3HVY A;  3LVK A;  3I4J A;  3ISL A;  2TPL A;  1W7N A;  4DQ6 A;  2AY6 A;  3HLM A;  3NYT A;  4RIZ A;  4RKD A;  5G0A A;  2VMO A;  4R2N A;  4B98 A;  2DGM A;  1TOK A;  3W1J A;  4HF8 A;  1M0P A;  2YKY A;  1WST A;  3EI7 A;  5D95 A;  1DTY A;  3ZRR A;  1WKG A;  5F9S A;  4J8L A;  1TOJ A;  2HZP A;  4RIT A;  1SF2 A;  2FM1 A;  2PB0 A;  1LKC A;  2ZP7 A;  3E2Y A;  4WB0 B;  2D61 A;  1GBN A;  1SFF A;  4IY7 A;  4KXK A;  5EAV A;  4IW7 A;  2HOX A;  2OGE A;  3EIB A;  4XJL A;  1X28 A;  4AO9 A;  2PO3 A;  2YCN A;  5C6U A;  2EH6 A;  4XEW A;  3AEP A;  1D7V A;  2WK8 A;  1CS1 A;  4XJO A;  5BJ4 A;  1TOG A;  4A0F A;  2RFV A;  1C7N A;  3KGW A;  3AAT A;  2ZSL A;  4RLG A;  3QI6 A;  4LC3 A;  1DJE A;  3MBB A;  3AEO A;  2VLF A;  4F5L A;  2CY8 A;  1KMJ A;  3AEL A;  3DR7 A;  1D7R A;  7AAT A;  1B5O A;  2C0R A;  2C81 A;  2YRI A;  3E77 A;  5DJ1 A;  5G2Q A;  1OAT A;  3USF A;  3AEM A;  3WGB A;  2VGW A;  5FT6 A;  3PD6 A;  4A6R A;  2W7L A;  1M4N A;  3JWA A;  4AZK A;  1BJW A;  2YKU A;  3L44 A;  4JEX A;  4Q75 A;  4UOY A;  1IX6 A;  2YCT A;  4WYE A;  1YJZ A;  1RVU A;  2BHX A;  2X5F A;  3MAD A;  3COG A;  3JZL A;  2GMU A;  1AIA A;  1YIY A;  3FFH A;  1OHW A;  3W1H A;  2CST A;  1I29 A;  2R2N A;  5E5I A;  4IYO A;  3TQX A;  1TOE A;  1B9H A;  1AHX A;  1AKB A;  5K8B A;  1MAQ A;  4UHN A;  1AAW A;  1MAP A;  3KGX A;  4WBT A;  4ATQ A;  5M4B A;  4ZDL A;  2VMY A;  3FRK A;  2DGK A;  4K2M A;  1BJN A;  2ORD A;  1YAA A;  2G6W A;  2W7G A;  2EO5 A;  3ASB A;  3NDN A;  4GE7 A;  1AIB A;  4H51 A;  4N0B A;  3E6G A;  4BMK A;  3F6T A;  3B1E A;  2R5E A;  4U1T A;  1C7G A;  4FFC A;  2WKA A;  1BT4 A;  4JEW A;  1X29 A;  3G0T A;  4A0R A;  1TOI A;  5EQC A;  8AAT A;  5HXX A;  3D6K A;  4BQ0 A;  3FSL A;  1XI9 A;  3PA9 A;  4WXB A;  4UHM A;  4EU1 A;  1ARH A;  1O61 A;  1W7M A;  5FT8 A;  5EIG B;  4WLH A;  2HUF A;  4HVK A;  1D7S A;  2C44 A;  4CVQ A;  2QBT A;  3DZZ A;  3A9Z A;  3GZC A;  5G4J A;  2HP1 A;  5EUE A;  3AEJ A;  4ZAS A;  4DBC A;  3LVJ A;  3RBL A;  1ASF A;  1BS0 A;  4IXS A;  3MAF B;  2FN6 A;  2W8J A;  4XJM A;  2XBN A;  2OGA A;  4O6Z A;  2QB2 A;  2X3L A;  3AEJ C;  1JF9 A;  4ISY A;  1IJI A;  4WB0 A;  1JS3 A;  3JWB A;  2Z9U A;  3PDB B;  1VEF A;  2VI9 A;  4OTL A;  3ZRQ A;  4ZDP A;  4J5U A;  2DR1 A;  9AAT A;  2VYC A;  1VJO A;  3H7F A;  2OKK A;  1LS3 A;  1S06 A;  2EPJ A;  1GC4 A;  1V2E A;  4ZSW A;  2O7C A;  1RVY A;  2BKW A;  2HOR A;  1ASA A;  1IAX A;  2DGL A;  3LG0 A;  3GR9 A;  3FZ7 A;  5DB5 A;  1KMK A;  4F5J A;  2VMN A;  4QGR A;  4EB5 A;  2DKJ A;  4GDY A;  3B8X A;  4A00 A;  2CAN A;  4AZJ A;  1M32 A;  2VMP A;  4E3R A;  4F5G A;  1ASD A;  5LHA A;  2HOY A;  4OT8 A;  3RI6 A;  3IHJ A;  4UHO A;  4OBU A;  4U2H A;  3F0H A;  4E77 A;  3A2B A;  1ZC9 A;  4F4E A;  1SZK A;  1EQB A;  3G8M A;  1ASG A;  4WYC A;  1GEW A;  3PAA A;  3PIU A;  3NYU A;  1ASL A;  2Z67 A;  2O1B A;  1AMA A;  1AIC A;  2VIB A;  4TN4 A;  5IWQ A;  1EG5 A;  2D65 A;  2DOU A;  4MQQ A;  4LW2 A;  4PFF A;  5J8Q A;  3AV7 A;  3UWC A;  4F5H A;  3BB8 A;  4ZDO A;  5E4Z A;  3FQ7 A;  1B5P A;  4M2J A;  2AY3 A;  2CIN A;  1FG3 A;  2E7U A;  3EI5 A;  3I16 A;  2YKX A;  2ZUK A;  1BW0 A;  3PJ0 A;  3H14 A;  3FZ6 A;  1ZOD A;  1LC7 A;  2D5Y A;  3AEN A;  3WLX A;  1GC2 A;  