1X0MA

A human kynurenine aminotransferase ii homologue from pyrococcus horikoshii ot3
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
403
structure length
403
Chain Sequence
MLGDVERFFSKKALEMRASEVRELLKLVETSDIISLAGGLPNPKTFPKEIIRDILVEIMEKYADKALQYGTTKGFTPLRETLMKWLGKRYGISQDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYIQIPLDDEGMKVEILEEKLKELKSQGKKVKVVYTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRYSGNPEKKIKALDNEGRVIYLGTFSKILAPGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGYLEKHIPEIRKFYKPRRDAMLEALEEFMPEGVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKGVAYVPGEAFYAHRDVKNTMRLNFTYVDEDKIMEGIKRLAETIKEELKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminotransferase II Homologue
publication title Crystal structure of a human kynurenine aminotransferase II homologue from Pyrococcus horikoshii OT3 at 2.20 A resolution
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 133
structure length 403
sequence length 403
ec nomenclature ec 2.6.1.7: Kynurenine--oxoglutarate transaminase.
pdb deposition date 2005-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1x0mA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1x0mA01
1N31A 2G6WA 2C81A 1ASNA 4WB0A 3HL2A 2BKWA 3ELEA 3OKSA 1GC4A 4IYOA 4OT8A 4W1XA 3B1CA 2TPLA 3LWSA 4RKDA 2VMZA 1ZC9A 1DJ9A 2D7YA 3GR9A 1WYTA 1VP4A 3VK3A 5M46A 2HOZA 1ORDA 1SZUA 3IF2A 3ZZKA 1X28A 1AAWA 1I48A 2YCTA 1AY5A 1DJEA 2YKUA 4LW4A 4LNJA 3M5UA 1TATA 4Q76A 3USFA 3H14A 4CVQA 2VMQA 1KMKA 1MDZA 1TARA 1ASBA 3OP7A 1PG8A 2OKJA 3RI6A 3W1IA 3I4JA 4OCAA 4WLJA 3FKDA 3EZSA 2VGTA 4KYOA 3CQ4A 3FVSA 1AMSA 4EU1A 5JAYA 1N8PA 4IX8A 4UOYA 2EGYA 4L0OA 2HZPA 5EQCA 5IWQA 1ASFA 4FL0A 1DKAA 1SPAA 4WYEA 1ZOBA 2CB1A 3G0TA 3MADA 4LNMA 1ZODA 1TASA 3I16A 1VEFA 1B9HA 4ZWVA 1UU0A 4ZLVA 4K2IA 1GEXA 5D95A 4M2MA 4XEWA 2GMUA 1B5PA 3ASBA 1AICA 2HUFA 4GE7A 4XAUA 3B46A 4A72A 3TCMA 3L8AA 3PDXA 3BS8A 4AO4A 2OQXA 3A9ZA 2Z1ZA 1AJRA 1DGDA 4P7YA 1BQDA 2BI2A 3HT4A 4WYCA 2R5CB 4GEBA 4OYTA 3DRDA 3GWPA 4JF1A 4ZSWA 5HHYA 3L44A 2AY6A 3GJUA 4MKKA 1C4KA 1CZEA 2FM1A 3EZ1A 3GZDC 3K40A 4ATQA 4AZKA 1C7GA 3A2BA 3F0HA 2JJFA 2W7KA 2DGLA 3CQ6A 2W7IA 1ELUA 1D7RA 3B8XA 1G7XA 1KKJA 2F8JA 