3DYD A;  1D7U A;  1S07 A;  2AY9 A;  2VMZ A;  1GDE A;  4R8D A;  1U08 A;  2E7I A;  4PIW A;  4PFN A;  4EMY A;  3CQ6 A;  2BI5 A;  1GEY A;  4MSO A;  4ADB A;  5JAY A;  1YOO A;  1MDO A;  1ASM A;  1QIR A;  1BJO B;  4BHD A;  1E5E A;  3HL2 A;  1CZC A;  3FTB A;  4OBV A;  1YIZ A;  3TAT A;  3NUI A;  2BIE A;  3P1T A;  4P7Y A;  1AMQ A;  4GEB A;  4JEY A;  1DJ9 A;  4B9B A;  2VMU A;  5HDM A;  1ASB A;  3FQA A;  2R5C A;  3ELE A;  1TAT A;  2GMS A;  2X5D A;  4F5I A;  4XJP A;  1KL1 A;  3PDX A;  2DKB A;  1N31 A;  4ZAH A;  1JS6 A;  1O62 A;  3LVM A;  3RCH B;  1X0M A;  2CJH A;  4BA4 A;  4OYT A;  4F5M A;  4W1V A;  2E7J A;  2ZY3 A;  1KL2 A;  2W8T A;  3FD0 A;  1QIS A;  1AMS A;  1AAM A;  1Y4I A;  2VGU A;  3BWN C;  3ZZK A;  4UQV A;  1C7O A;  3ATH A;  2BI9 A;  4MQR A;  5I92 A;  1ARI A;  4A72 A;  4RKC A;  4E1O A;  2R0T A;  2QLR A;  4ITX A;  1M0Q A;  1AKA A;  3FFR A;  2EGY A;  1MDZ A;  2CH2 A;  4AOA A;  1O4S A;  2AY4 A;  1M0N A;  3G7Q A;  1ELU A;  3K7Y A;  4WXG A;  1UU0 A;  4ATP A;  2ZY2 A;  4JEZ A;  1G7X A;  1H1C A;  3NU7 A;  1TAS A;  3FZ8 A;  4GE9 A;  4WYG A;  4F5F A;  2GQN A;  1PMO A;  3RQ1 A;  1CZE A;  2D66 A;  4ADD A;  3DXW A;  1JG8 A;  2CH1 A;  4Q6R A;  3FDD A;  1OXO A;  1Z7D A;  3K40 A;  3WCN A;  5HHY A;  3NYS A;  3M5U A;  1WYV B;  3P6K A;  4ZM4 A;  3GZD C;  2JG2 A;  2HUU A;  1AKC A;  1ASE A;  1BJO A;  1CL1 A;  1FG7 A;  4I8A A;  1YJS A;  4XAU A;  4Y0H A;  4AH3 A;  3TFU A;  2D64 A;  2BI3 A;  3AEM C;  3L8A A;  4M2M A;  1AHG A;  2VLH A;  2Z9X A;  1IX7 A;  2VGV A;  1AMR A;  4TMR A;  2YOB A;  3B1D A;  1RV4 A;  1UU1 A;  3DR4 A;  4ADC A;  2BYL A;  3FQ8 A;  3KKI A;  2WK7 A;  5EFS A;  4RJY A;  2W8U A;  3CQ5 A;  1SZU A;  3DRD A;  3DU4 A;  3AOW A;  2FNU A;  1M7Y A;  2C7T A;  2AEU A;  2Z9W A;  1V72 A;  3MAU A;  4JF0 A;  1S08 A;  1DKA A;  5EUD A;  1Z3Z A;  3VK4 A;  5BJ3 A;  2Z9V A;  2BWO A;  3LV2 A;  1B8G A;  4CXQ A;  2FNI A;  3II0 A;  1I48 A;  3JW9 A;  1QJ3 A;  2VGZ A;  1OHV A;  3A9X A;  4IXZ A;  4ZWM A;  4CBS A;  2VMQ A;  2W7K A;  2HOZ A;  4Q31 A;  3ELP A;  2VMR A;  3VK3 A;  4XK1 A;  4ITG A;  3FVX A;  4L0O A;  4CXR A;  5FT5 A;  4DGT A;  3PGY A;  3DXV A;  1IBJ A;  4GRX A;  1MLZ A;  3JU7 A;  1PFF A;  2BWN A;  1SPA A;  1AX4 A;  3BV0 A;  1X2A A;  1IUG A;  3QHX A;  3AOV A;  2FQ6 A;  1AHF A;  2VMS A;  3IF2 A;  1LW4 A;  1G4X A;  2BI2 A;  4PVF A;  4WP0 A;  2W7D A;  3NUB A;  2ZY5 A;  4LNM A;  3EI6 A;  4RAE A;  4WYF A;  2X8U A;  3WY7 A;  3LVL B;  2YHK A;  3N5M A;  3RCH A;  2AY2 A;  3W1I A;  1XEY A;  4IYO B;  1ECX A;  3ECD A;  1CQ7 A;  2ZC0 A;  2W7E A;  1QIT A;  3NU8 A;  1CJ0 A;  5DX5 A;  3QGU A;  2HP2 A;  2AY7 A;  4ZLV A;  1C4K A;  2BYJ A;  3R4T A;  4KAM A;  1AHE A;  1H0C A;  1SZS A;  1W7L A;  2D7Y A;  4WD2 A;  3WGC A;  4AO4 A;  1LC5 A;  3WKR A;  4IXO A;  3WZF A;  3QM2 A;  3ZRP A;  2QB3 A;  1D2F A;  3AEN B;  2Z1Z A;  2JJG A;  3LWS A;  1AY4 A;  3DOD A;  3CBF A;  3MC6 C;  3QBO A;  5LH9 A;  5F8V A;  2ZY4 A;  2QA3 A;  1BQD A;  1OHY A;  3MAF A;  2E54 A;  4GSA A;  3A9Y A;  4W1W A;  2OKJ A;  4JE5 A;  4BA5 A;  1GEX A;  5D5S A;  3MC6 A;  1CL2 A;  3RUY A;  3HBX A;  3ZZJ A;  4P3M A;  3HQT A;  3HT4 A;  4OMA A;  2NMP A;  3EI8 A;  1AJR A;  2GB3 A;  1B9I A;  3FCR A;  3GZD A;  1TAR A;  3E9K A;  2VMT A;  2EZ2 A;  3PD6 B;  3R9A A;  4Y0I A;  3FVU A;  1ARS A;  4N0W A;  2YRR A;  2CJD A;  2W7J A;  4LW4 A;  2R5C B;  3BN1 A;  3VOM A;  4F5K A;  4LNJ A;  2VMV A;  1QZ9 A;  1UKJ A;  2Q7W A;  3BCX A;  1ARG A;  4FL0 A;  1WYU A;  1G7W A;  1RV3 A;  2JJE A;  4RM1 A;  4WYD A;  3HMU A;  4ZM3 A;  3MKJ A;  1ART A;  3B46 A;  1WYT B;  3B1C A;  3NX3 A;  5G09 A;  1MGV A;  4Q76 A;  2F8J A;  1DGE A;  1QJ5 A;  4ADE A;  4EB7 A;  5EUN A;  3WX9 A;  2JIS A;  2OQX A;  4A0G A;  5G2P A;  4MKK A;  3N0L A;  3WCO A;  1V2F A;  1DGD A;  2QMA A;  3QPG A;  4TV7 A;  1AHY A;  3EUC A;  5M4D A;  5M49 A;  3CAI A;  3UE8 A;  3BC8 A; 
#chains in the Genus database with same CATH topology
 3VK2 A;  5TF5 A;  5EAA A;  2AAT A;  1GC0 A;  3Q8N A;  4GE4 A;  4ZSY A;  4KYO A;  4W1X A;  3T32 A;  1W23 A;  4CBR A;  1N2T A;  3VP6 A;  1WYT A;  2W7F A;  4MQP A;  1AJS A;  3TFT A;  1IVR A;  2VIA A;  4A6T A;  3GET A;  1YNU A;  3BCB A;  3FDB A;  2YCP A;  1G4V A;  1WYV A;  1MDX A;  1GCK A;  2WK9 A;  3EI9 A;  3OP7 A;  1GC3 A;  3I5T A;  1OXP A;  2BI1 A;  4W5K A;  2VI8 A;  3GSB A;  1P3W A;  4R5Z A;  2KFP A;  4JF1 A;  2EYQ A;  2O0R A;  3NTJ A;  4MY5 A;  1W3U A;  1B4X A;  1DJU A;  2EZ1 A;  1J04 A;  2ZYJ A;  1N8P A;  1I43 A;  2VGS A;  4RJ0 A;  2CB1 A;  1LK9 A;  3BWN A;  4OCA A;  1ORD A;  2W7I A;  2W7H A;  1IX8 A;  1M0O A;  1O69 A;  4WYA A;  1E5F A;  3QN6 A;  3WKS A;  2CTZ A;  4Y0D A;  1ASN A;  1YJY A;  4EFF A;  4W8I A;  3DC1 A;  2JGT A;  2ZSM A;  3RBF A;  5EIG A;  1SVV A;  4LNL A;  5M46 A;  1LC8 A;  4JE5 D;  1ELQ A;  2CJG A;  3NNK A;  3TCM A;  1BJ4 A;  3KE3 A;  3VAX A;  1ASC A;  2W8V A;  3NRA A;  3N4R A;  3EZ1 A;  1AY5 A;  3CQ4 A;  2CFB A;  2D63 A;  4E3Q A;  1CQ8 A;  3OKS A;  2JJF A;  1T3I A;  2W8W A;  4WXF A;  3N4X A;  3MEB A;  3E2Z A;  3PDB A;  4OC9 A;  2OAT A;  2W7M A;  1PG8 A;  3E2Z B;  2PB2 A;  3N75 A;  2BWP A;  4W91 A;  3A8U X;  5E3K A;  1LW5 A;  2Z1Y A;  1KKP A;  1AJS B;  1AY8 A;  4XQ2 A;  1MLY A;  3BS8 A;  2ZJG A;  1S0A A;  2BIG A;  2Z20 A;  1DFO A;  2BIA A;  4K2B A;  2AY8 A;  2VMX A;  3E2F A;  3JTX A;  1I41 A;  1S09 A;  1TPL A;  4MGR A;  1CQ6 A;  3ASA A;  1WKH A;  2VMW A;  3GBX A;  1BKG A;  2HUI A;  1M6S A;  1IAY A;  4A0H A;  2GSA A;  1WYU B;  1ZOB A;  3PPL A;  4NOG A;  1VP4 A;  3K28 A;  4A6U A;  1PMM A;  2JJH A;  2XH1 A;  3GJU A;  4MKJ A;  1V2D A;  1FC4 A;  1QGN A;  1BQA A;  2VGT A;  3BCA A;  4WLJ A;  1GD9 A;  3ACZ A;  3FVS A;  4K2I A;  5DJ9 A;  2AY5 A;  2V0Y A;  4IX8 A;  4JEV A;  3EIA A;  3UAK A;  1C0N A;  2Z61 A;  5AX8 A;  4M2K A;  4H63 Q;  5G4I A;  4R5F A;  3EZS A;  3FKD A;  1J32 A;  1C9C A;  1EJI A;  3HDO A;  3GWP A;  3LY1 A;  2AY1 A;  1KKJ A;  2V1P A;  3BWO A;  2D7Z A;  2YKV A;  5FT4 A;  2AEV A;  4ZWV A;  1UU2 A;  3F9T A;  2FYF A;  3HVY A;  3LVK A;  3I4J A;  3ISL A;  2TPL A;  1W7N A;  4DQ6 A;  2AY6 A;  3HLM A;  3NYT A;  4RIZ A;  4RKD A;  5G0A A;  2VMO A;  4R2N A;  4B98 A;  2DGM A;  1TOK A;  3W1J A;  4HF8 A;  1M0P A;  2YKY A;  1WST A;  3EI7 A;  5D95 A;  1DTY A;  3ZRR A;  2A1V A;  1WKG A;  5F9S A;  4J8L A;  1TOJ A;  2HZP A;  4RIT A;  1SF2 A;  2FM1 A;  2PB0 A;  1LKC A;  2ZP7 A;  3E2Y A;  4WB0 B;  2D61 A;  1GBN A;  1SFF A;  4IY7 A;  4KXK A;  5EAV A;  4IW7 