4Q31A 1ASEA 4GE4A 3WKSA 1C0NA 1H1CA 3COGA 3W1HA 4MSOA 2ZSLA 1GC3A 2O7CA 1QITA 2W7HA 1J32A 2BIGA 3E2FA 5EAAA 2Z9XA 5EUNA 3Q8NA 4DQ6A 4OTLA 3QPGA 4KAMA 2CH1A 1ASCA 3BCBA 3KKIA 4F4EA 3FDDA 1E5FA 2W8UA 4RITA 1GCKA 4F5LA 3UAKA 1S09A 2CFBA 1BJOB 1ARSA 3HVYA 2Z67A 1GEYA 1CJ0A 1SF2A 2OATA 1SZSA 1TOIA 1YOOA 2JJGA 4E3QA 2JGTA 2R2NA 2HP2A 4Q75A 4Q6RA 2DOUA 2BYJA 2YKVA 3FVXA 4UHMA 2V1PA 1ECXA 2OGAA 1M6SA 3A9XA 2AY7A 3MBBA 1YJYA 1LC8A 2WK7A 3MEBA 4N0BA 1QZ9A 2WKAA 1WKGA 3ASAA 3QI6A 1XEYA 1Y4IA 2W7JA 1M0PA 3N75A 3NU8A 3WCNA 3LV2A 1TOKA 4IW7A 1TOJA 4H51A 1I41A 2YHKA 3WY7A 3D6KA 4J5UA 1JG8A 3WLXA 5G0AA 2VMNA 3VOMA 2CH2A 2BIEA 2W7LA 2R5CA 1FC4A 4F5MA 4TN4A 1AHFA 4KXKA 3NYSA 1LW5A 4GRXA 1ELQA 3DYDA 1OXPA 3KGXA 4W91A 5EFSA 1ARIA 3E6GA 3NRAA 2X5DA 5DX5A 1V2DA 2GB3A 3AEMA 4ZWMA 3CAIA 1KMJA 2GSAA 4WXFA 1DFOA 1KL2A 3QGUA 1JS6A 3BWNC 1QISA 2CINA 2QLRA 2QBTA 5G4IA 1BJ4A 3JW9A 2XH1A 4JEXA 3FSLA 4ADEA 3PGYA 3E2ZB 3RQ1A 4ATPA 3HLMA 1LC7A 2BI3A 2DKBA 1M0QA 3WZFA 5BJ4A 2E54A 1T3IA 2JJHA 3E2YA 2HOXA 4IXZA 2EO5A 1CL2A 1P3WA 3ZRRA 2W7FA 1LK9A 4F5FA 2QB2A 2AATA 3NDNA 1OHWA 1BJOA 1KKPA 1AHXA 2RFVA 1DTYA 9AATA 4HVKA 4WYDA 3E77A 2GQNA 1IAXA 1I43A 2ZY4A 3TFTA 3MAFB 5BJ3A 2VMUA 2HP1A 2QB3A 4ZM4A 3FZ7A 4M2JA 5AX8A 2O0RA 3WCOA 2V0YA 3VAXA 2QMAA 2ZY5A 3T32A 2X8UA 1D7VA 4IY7A 2XBNA 1EJIA 3G8MA 4A0HA 3GSBA 4E1OA 3RBFA 4UHOA 1EG5A 1ASAA 3JZLA 4U2HA 2CY8A 2VIAA 4W1WA 4P3MA 2DGKA 4JEVA 4CXRA 5LH9A 1QGNA 3GBXA 1GC0A 4K2BA 3KE3A 3CBFA 4A6RA 1AKBA 4ADBA 2X5FA 2YRRA 4Y0HA 3ECDA 4B98A 2W8TA 3KGWA 1OATA 1GEWA 3QN6A 5EUDA 1SFFA 1UU1A 3BN1A 3HQTA 4K2MA 3ACZA 3BWNA 4A0FA 3JU7A 1XI9A 2FNIA 3I5TA 1ASDA 1V2EA 2Z61A 3AEJA 3BWOA 1C7OA 3PJ0A 1M0NA 2FNUA 3BCAA 3ELPA 5D5SA 2BWNA 2PB2A 1OXOA 1IX8A 2VI9A 4LC3A 3MKJA 3LVKA 3FVUA 3LVJA 1UU2A 1M7YA 1MDOA 4F5JA 2D7ZA 3ZZJA 2CANA 3FTBA 3K28A 3NYTA 3PIUA 4ZASA 3F9TA 2C0RA 3FDBA 3E2ZA 3PD6B 4ISYA 4IXSA 1VJOA 4GDYA 1BKGA 5HXXA 1GDEA 4BA5A 1CZCA 5J8QA 3FFRA 2DKJA 4GSAA 1B9IA 2W8JA 4EMYA 2VMXA 3W1JA 1AMQA 1AHEA 1WYUB 4ZDOA 2FYFA 2BIAA 3WGBA 1BT4A 1DGEA 1O4SA 2EH6A 2YRIA 3AEMC 3LVLB 4XK1A 4W1VA 2BWOA 4XJLA 3F6TA 1MLYA 1RV4A 2VMOA 3DODA 3G7QA 2AY5A 4MY5A 1CL1A 1MLZA 5M4DA 5EAVA 3MAFA 3TFUA 1ASGA 1GD9A 