A;  2HOX A;  2OGE A;  3EIB A;  4XJL A;  1X28 A;  4AO9 A;  2PO3 A;  2YCN A;  5C6U A;  2EH6 A;  4XEW A;  3AEP A;  1D7V A;  2WK8 A;  1CS1 A;  4XJO A;  5BJ4 A;  1TOG A;  4A0F A;  2RFV A;  1C7N A;  3KGW A;  3AAT A;  2ZSL A;  4RLG A;  3QI6 A;  4LC3 A;  1DJE A;  3MBB A;  3AEO A;  2VLF A;  4F5L A;  2CY8 A;  1KMJ A;  3AEL A;  3DR7 A;  1D7R A;  7AAT A;  1B5O A;  2C0R A;  2C81 A;  2YRI A;  3E77 A;  5DJ1 A;  5G2Q A;  1OAT A;  3USF A;  3AEM A;  3WGB A;  2VGW A;  5FT6 A;  3PD6 A;  4A6R A;  2W7L A;  1M4N A;  3JWA A;  4AZK A;  1BJW A;  2YKU A;  3L44 A;  4JEX A;  4Q75 A;  4UOY A;  1IX6 A;  2YCT A;  4WYE A;  1YJZ A;  1RVU A;  2BHX A;  2X5F A;  3MAD A;  3COG A;  3JZL A;  2GMU A;  1AIA A;  1YIY A;  3FFH A;  1OHW A;  3W1H A;  2CST A;  1I29 A;  2R2N A;  5E5I A;  4IYO A;  3TQX A;  1TOE A;  1B9H A;  1AHX A;  1AKB A;  5K8B A;  1MAQ A;  4UHN A;  1AAW A;  1MAP A;  3KGX A;  4WBT A;  4ATQ A;  5M4B A;  4ZDL A;  2VMY A;  3FRK A;  2DGK A;  4K2M A;  1BJN A;  2ORD A;  1YAA A;  2G6W A;  2W7G A;  2EO5 A;  3ASB A;  3NDN A;  4GE7 A;  1AIB A;  4H51 A;  4N0B A;  3E6G A;  4BMK A;  3N4S A;  3F6T A;  3B1E A;  2R5E A;  4U1T A;  1C7G A;  4FFC A;  2WKA A;  1BT4 A;  4JEW A;  1X29 A;  3G0T A;  4A0R A;  2FKI A;  1TOI A;  5EQC A;  8AAT A;  5HXX A;  3D6K A;  4BQ0 A;  3FSL A;  1XI9 A;  3PA9 A;  4WXB A;  4UHM A;  4EU1 A;  1ARH A;  1O61 A;  1W7M A;  5FT8 A;  5EIG B;  4WLH A;  2HUF A;  4HVK A;  1D7S A;  2C44 A;  4CVQ A;  2QBT A;  3DZZ A;  3A9Z A;  3GZC A;  5G4J A;  2HP1 A;  5EUE A;  3AEJ A;  4ZAS A;  4DBC A;  3LVJ A;  3RBL A;  1ASF A;  1BS0 A;  4IXS A;  3MAF B;  2FN6 A;  2W8J A;  4XJM A;  2XBN A;  2OGA A;  4O6Z A;  2QB2 A;  2X3L A;  3AEJ C;  1JF9 A;  4ISY A;  1IJI A;  4WB0 A;  1JS3 A;  3JWB A;  2Z9U A;  3PDB B;  1VEF A;  2VI9 A;  4OTL A;  3ZRQ A;  4ZDP A;  4J5U A;  2DR1 A;  9AAT A;  2VYC A;  1VJO A;  3H7F A;  2OKK A;  1LS3 A;  1S06 A;  2EPJ A;  1GC4 A;  1V2E A;  4ZSW A;  2O7C A;  1RVY A;  2BKW A;  2HOR A;  1ASA A;  1IAX A;  2DGL A;  3LG0 A;  3GR9 A;  3FZ7 A;  5DB5 A;  1KMK A;  4F5J A;  2VMN A;  4QGR A;  4EB5 A;  2DKJ A;  4GDY A;  3B8X A;  4A00 A;  2CAN A;  4AZJ A;  1M32 A;  2VMP A;  4E3R A;  4F5G A;  1ASD A;  5LHA A;  2HOY A;  4OT8 A;  3RI6 A;  3IHJ A;  4UHO A;  4OBU A;  4U2H A;  3F0H A;  4E77 A;  3A2B A;  1ZC9 A;  4F4E A;  1SZK A;  1EQB A;  3G8M A;  1ASG A;  4WYC A;  1GEW A;  3PAA A;  3PIU A;  3NYU A;  1ASL A;  2Z67 A;  2O1B A;  1AMA A;  1AIC A;  2VIB A;  4TN4 A;  5IWQ A;  1EG5 A;  2D65 A;  2DOU A;  4MQQ A;  4LW2 A;  4PFF A;  5J8Q A;  3AV7 A;  3UWC A;  4F5H A;  3BB8 A;  4ZDO A;  5E4Z A;  3FQ7 A;  1B5P A;  4M2J A;  2AY3 A;  2CIN A;  1FG3 A;  2E7U A;  3EI5 A;  3I16 A;  2YKX A;  2ZUK A;  1BW0 A;  3PJ0 A;  3H14 A;  3FZ6 A;  1ZOD A;  1LC7 A;  2D5Y A;  3AEN A;  3WLX A;  1GC2 A;  3DYD A;  1D7U A;  1S07 A;  2AY9 A;  2VMZ A;  1GDE A;  4R8D A;  1U08 A;  2E7I A;  4PIW A;  4PFN A;  4EMY A;  3CQ6 A;  2BI5 A;  1GEY A;  4MSO A;  4ADB A;  5JAY A;  1YOO A;  1MDO A;  1ASM A;  1QIR A;  1BJO B;  4BHD A;  1E5E A;  3HL2 A;  1CZC A;  3FTB A;  4OBV A;  1YIZ A;  3TAT A;  3NUI A;  2BIE A;  3P1T A;  4P7Y A;  1AMQ A;  4GEB A;  4JEY A;  1DJ9 A;  4B9B A;  2VMU A;  5HDM A;  1ASB A;  3FQA A;  2R5C A;  3ELE A;  1TAT A;  2GMS A;  2X5D A;  4F5I A;  4XJP A;  1KL1 A;  3PDX A;  2DKB A;  1N31 A;  4ZAH A;  1JS6 A;  1O62 A;  3LVM A;  3RCH B;  1X0M A;  2CJH A;  4BA4 A;  4OYT A;  4F5M A;  4W1V A;  2E7J A;  2ZY3 A;  1KL2 A;  2W8T A;  3FD0 A;  1QIS A;  1AMS A;  1AAM A;  1Y4I A;  2VGU A;  3BWN C;  3ZZK A;  4UQV A;  1C7O A;  3ATH A;  2BI9 A;  4MQR A;  5I92 A;  1ARI A;  4A72 A;  4RKC A;  4E1O A;  2R0T A;  2QLR A;  4ITX A;  1M0Q A;  1AKA A;  3FFR A;  2EGY A;  1MDZ A;  2CH2 A;  4AOA A;  1O4S A;  2AY4 A;  1M0N A;  3G7Q A;  1ELU A;  3K7Y A;  4WXG A;  1UU0 A;  4ATP A;  2ZY2 A;  4JEZ A;  1G7X A;  1H1C A;  3NU7 A;  1TAS A;  3FZ8 A;  4GE9 A;  4WYG A;  4F5F A;  2GQN A;  4K05 A;  1PMO A;  3RQ1 A;  1CZE A;  2D66 A;  4ADD A;  3DXW A;  3N7N A;  1JG8 A;  2CH1 A;  4Q6R A;  3FDD A;  1OXO A;  1Z7D A;  3K40 A;  3WCN A;  2G7J A;  5HHY A;  3NYS A;  3M5U A;  1WYV B;  3P6K A;  4ZM4 A;  3GZD C;  2JG2 A;  2HUU A;  1AKC A;  1ASE A;  1BJO A;  1CL1 A;  1FG7 A;  4I8A A;  1YJS A;  4XAU A;  4Y0H A;  4AH3 A;  5KTB A;  3TFU A;  2D64 A;  2BI3 A;  3AEM C;  3L8A A;  4M2M A;  1AHG A;  2VLH A;  2Z9X A;  1IX7 A;  2VGV A;  1AMR A;  4TMR A;  2YOB A;  3B1D A;  1RV4 A;  1UU1 A;  3DR4 A;  4ADC A;  3H9X A;  2BYL A;  3FQ8 A;  3KKI A;  2WK7 A;  5EFS A;  4RJY A;  2W8U A;  3CQ5 A;  1SZU A;  3DRD A;  3DU4 A;  3AOW A;  2FNU A;  1M7Y A;  2C7T A;  2AEU A;  2Z9W A;  1V72 A;  3MAU A;  4JF0 A;  1S08 A;  1DKA A;  5EUD A;  1Z3Z A;  3VK4 A;  2WB6 A;  5BJ3 A;  2Z9V A;  2BWO A;  3LV2 A;  1B8G A;  4CXQ A;  2FNI A;  3II0 A;  1I48 A;  3JW9 A;  1QJ3 A;  2VGZ A;  1OHV A;  3A9X A;  4IXZ A;  4ZWM A;  4CBS A;  2VMQ A;  2W7K A;  2HOZ A;  4Q31 A;  3ELP A;  2VMR A;  3VK3 A;  4XK1 A;  4ITG A;  3FVX A;  4L0O A;  4CXR A;  5FT5 A;  4DGT A;  3PGY A;  3DXV A;  1IBJ A;  4GRX A;  1MLZ A;  3JU7 A;  1PFF A;  2BWN A;  1SPA A;  1AX4 A;  3BV0 A;  1X2A A;  1IUG A;  3QHX A;  3AOV A;  2FQ6 A;  1AHF A;  2VMS A;  3IF2 A;  1LW4 A;  1G4X A;  2BI2 A;  4PVF A;  4WP0 A;  2W7D A;  3NUB A;  2ZY5 A;  4LNM A;  3EI6 A;  4RAE A;  4WYF A;  2X8U A;  3WY7 A;  3LVL B;  2YHK A;  3N5M A;  3RCH A;  2QSR A;  2AY2 A;  3W1I A;  1XEY A;  4IYO B;  1ECX A;  3ECD A;  1CQ7 A;  2ZC0 A;  2W7E A;  1QIT A;  3NU8 A;  1CJ0 A;  5DX5 A;  3QGU A;  2HP2 A;  2AY7 A;  4ZLV A;  1C4K A;  2BYJ A;  3R4T A;  4KAM A;  1AHE A;  1H0C A;  1SZS A;  1W7L A;  2D7Y A;  4WD2 A;  3WGC A;  4AO4 A;  1LC5 A;  3WKR A;  4IXO A;  3WZF A;  3QM2 A;  3ZRP A;  2QB3 A;  1D2F A;  3AEN B;  2Z1Z A;  2JJG A;  3LWS A;  1AY4 A;  3DOD A;  3CBF A;  3MC6 C;  3QBO A;  5LH9 A;  5F8V A;  2ZY4 A;  2QA3 A;  1BQD A;  1OHY A;  3MAF A;  2E54 A;  4GSA A;  3A9Y A;  4W1W A;  2OKJ A;  4JE5 A;  4BA5 A;  1GEX A;  5D5S A;  3MC6 A;  1CL2 A;  3RUY A;  3HBX A;  3ZZJ A;  4P3M A;  3HQT A;  3HT4 A;  4OMA A;  1KAF A;  2NMP A;  3EI8 A;  1AJR A;  2GB3 A;  1B9I A;  3FCR A;  3GZD A;  1TAR A;  3E9K A;  2VMT A;  2EZ2 A;  3PD6 B;  3R9A A;  4Y0I A;  3FVU A;  1ARS A;  4N0W A;  2YRR A;  2CJD A;  2W7J A;  4LW4 A;  2R5C B;  3BN1 A;  3VOM A;  4F5K A;  4LNJ A;  2VMV A;  1QZ9 A;  1UKJ A;  2Q7W A;  3BCX A;  1ARG A;  4FL0 A;  1WYU A;  1G7W A;  1RV3 A;  2JJE A;  4RM1 A;  4WYD A;  3HMU A;  4ZM3 A;  3MKJ A;  1ART A;  3B46 A;  1WYT B;  3B1C A;  3NX3 A;  5G09 A;  1MGV A;  4Q76 A;  2F8J A;  1DGE A;  1QJ5 A;  4ADE A;  4EB7 A;  5EUN A;  3WX9 A;  2JIS A;  2OQX A;  4A0G A;  5G2P A;  4MKK A;  3N0L A;  3WCO A;  1V2F A;  1DGD A;  2QMA A;  3QPG A;  4TV7 A;  1AHY A;  3EUC A;  5M4D A;  5M49 A;  3CAI A;  3UE8 A;  3BC8 A; 