5K8BA 4WYAA 2HOYA 2VGWA 3TQXA 4MQPA 2D5YA 1B5OA 3N0LA 1W3UA 3LY1A 5F8VA 1RVUA 4F5IA 1D7UA 3AEOA 2AY8A 2W8WA 1GC2A 3ZRQA 3JWBA 4RAEA 2BYLA 3P6KA 3PAAA 4DBCA 1JF9A 1AKAA 3FRKA 4LNLA 4F5GA 1E5EA 1BW0A 3HDOA 8AATA 5TF5A 4PIWA 2GMSA 4ITGA 4OBUA 4PFNA 3A8UX 2HUUA 1JS3A 4RJ0A 2Z9WA 1ASMA 4I8AA 1IAYA 1LKCA 3E9KA 3NUIA 4A0RA 1I29A 4W8IA 4AO9A 2D63A 1PMMA 2EPJA 2VMWA 3NU7A 4ITXA 4UQVA 1AJSB 1QIRA 2E7IA 5LHAA 3EI7A 3RCHB 4XQ2A 1AX4A 1MGVA 5G2QA 2YKXA 1GBNA 2ZY2A 2VMTA 1FG7A 4JE5A 2QA3A 1X29A 4A0GA 1IX7A 1LW4A 3HMUA 5EIGB 1TOEA 1O62A 1W7MA 3NTJA 4WYGA 4UHNA 5E5IA 2HUIA 3PD6A 2EZ2A 4EB7A 1IX6A 1H0CA 3BB8A 3PPLA 4BHDA 3AEJC 4R5FA 4PVFA 1J04A 1WYVB 4RLGA 3TATA 3ZRPA 4U1TA 1RV3A 5DJ9A 5DB5A 1X2AA 3N5MA 1CQ6A 3A9YA 3MAUA 4M2KA 2FN6A 1IVRA 2W7MA 5M49A 2BI5A 2VYCA 4MQQA 3QBOA 2D61A 3DXWA 4GE9A 2ZSMA 2YKYA 4WBTA 1W23A 3PA9A 4QGRA 5HDMA 4A6TA 3DR4A 1FG3A 2VMPA 4Y0DA 3VP6A 4RKCA 1U08A 4JEWA 2DR1A 4LW2A 1D2FA 2X3LA 3LVMA 1D7SA 1ARTA 4E77A 2NMPA 7AATA 2VGZA 2DGMA 3RUYA 2O1BA 4N0WA 1ARGA 5FT5A 5F9SA 1S0AA 2AY2A 2JISA 2VGSA 4TV7A 1AMAA 5C6UA 1W7LA 5I92A 2W7DA 2ZP7A 3B1EA 3DC1A 2Z1YA 3DR7A 3GZCA 1CS1A 1M0OA 1O61A 4AOAA 4A6UA 1G4VA 5FT8A 1AHGA 2PB0A 1Z3ZA 3P1TA 1N2TA 1ASLA 1BS0A 5G09A 2PO3A 1PFFA 2VGVA 3AENB 1BJWA 1YIZA 1X0MA 4R2NA 3FCRA 4IXOA 4AZJA 3NUBA 2AY4A 2YCPA 1AY4A 1AJSA 1ARHA 3CQ5A 3RCHA 4NOGA 4ZDPA 1W7NA 5E3KA 2Z9VA 3MC6A 1S07A 2VMSA 3EIAA 4R5ZA 3AATA 4RM1A 1WSTA 5EIGA 3LG0A 4MKJA 3AOVA 4F5HA 1CQ7A 1SVVA 1QJ3A 4O6ZA 3WX9A 2VLHA 4F5KA 3NNKA 2W8VA 2D65A 1QJ5A 2E7JA 4MQRA 5FT6A 2VGUA 4BMKA 1WYVA 4ZDLA 2VI8A 1AY8A 3UWCA 4J8LA 4CBRA 1LS3A 4WP0A 1B4XA 5M4BA 1YIYA 3ATHA 2WK9A 3GETA 3EI9A 2VMRA 4OC9A 4PFFA 1RVYA 2Z9UA 3AV7A 4E3RA 3FZ8A 3QHXA 1SZKA 3DU4A 3EI5A 5DJ1A 3DXVA 1IJIA 3EI8A 3R4TA 2ZC0A 4JEYA 3JWAA 2CJDA 4WYFA 4FFCA 3EIBA 4OMAA 4A00A 2C7TA 3BCXA 1S08A 3PDBB 4XJMA 1AIAA 2AY9A 3NX3A 4XJOA 1BQAA 1CQ8A 2EZ1A 3BC8A 1YAAA 2CJGA 3FQ8A 3B1DA 4OBVA 2AEVA 4TMRA 2Q7WA 2AEUA 4WB0B 2E7UA 2VMVA 1V72A 3EI6A 2HORA 1S06A 3K7YA 1DJUA 3QM2A 4HF8A 3R9AA 4IYOB 3RBLA 3ISLA 4ZM3A 2D66A 1Z7DA 2BWPA 3IHJA 3WGCA 4EFFA 4W5KA 2OKKA 3AENA 1V2FA 2BI1A 3FQ7A 2Z20A 5FT4A 2D64A 3AELA 1WYTB 1KL1A 4JF0A 1IUGA 1C7NA 4RIZA 