#chains in the Genus database with same CATH homology
 3VK2 A;  5TF5 A;  5EAA A;  2AAT A;  1GC0 A;  3Q8N A;  4GE4 A;  4ZSY A;  4KYO A;  4W1X A;  3T32 A;  1W23 A;  4CBR A;  1N2T A;  3VP6 A;  1WYT A;  2W7F A;  4MQP A;  1AJS A;  3TFT A;  1IVR A;  2VIA A;  4A6T A;  3GET A;  1YNU A;  3BCB A;  3FDB A;  2YCP A;  1G4V A;  1WYV A;  1MDX A;  1GCK A;  2WK9 A;  3EI9 A;  3OP7 A;  1GC3 A;  3I5T A;  1OXP A;  2BI1 A;  4W5K A;  2VI8 A;  3GSB A;  1P3W A;  4R5Z A;  2KFP A;  4JF1 A;  2EYQ A;  2O0R A;  3NTJ A;  4MY5 A;  1W3U A;  1B4X A;  1DJU A;  2EZ1 A;  1J04 A;  2ZYJ A;  1N8P A;  1I43 A;  2VGS A;  4RJ0 A;  2CB1 A;  1LK9 A;  3BWN A;  4OCA A;  1ORD A;  2W7I A;  2W7H A;  1IX8 A;  1M0O A;  1O69 A;  4WYA A;  1E5F A;  3QN6 A;  3WKS A;  2CTZ A;  4Y0D A;  1ASN A;  1YJY A;  4EFF A;  4W8I A;  3DC1 A;  2JGT A;  2ZSM A;  3RBF A;  5EIG A;  1SVV A;  4LNL A;  5M46 A;  1LC8 A;  4JE5 D;  1ELQ A;  2CJG A;  3NNK A;  3TCM A;  1BJ4 A;  3KE3 A;  3VAX A;  1ASC A;  2W8V A;  3NRA A;  3N4R A;  3EZ1 A;  1AY5 A;  3CQ4 A;  2CFB A;  2D63 A;  4E3Q A;  1CQ8 A;  3OKS A;  2JJF A;  1T3I A;  2W8W A;  4WXF A;  3N4X A;  3MEB A;  3E2Z A;  3PDB A;  4OC9 A;  2OAT A;  2W7M A;  1PG8 A;  3E2Z B;  2PB2 A;  3N75 A;  2BWP A;  4W91 A;  3A8U X;  5E3K A;  1LW5 A;  2Z1Y A;  1KKP A;  1AJS B;  1AY8 A;  4XQ2 A;  1MLY A;  3BS8 A;  2ZJG A;  1S0A A;  2BIG A;  2Z20 A;  1DFO A;  2BIA A;  4K2B A;  2AY8 A;  2VMX A;  3E2F A;  3JTX A;  1I41 A;  1S09 A;  1TPL A;  4MGR A;  1CQ6 A;  3ASA A;  1WKH A;  2VMW A;  3GBX A;  1BKG A;  2HUI A;  1M6S A;  1IAY A;  4A0H A;  2GSA A;  1WYU B;  1ZOB A;  3PPL A;  4NOG A;  1VP4 A;  3K28 A;  4A6U A;  1PMM A;  2JJH A;  2XH1 A;  3GJU A;  4MKJ A;  1V2D A;  1FC4 A;  1QGN A;  1BQA A;  2VGT A;  3BCA A;  4WLJ A;  1GD9 A;  3ACZ A;  3FVS A;  4K2I A;  5DJ9 A;  2AY5 A;  2V0Y A;  4IX8 A;  4JEV A;  3EIA A;  3UAK A;  1C0N A;  2Z61 A;  5AX8 A;  4M2K A;  4H63 Q;  5G4I A;  4R5F A;  3EZS A;  3FKD A;  1J32 A;  1C9C A;  1EJI A;  3HDO A;  3GWP A;  3LY1 A;  2AY1 A;  1KKJ A;  2V1P A;  3BWO A;  2D7Z A;  2YKV A;  5FT4 A;  2AEV A;  4ZWV A;  1UU2 A;  3F9T A;  2FYF A;  3HVY A;  3LVK A;  3I4J A;  3ISL A;  2TPL A;  1W7N A;  4DQ6 A;  2AY6 A;  3HLM A;  3NYT A;  4RIZ A;  4RKD A;  5G0A A;  2VMO A;  4R2N A;  4B98 A;  2DGM A;  1TOK A;  3W1J A;  4HF8 A;  1M0P A;  2YKY A;  1WST A;  3EI7 A;  5D95 A;  1DTY A;  3ZRR A;  2A1V A;  1WKG A;  5F9S A;  4J8L A;  1TOJ A;  2HZP A;  4RIT A;  1SF2 A;  2FM1 A;  2PB0 A;  1LKC A;  2ZP7 A;  3E2Y A;  4WB0 B;  2D61 A;  1GBN A;  1SFF A;  4IY7 A;  4KXK A;  5EAV A;  4IW7 A;  2HOX A;  2OGE A;  3EIB A;  4XJL A;  1X28 A;  4AO9 A;  2PO3 A;  2YCN A;  5C6U A;  2EH6 A;  4XEW A;  3AEP A;  1D7V A;  2WK8 A;  1CS1 A;  4XJO A;  5BJ4 A;  1TOG A;  4A0F A;  2RFV A;  1C7N A;  3KGW A;  3AAT A;  2ZSL A;  4RLG A;  3QI6 A;  4LC3 A;  1DJE A;  3MBB A;  3AEO A;  2VLF A;  4F5L A;  2CY8 A;  1KMJ A;  3AEL A;  3DR7 A;  1D7R A;  7AAT A;  1B5O A;  2C0R A;  2C81 A;  2YRI A;  3E77 A;  5DJ1 A;  5G2Q A;  1OAT A;  3USF A;  3AEM A;  3WGB A;  2VGW A;  5FT6 A;  3PD6 A;  4A6R A;  2W7L A;  1M4N A;  3JWA A;  4AZK A;  1BJW A;  2YKU A;  3L44 A;  4JEX A;  4Q75 A;  4UOY A;  1IX6 A;  2YCT A;  4WYE A;  1YJZ A;  1RVU A;  2BHX A;  2X5F A;  3MAD A;  3COG A;  3JZL A;  2GMU A;  1AIA A;  1YIY A;  3FFH A;  1OHW A;  3W1H A;  2CST A;  1I29 A;  2R2N A;  5E5I A;  4IYO A;  3TQX A;  1TOE A;  1B9H A;  1AHX A;  1AKB A;  5K8B A;  1MAQ A;  4UHN A;  1AAW A;  1MAP A;  3KGX A;  4WBT A;  4ATQ A;  5M4B A;  4ZDL A;  2VMY A;  3FRK A;  2DGK A;  4K2M A;  1BJN A;  2ORD A;  1YAA A;  2G6W A;  2W7G A;  2EO5 A;  3ASB A;  3NDN A;  4GE7 A;  1AIB A;  4H51 A;  4N0B A;  3E6G A;  4BMK A;  3N4S A;  3F6T A;  3B1E A;  2R5E A;  4U1T A;  1C7G A;  4FFC A;  2WKA A;  1BT4 A;  4JEW A;  1X29 A;  3G0T A;  4A0R A;  2FKI A;  1TOI A;  5EQC A;  8AAT A;  5HXX A;  3D6K A;  4BQ0 A;  3FSL A;  1XI9 A;  3PA9 A;  4WXB A;  4UHM A;  4EU1 A;  1ARH A;  1O61 A;  1W7M A;  5FT8 A;  5EIG B;  4WLH A;  2HUF A;  4HVK A;  1D7S A;  2C44 A;  4CVQ A;  2QBT A;  3DZZ A;  3A9Z A;  3GZC A;  5G4J A;  2HP1 A;  5EUE A;  3AEJ A;  4ZAS A;  4DBC A;  3LVJ A;  3RBL A;  1ASF A;  1BS0 A;  4IXS A;  3MAF B;  2FN6 A;  2W8J A;  4XJM A;  2XBN A;  2OGA A;  4O6Z A;  2QB2 A;  2X3L A;  3AEJ C;  1JF9 A;  4ISY A;  1IJI A;  4WB0 A;  1JS3 A;  3JWB A;  2Z9U A;  3PDB B;  1VEF A;  2VI9 A;  4OTL A;  3ZRQ A;  4ZDP A;  4J5U A;  2DR1 A;  9AAT A;  2VYC A;  1VJO A;  3H7F A;  2OKK A;  1LS3 A;  1S06 A;  2EPJ A;  1GC4 A;  1V2E A;  4ZSW A;  2O7C A;  1RVY A;  2BKW A;  2HOR A;  1ASA A;  1IAX A;  2DGL A;  3LG0 A;  3GR9 A;  3FZ7 A;  5DB5 A;  1KMK A;  4F5J A;  2VMN A;  4QGR A;  4EB5 A;  2DKJ A;  4GDY A;  3B8X A;  4A00 A;  2CAN A;  4AZJ A;  1M32 A;  2VMP A;  4E3R A;  4F5G A;  1ASD A;  5LHA A;  2HOY A;  4OT8 A;  3RI6 A;  3IHJ A;  4UHO A;  4OBU A;  4U2H A;  3F0H A;  4E77 A;  3A2B A;  1ZC9 A;  4F4E A;  1SZK A;  1EQB A;  3G8M A;  1ASG A;  4WYC A;  1GEW A;  3PAA A;  3PIU A;  3NYU A;  1ASL A;  2Z67 A;  2O1B A;  1AMA A;  1AIC A;  2VIB A;  4TN4 A;  5IWQ A;  1EG5 A;  2D65 A;  2DOU A;  4MQQ A;  4LW2 A;  4PFF A;  5J8Q A;  3AV7 A;  3UWC A;  4F5H A;  3BB8 A;  4ZDO A;  5E4Z A;  3FQ7 A;  1B5P A;  4M2J A;  2AY3 A;  2CIN A;  1FG3 A;  2E7U A;  3EI5 A;  3I16 A;  2YKX A;  2ZUK A;  1BW0 A;  3PJ0 A;  3H14 A;  3FZ6 A;  1ZOD A;  1LC7 A;  2D5Y A;  3AEN A;  3WLX A;  1GC2 A;  3DYD A;  1D7U A;  1S07 A;  2AY9 A;  2VMZ A;  1GDE A;  4R8D A;  1U08 A;  2E7I A;  4PIW A;  4PFN A;  4EMY A;  3CQ6 A;  2BI5 A;  1GEY A;  4MSO A;  4ADB A;  5JAY A;  1YOO A;  1MDO A;  1ASM A;  1QIR A;  1BJO B;  4BHD A;  1E5E A;  3HL2 A;  1CZC A;  3FTB A;  4OBV A;  1YIZ A;  3TAT A;  3NUI A;  2BIE A;  3P1T A;  4P7Y A;  1AMQ A;  4GEB A;  4JEY A;  1DJ9 A;  4B9B A;  2VMU A;  5HDM A;  1ASB A;  3FQA A;  2R5C A;  3ELE A;  1TAT A;  2GMS A;  2X5D A;  4F5I A;  4XJP A;  1KL1 A;  3PDX A;  2DKB A;  1N31 A;  4ZAH A;  1JS6 A;  1O62 A;  3LVM A;  3RCH B;  1X0M A;  2CJH A;  4BA4 A;  4OYT A;  4F5M A;  4W1V A;  2E7J A;  2ZY3 A;  1KL2 A;  2W8T A;  3FD0 A;  1QIS A;  1AMS A;  1AAM A;  1Y4I A;  2VGU A;  3BWN C;  3ZZK A;  4UQV A;  1C7O A;  3ATH A;  2BI9 