4RJYA 2JJEA 1O69A 1M4NA 2FQ6A 3NYUA 1AMRA 1EQBA 2VIBA 3AEPA 4WXGA 3FQAA 4CBSA 2CSTA 4R8DA 4DGTA 3II0A 3HBXA 2C44A 2AY1A 2BI9A 1BJNA 2OGEA 1TOGA 3H7FA 1AAMA 2CJHA 1YJSA 5E4ZA 2YOBA 1UKJA 4ADDA 4ZAHA 1G4XA 2ZJGA 4CXQA 1OHYA 3VK2A 1M32A 4ADCA 3EUCA 4WD2A 3JTXA 1MDXA 1AHYA 2ORDA 3FD0A 4WLHA 1YNUA 4WXBA 1IBJA 3GZDA 1OHVA 2BHXA 2CTZA 2ZYJA 1YJZA 2VMYA 2W7EA 4JEZA 3MC6C 5G2PA 3BV0A 4JE5D 4MGRA 4B9BA 2YCNA 4BQ0A 2AY3A 1MAQA 1WYUA 1MAPA 2R0TA 2WK8A 2R5EA 2W7GA 4AH3A 4EB5A 1TPLA 4ZSYA 1G7WA 4Y0IA 1WKHA 3AOWA 1LC5A 2JG2A 3DZZA 2ZY3A 3WKRA 1AKCA 2VLFA 1B8GA 2ZUKA 3FZ6A 4BA4A 4XJPA 5G4JA 1C9CA 3PDBA 3UE8A 1AIBA 3VK4A 1PMOA 3FFHA 5EUEA
chains in the Genus database with same CATH superfamily
1N31A 2G6WA 2A1VA 2C81A 1ASNA 4WB0A 3HL2A 2BKWA 3ELEA 3OKSA 1GC4A 4IYOA 4OT8A 4W1XA 3B1CA 2TPLA 3LWSA 4RKDA 2VMZA 1ZC9A 1DJ9A 2D7YA 3GR9A 1WYTA 1VP4A 3VK3A 5M46A 2HOZA 1ORDA 1SZUA 3IF2A 3ZZKA 1X28A 1AAWA 1I48A 2YCTA 1AY5A 1DJEA 2YKUA 4LW4A 4LNJA 3M5UA 1TATA 4Q76A 3USFA 3H14A 4CVQA 2VMQA 1KMKA 1MDZA 1TARA 1ASBA 3OP7A 1PG8A 2OKJA 3RI6A 3W1IA 3I4JA 4OCAA 4WLJA 3FKDA 3EZSA 2VGTA 4KYOA 3CQ4A 3FVSA 3N4XA 1AMSA 4EU1A 5JAYA 1N8PA 4IX8A 4UOYA 2EGYA 4L0OA 2HZPA 5EQCA 5IWQA 1ASFA 4FL0A 1DKAA 1SPAA 4WYEA 1ZOBA 2CB1A 3G0TA 3MADA 4LNMA 1ZODA 1TASA 3I16A 1VEFA 1B9HA 4ZWVA 1UU0A 4ZLVA 4K2IA 1GEXA 5D95A 4M2MA 4XEWA 2GMUA 1B5PA 3ASBA 1AICA 2HUFA 4GE7A 4XAUA 3B46A 4A72A 3TCMA 3L8AA 3PDXA 3BS8A 4AO4A 2OQXA 3A9ZA 2Z1ZA 1AJRA 1DGDA 4P7YA 1BQDA 2BI2A 3HT4A 4WYCA 2R5CB 4GEBA 4OYTA 3DRDA 3GWPA 4JF1A 4ZSWA 5HHYA 3L44A 2AY6A 3GJUA 4MKKA 1C4KA 1CZEA 2FM1A 3EZ1A 3GZDC 3K40A 4ATQA 4AZKA 1C7GA 3A2BA 3F0HA 2JJFA 2W7KA 2DGLA 3CQ6A 2W7IA 1ELUA 2FKIA 1D7RA 3B8XA 1G7XA 3N4SA 1KKJA 2F8JA 4Q31A 1ASEA 4GE4A 3WKSA 1C0NA 1H1CA 3COGA 3W1HA 4MSOA 2ZSLA 1GC3A 2O7CA 1QITA 2W7HA 1J32A 2BIGA 3E2FA 5EAAA 2Z9XA 5EUNA 3Q8NA 4DQ6A 4OTLA 3QPGA 2KFPA 4KAMA 2CH1A 1ASCA 3BCBA 3KKIA 4F4EA 3FDDA 1E5FA 2W8UA 4RITA 1GCKA 4F5LA 3UAKA 1S09A 2CFBA 1BJOB 1ARSA 3HVYA 2Z67A 1GEYA 1CJ0A 1SF2A 2OATA 1SZSA 1TOIA 1YOOA 2JJGA 4E3QA 2JGTA 2R2NA 2HP2A 4Q75A 4Q6RA 2DOUA 2BYJA 2YKVA 3FVXA 4UHMA 2V1PA 1ECXA 2OGAA 1M6SA 3A9XA 2AY7A 3MBBA 1YJYA 1LC8A 2WK7A 3MEBA 4N0BA 1QZ9A 2WKAA 