A;  4MQR A;  5I92 A;  1ARI A;  4A72 A;  4RKC A;  4E1O A;  2R0T A;  2QLR A;  4ITX A;  1M0Q A;  1AKA A;  3FFR A;  2EGY A;  1MDZ A;  2CH2 A;  4AOA A;  1O4S A;  2AY4 A;  1M0N A;  3G7Q A;  1ELU A;  3K7Y A;  4WXG A;  1UU0 A;  4ATP A;  2ZY2 A;  4JEZ A;  1G7X A;  1H1C A;  3NU7 A;  1TAS A;  3FZ8 A;  4GE9 A;  4WYG A;  4F5F A;  2GQN A;  4K05 A;  1PMO A;  3RQ1 A;  1CZE A;  2D66 A;  4ADD A;  3DXW A;  3N7N A;  1JG8 A;  2CH1 A;  4Q6R A;  3FDD A;  1OXO A;  1Z7D A;  3K40 A;  3WCN A;  2G7J A;  5HHY A;  3NYS A;  3M5U A;  1WYV B;  3P6K A;  4ZM4 A;  3GZD C;  2JG2 A;  2HUU A;  1AKC A;  1ASE A;  1BJO A;  1CL1 A;  1FG7 A;  4I8A A;  1YJS A;  4XAU A;  4Y0H A;  4AH3 A;  5KTB A;  3TFU A;  2D64 A;  2BI3 A;  3AEM C;  3L8A A;  4M2M A;  1AHG A;  2VLH A;  2Z9X A;  1IX7 A;  2VGV A;  1AMR A;  4TMR A;  2YOB A;  3B1D A;  1RV4 A;  1UU1 A;  3DR4 A;  4ADC A;  3H9X A;  2BYL A;  3FQ8 A;  3KKI A;  2WK7 A;  5EFS A;  4RJY A;  2W8U A;  3CQ5 A;  1SZU A;  3DRD A;  3DU4 A;  3AOW A;  2FNU A;  1M7Y A;  2C7T A;  2AEU A;  2Z9W A;  1V72 A;  3MAU A;  4JF0 A;  1S08 A;  1DKA A;  5EUD A;  1Z3Z A;  3VK4 A;  2WB6 A;  5BJ3 A;  2Z9V A;  2BWO A;  3LV2 A;  1B8G A;  4CXQ A;  2FNI A;  3II0 A;  1I48 A;  3JW9 A;  1QJ3 A;  2VGZ A;  1OHV A;  3A9X A;  4IXZ A;  4ZWM A;  4CBS A;  2VMQ A;  2W7K A;  2HOZ A;  4Q31 A;  3ELP A;  2VMR A;  3VK3 A;  4XK1 A;  4ITG A;  3FVX A;  4L0O A;  4CXR A;  5FT5 A;  4DGT A;  3PGY A;  3DXV A;  1IBJ A;  4GRX A;  1MLZ A;  3JU7 A;  1PFF A;  2BWN A;  1SPA A;  1AX4 A;  3BV0 A;  1X2A A;  1IUG A;  3QHX A;  3AOV A;  2FQ6 A;  1AHF A;  2VMS A;  3IF2 A;  1LW4 A;  1G4X A;  2BI2 A;  4PVF A;  4WP0 A;  2W7D A;  3NUB A;  2ZY5 A;  4LNM A;  3EI6 A;  4RAE A;  4WYF A;  2X8U A;  3WY7 A;  3LVL B;  2YHK A;  3N5M A;  3RCH A;  2QSR A;  2AY2 A;  3W1I A;  1XEY A;  4IYO B;  1ECX A;  3ECD A;  1CQ7 A;  2ZC0 A;  2W7E A;  1QIT A;  3NU8 A;  1CJ0 A;  5DX5 A;  3QGU A;  2HP2 A;  2AY7 A;  4ZLV A;  1C4K A;  2BYJ A;  3R4T A;  4KAM A;  1AHE A;  1H0C A;  1SZS A;  1W7L A;  2D7Y A;  4WD2 A;  3WGC A;  4AO4 A;  1LC5 A;  3WKR A;  4IXO A;  3WZF A;  3QM2 A;  3ZRP A;  2QB3 A;  1D2F A;  3AEN B;  2Z1Z A;  2JJG A;  3LWS A;  1AY4 A;  3DOD A;  3CBF A;  3MC6 C;  3QBO A;  5LH9 A;  5F8V A;  2ZY4 A;  2QA3 A;  1BQD A;  1OHY A;  3MAF A;  2E54 A;  4GSA A;  3A9Y A;  4W1W A;  2OKJ A;  4JE5 A;  4BA5 A;  1GEX A;  5D5S A;  3MC6 A;  1CL2 A;  3RUY A;  3HBX A;  3ZZJ A;  4P3M A;  3HQT A;  3HT4 A;  4OMA A;  2NMP A;  3EI8 A;  1AJR A;  2GB3 A;  1B9I A;  3FCR A;  3GZD A;  1TAR A;  3E9K A;  2VMT A;  2EZ2 A;  3PD6 B;  3R9A A;  4Y0I A;  3FVU A;  1ARS A;  4N0W A;  2YRR A;  2CJD A;  2W7J A;  4LW4 A;  2R5C B;  3BN1 A;  3VOM A;  4F5K A;  4LNJ A;  2VMV A;  1QZ9 A;  1UKJ A;  2Q7W A;  3BCX A;  1ARG A;  4FL0 A;  1WYU A;  1G7W A;  1RV3 A;  2JJE A;  4RM1 A;  4WYD A;  3HMU A;  4ZM3 A;  3MKJ A;  1ART A;  3B46 A;  1WYT B;  3B1C A;  3NX3 A;  5G09 A;  1MGV A;  4Q76 A;  2F8J A;  1DGE A;  1QJ5 A;  4ADE A;  4EB7 A;  5EUN A;  3WX9 A;  2JIS A;  2OQX A;  4A0G A;  5G2P A;  4MKK A;  3N0L A;  3WCO A;  1V2F A;  1DGD A;  2QMA A;  3QPG A;  4TV7 A;  1AHY A;  3EUC A;  5M4D A;  5M49 A;  3CAI A;  3UE8 A;  3BC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...