1WKGA 3ASAA 3QI6A 1XEYA 1Y4IA 2W7JA 1M0PA 3N75A 3NU8A 3WCNA 3LV2A 1TOKA 4IW7A 1TOJA 4H51A 1I41A 2YHKA 3WY7A 3D6KA 4J5UA 1JG8A 3WLXA 5G0AA 2VMNA 3VOMA 2CH2A 2BIEA 2W7LA 2R5CA 1FC4A 4F5MA 4TN4A 1AHFA 4KXKA 3NYSA 1LW5A 4GRXA 1ELQA 3DYDA 1OXPA 3KGXA 4W91A 5EFSA 1ARIA 3E6GA 3NRAA 2X5DA 5DX5A 1V2DA 2GB3A 3AEMA 4ZWMA 3CAIA 1KMJA 2GSAA 4WXFA 1DFOA 1KL2A 3QGUA 1JS6A 3BWNC 1QISA 2CINA 2QLRA 2QBTA 5G4IA 1BJ4A 3JW9A 2XH1A 4JEXA 3FSLA 4ADEA 3PGYA 3E2ZB 3RQ1A 4ATPA 3HLMA 1LC7A 2BI3A 2DKBA 1M0QA 3WZFA 5BJ4A 2E54A 1T3IA 2JJHA 3E2YA 2HOXA 4IXZA 2EO5A 1CL2A 1P3WA 3ZRRA 2W7FA 1LK9A 4F5FA 2QB2A 2AATA 3NDNA 1OHWA 1BJOA 1KKPA 1AHXA 2RFVA 1DTYA 9AATA 4HVKA 4WYDA 3E77A 2GQNA 1IAXA 1I43A 2ZY4A 3TFTA 3MAFB 5BJ3A 2VMUA 2HP1A 2QB3A 4ZM4A 3FZ7A 4M2JA 5AX8A 2O0RA 3WCOA 2V0YA 3VAXA 2QMAA 2ZY5A 3T32A 2X8UA 1D7VA 4IY7A 2XBNA 1EJIA 3G8MA 4A0HA 3GSBA 4E1OA 3RBFA 4UHOA 1EG5A 1ASAA 3JZLA 4U2HA 2CY8A 2VIAA 3H9XA 4W1WA 4P3MA 2DGKA 4JEVA 4CXRA 5LH9A 1QGNA 3GBXA 1GC0A 4K2BA 3KE3A 3CBFA 4A6RA 1AKBA 4ADBA 2X5FA 2YRRA 4Y0HA 3ECDA 4B98A 2W8TA 3KGWA 1OATA 1GEWA 3QN6A 5EUDA 1SFFA 1UU1A 3BN1A 3HQTA 4K2MA 3ACZA 3BWNA 4A0FA 3JU7A 1XI9A 2FNIA 3I5TA 1ASDA 1V2EA 2Z61A 3AEJA 3BWOA 1C7OA 3PJ0A 1M0NA 2FNUA 3BCAA 3ELPA 5D5SA 2BWNA 2PB2A 1OXOA 1IX8A 2VI9A 4LC3A 3MKJA 3LVKA 3FVUA 3LVJA 1UU2A 1M7YA 1MDOA 4F5JA 2D7ZA 3ZZJA 2CANA 3FTBA 3K28A 3NYTA 3PIUA 4ZASA 3F9TA 2C0RA 3FDBA 3E2ZA 3PD6B 4ISYA 4IXSA 1VJOA 4GDYA 1BKGA 5HXXA 1GDEA 4BA5A 1CZCA 5J8QA 3FFRA 2DKJA 4GSAA 1B9IA 2W8JA 4EMYA 2VMXA 3W1JA 1AMQA 1AHEA 1WYUB 4ZDOA 2FYFA 2BIAA 3WGBA 1BT4A 1DGEA 1O4SA 2EH6A 2YRIA 3AEMC 3LVLB 4XK1A 4W1VA 2BWOA 4XJLA 3F6TA 1MLYA 1RV4A 2VMOA 3DODA 3G7QA 2AY5A 4MY5A 1CL1A 1MLZA 5M4DA 5EAVA 3MAFA 3TFUA 1ASGA 1GD9A 5K8BA 4WYAA 2HOYA 2VGWA 3TQXA 4MQPA 2D5YA 1B5OA 1KAFA 3N0LA 1W3UA 3LY1A 5F8VA 1RVUA 4F5IA 1D7UA 3AEOA 2AY8A 2W8WA 1GC2A 3ZRQA 3JWBA 4RAEA 2BYLA 3P6KA 3PAAA 4DBCA 1JF9A 1AKAA 3FRKA 4LNLA 4F5GA 1E5EA 1BW0A 3HDOA 8AATA 5TF5A 4PIWA 2GMSA 4ITGA 5KTBA 4OBUA 4PFNA 3A8UX 2HUUA 1JS3A 4RJ0A 2Z9WA 1ASMA 4I8AA 1IAYA 1LKCA 3E9KA 3NUIA 4A0RA 1I29A 4W8IA 4AO9A 4H63Q 2D63A 1PMMA 2EPJA 2VMWA 3NU7A 4ITXA 4UQVA 1AJSB 1QIRA 2E7IA 5LHAA 3EI7A 3RCHB 4XQ2A 1AX4A 1MGVA 5G2QA 2YKXA 1GBNA 2ZY2A 2VMTA 1FG7A 4JE5A 2QA3A 1X29A 4A0GA 1IX7A 1LW4A 3HMUA 5EIGB 1TOEA 1O62A 1W7MA 3NTJA 4WYGA 4UHNA 5E5IA 2HUIA 3PD6A 2EZ2A 4EB7A 1IX6A 1H0CA 3BB8A 3PPLA 4BHDA 3AEJC 4R5FA 4PVFA 1J04A 1WYVB 4RLGA 3TATA 3ZRPA 4U1TA 1RV3A 5DJ9A 5DB5A 1X2AA 3N5MA 1CQ6A 3A9YA 3MAUA 4M2KA 2FN6A 1IVRA 2W7MA 5M49A 2BI5A 2VYCA 4MQQA 3QBOA 2D61A 3DXWA 4GE9A 2ZSMA 2YKYA 4WBTA 1W23A 3PA9A 4QGRA 5HDMA 4A6TA 3DR4A 1FG3A 2VMPA 4Y0DA 3VP6A 4RKCA 1U08A 4JEWA 2DR1A 4LW2A 1D2FA 2X3LA 3LVMA 1D7SA 1ARTA 2G7JA 4E77A 2NMPA 7AATA 2VGZA 2DGMA 3RUYA 2O1BA 4N0WA 1ARGA 5FT5A 5F9SA 1S0AA 2AY2A 2JISA 2VGSA 4TV7A 1AMAA 5C6UA 1W7LA 5I92A 2W7DA 2ZP7A 3B1EA 3DC1A 2Z1YA 3DR7A 3GZCA 1CS1A 1M0OA 1O61A 4AOAA 4A6UA 1G4VA 5FT8A 1AHGA 2PB0A 1Z3ZA 3P1TA 1N2TA 1ASLA 1BS0A 5G09A 2PO3A 1PFFA 2VGVA 3AENB 1BJWA 1YIZA 1X0MA 4R2NA 2EYQA 3FCRA 4IXOA 4AZJA 3NUBA 2AY4A 2YCPA 1AY4A 1AJSA 1ARHA 3CQ5A 3RCHA 4NOGA 4ZDPA 1W7NA 5E3KA 2Z9VA 3MC6A 1S07A 2VMSA 3EIAA 4R5ZA 3AATA 4RM1A 1WSTA 5EIGA 3LG0A 4MKJA 3AOVA 4F5HA 1CQ7A 1SVVA 1QJ3A 4O6ZA 3WX9A 2VLHA 4F5KA 3NNKA 2W8VA 2D65A 1QJ5A 2E7JA 4MQRA 5FT6A 2VGUA 4BMKA 1WYVA 4ZDLA 2VI8A 1AY8A 3UWCA 4J8LA 2QSRA 4CBRA 1LS3A 4WP0A 1B4XA 5M4BA 1YIYA 3ATHA 2WK9A 3GETA 3EI9A 2VMRA 4OC9A 4PFFA 1RVYA 2Z9UA 3AV7A 4E3RA 3FZ8A 3QHXA 1SZKA 3DU4A 3EI5A 5DJ1A 3DXVA 1IJIA 3EI8A 3R4TA 2ZC0A 4JEYA 3JWAA 2CJDA 4WYFA 4FFCA 3EIBA 4OMAA 4A00A 2WB6A 2C7TA 3BCXA 1S08A 3PDBB 4XJMA 1AIAA 2AY9A 3NX3A 4XJOA 1BQAA 1CQ8A 2EZ1A 3BC8A 1YAAA 2CJGA 4K05A 3FQ8A 3B1DA 4OBVA 2AEVA 4TMRA 2Q7WA 2AEUA 4WB0B 2E7UA 2VMVA 1V72A 3EI6A 2HORA 1S06A 3K7YA 1DJUA 3QM2A 4HF8A 3R9AA 4IYOB 3RBLA 3ISLA 4ZM3A 2D66A 1Z7DA 2BWPA 3IHJA 3WGCA 4EFFA 4W5KA 2OKKA 3AENA 1V2FA 2BI1A 3FQ7A 2Z20A 5FT4A 2D64A 3AELA 1WYTB 1KL1A 4JF0A 1IUGA 3N7NA 1C7NA 4RIZA 4RJYA 2JJEA 1O69A 1M4NA 2FQ6A 3NYUA 1AMRA 1EQBA 2VIBA 3AEPA 4WXGA 3FQAA 4CBSA 2CSTA 4R8DA 4DGTA 3II0A 3HBXA 2C44A 2AY1A 2BI9A 1BJNA 2OGEA 1TOGA 3H7FA 1AAMA 2CJHA 1YJSA 5E4ZA 2YOBA 1UKJA 4ADDA 4ZAHA 1G4XA 2ZJGA 4CXQA 1OHYA 3VK2A 1M32A 4ADCA 3N4RA 3EUCA 4WD2A 3JTXA 1MDXA 1AHYA 2ORDA 3FD0A 4WLHA 1YNUA 4WXBA 1IBJA 3GZDA 1OHVA 2BHXA 2CTZA 2ZYJA 1YJZA 2VMYA 2W7EA 4JEZA 3MC6C 5G2PA 3BV0A 4JE5D 4MGRA 4B9BA 2YCNA 4BQ0A 2AY3A 1MAQA 1WYUA 1MAPA 2R0TA 2WK8A 2R5EA 2W7GA 4AH3A 4EB5A 1TPLA 4ZSYA 1G7WA 4Y0IA 1WKHA 3AOWA 1LC5A 2JG2A 3DZZA 2ZY3A 3WKRA 1AKCA 2VLFA 1B8GA 2ZUKA 3FZ6A 4BA4A 4XJPA 5G4JA 1C9CA 3PDBA 3UE8A 1AIBA 3VK4A 1PMOA 3FFHA 5EUEA
chains in the Genus database with same CATH topology
1N31A 2G6WA 2A1VA 2C81A 1ASNA 4WB0A 3HL2A 2BKWA 3ELEA 3OKSA 1GC4A 4IYOA 4OT8A 4W1XA 3B1CA 2TPLA 3LWSA 4RKDA 2VMZA 1ZC9A 1DJ9A 2D7YA 3GR9A 1WYTA 1VP4A 3VK3A 5M46A 2HOZA 1ORDA 1SZUA 3IF2A 3ZZKA 1X28A 1AAWA 1I48A 2YCTA 1AY5A 1DJEA 2YKUA 4LW4A 4LNJA 3M5UA 1TATA 4Q76A 3USFA 3H14A 4CVQA 2VMQA 1KMKA 1MDZA 1TARA 1ASBA 3OP7A 1PG8A 2OKJA 3RI6A 3W1IA 3I4JA 4OCAA 4WLJA 3FKDA 3EZSA 2VGTA 4KYOA 3CQ4A 3FVSA 3N4XA 1AMSA 4EU1A 5JAYA 1N8PA 4IX8A 4UOYA 2EGYA 4L0OA 2HZPA 5EQCA 5IWQA 1ASFA 4FL0A 1DKAA 1SPAA 4WYEA 1ZOBA 2CB1A 3G0TA 3MADA 4LNMA 1ZODA 1TASA 3I16A 1VEFA 1B9HA 4ZWVA 1UU0A 4ZLVA 4K2IA 1GEXA 5D95A 4M2MA 4XEWA 2GMUA 1B5PA 3ASBA 1AICA 2HUFA 4GE7A 4XAUA 3B46A 4A72A 3TCMA 3L8AA 3PDXA 3BS8A 4AO4A 2OQXA 3A9ZA 2Z1ZA 1AJRA 1DGDA 4P7YA 1BQDA 2BI2A 3HT4A 4WYCA 2R5CB 4GEBA 4OYTA 3DRDA 3GWPA 4JF1A 4ZSWA 5HHYA 3L44A 2AY6A 3GJUA 4MKKA 1C4KA 1CZEA 2FM1A 3EZ1A 3GZDC 3K40A 4ATQA 4AZKA 1C7GA 3A2BA 3F0HA 2JJFA 2W7KA 2DGLA 3CQ6A 2W7IA 1ELUA 2FKIA 1D7RA 3B8XA 1G7XA 3N4SA 1KKJA 2F8JA 4Q31A 1ASEA 4GE4A 3WKSA 1C0NA 1H1CA 3COGA 3W1HA 4MSOA 2ZSLA 1GC3A 2O7CA 1QITA 2W7HA 1J32A 2BIGA 3E2FA 5EAAA 2Z9XA 5EUNA 3Q8NA 4DQ6A 4OTLA 3QPGA 2KFPA 4KAMA 2CH1A 1ASCA 3BCBA 3KKIA 4F4EA 3FDDA 1E5FA 2W8UA 4RITA 1GCKA 4F5LA 3UAKA 1S09A 2CFBA 1BJOB 1ARSA 3HVYA 2Z67A 1GEYA 1CJ0A 1SF2A 2OATA 1SZSA 1TOIA 1YOOA 2JJGA 4E3QA 2JGTA 2R2NA 2HP2A 4Q75A 4Q6RA 2DOUA 2BYJA 2YKVA 3FVXA 4UHMA 2V1PA 1ECXA 2OGAA 1M6SA 3A9XA 2AY7A 3MBBA 1YJYA 1LC8A 2WK7A 3MEBA 4N0BA 1QZ9A 2WKAA 1WKGA 3ASAA 3QI6A 1XEYA 1Y4IA 2W7JA 1M0PA 3N75A 3NU8A 3WCNA 3LV2A 1TOKA 4IW7A 1TOJA 4H51A 1I41A 2YHKA 3WY7A 3D6KA 4J5UA 1JG8A 3WLXA 5G0AA 2VMNA 3VOMA 2CH2A 2BIEA 2W7LA 2R5CA 1FC4A 4F5MA 4TN4A 1AHFA 4KXKA 3NYSA 1LW5A 4GRXA 1ELQA 3DYDA 1OXPA 3KGXA 4W91A 5EFSA 1ARIA 3E6GA 3NRAA 2X5DA 5DX5A 1V2DA 2GB3A 3AEMA 4ZWMA 3CAIA 1KMJA 2GSAA 4WXFA 1DFOA 1KL2A 3QGUA 1JS6A 3BWNC 1QISA 2CINA 2QLRA 2QBTA 5G4IA 1BJ4A 3JW9A 2XH1A 4JEXA 3FSLA 4ADEA 3PGYA 3E2ZB 3RQ1A 4ATPA 3HLMA 1LC7A 2BI3A 2DKBA 1M0QA 3WZFA 5BJ4A 2E54A 1T3IA 2JJHA 3E2YA 2HOXA 4IXZA 2EO5A 1CL2A 1P3WA 3ZRRA 2W7FA 1LK9A 4F5FA 2QB2A 2AATA 3NDNA 1OHWA 1BJOA 1KKPA 1AHXA 2RFVA 1DTYA 9AATA 4HVKA 4WYDA 3E77A 2GQNA 1IAXA 1I43A 2ZY4A 3TFTA 3MAFB 5BJ3A 2VMUA 2HP1A 2QB3A 4ZM4A 3FZ7A 4M2JA 5AX8A 2O0RA 3WCOA 2V0YA 3VAXA 2QMAA 2ZY5A 3T32A 2X8UA 1D7VA 4IY7A 2XBNA 1EJIA 3G8MA 4A0HA 3GSBA 4E1OA 3RBFA 4UHOA 1EG5A 1ASAA 3JZLA 4U2HA 2CY8A 2VIAA 3H9XA 4W1WA 4P3MA 2DGKA 4JEVA 4CXRA 5LH9A 1QGNA 3GBXA 1GC0A 4K2BA 3KE3A 3CBFA 4A6RA 1AKBA 4ADBA 2X5FA 2YRRA 4Y0HA 3ECDA 4B98A 2W8TA 3KGWA 1OATA 1GEWA 3QN6A 5EUDA 1SFFA 1UU1A 3BN1A 3HQTA 4K2MA 3ACZA 3BWNA 4A0FA 3JU7A 1XI9A 2FNIA 3I5TA 1ASDA 1V2EA 2Z61A 3AEJA 3BWOA 1C7OA 3PJ0A 1M0NA 2FNUA 3BCAA 3ELPA 5D5SA 2BWNA 2PB2A 1OXOA 1IX8A 2VI9A 4LC3A 3MKJA 3LVKA 3FVUA 3LVJA 1UU2A 1M7YA 1MDOA 4F5JA 2D7ZA 3ZZJA 2CANA 3FTBA 3K28A 3NYTA 3PIUA 4ZASA 3F9TA 2C0RA 3FDBA 3E2ZA 3PD6B 4ISYA 4IXSA 1VJOA 4GDYA 1BKGA 5HXXA 1GDEA 4BA5A 1CZCA 5J8QA 3FFRA 2DKJA 4GSAA 1B9IA 2W8JA 4EMYA 2VMXA 3W1JA 1AMQA 1AHEA 1WYUB 4ZDOA 2FYFA 2BIAA 3WGBA 1BT4A 1DGEA 1O4SA 2EH6A 2YRIA 3AEMC 3LVLB 4XK1A 4W1VA 2BWOA 4XJLA 3F6TA 1MLYA 1RV4A 2VMOA 3DODA 3G7QA 2AY5A 4MY5A 1CL1A 1MLZA 5M4DA 5EAVA 3MAFA 3TFUA 1ASGA 1GD9A 5K8BA 4WYAA 2HOYA 2VGWA 3TQXA 4MQPA 2D5YA 1B5OA 3N0LA 1W3UA 3LY1A 5F8VA 1RVUA 4F5IA 1D7UA 3AEOA 2AY8A 2W8WA 1GC2A 3ZRQA 3JWBA 4RAEA 2BYLA 3P6KA 3PAAA 4DBCA 1JF9A 1AKAA 3FRKA 4LNLA 4F5GA 1E5EA 1BW0A 3HDOA 8AATA 5TF5A 4PIWA 2GMSA 4ITGA 5KTBA 4OBUA 4PFNA 3A8UX 2HUUA 1JS3A 4RJ0A 2Z9WA 1ASMA 4I8AA 1IAYA 1LKCA 3E9KA 3NUIA 4A0RA 1I29A 4W8IA 4AO9A 4H63Q 2D63A 1PMMA 2EPJA 2VMWA 3NU7A 4ITXA 4UQVA 1AJSB 1QIRA 2E7IA 5LHAA 3EI7A 3RCHB 4XQ2A 1AX4A 1MGVA 5G2QA 2YKXA 1GBNA 2ZY2A 2VMTA 1FG7A 4JE5A 2QA3A 1X29A 4A0GA 1IX7A 1LW4A 3HMUA 5EIGB 1TOEA 1O62A 1W7MA 3NTJA 4WYGA 4UHNA 5E5IA 2HUIA 3PD6A 2EZ2A 4EB7A 1IX6A 1H0CA 3BB8A 3PPLA 4BHDA 3AEJC 4R5FA 4PVFA 1J04A 1WYVB 4RLGA 3TATA 3ZRPA 4U1TA 1RV3A 5DJ9A 5DB5A 1X2AA 3N5MA 1CQ6A 3A9YA 3MAUA 4M2KA 2FN6A 1IVRA 2W7MA 5M49A 2BI5A 2VYCA 4MQQA 3QBOA 2D61A 3DXWA 4GE9A 2ZSMA 2YKYA 4WBTA 1W23A 3PA9A 4QGRA 5HDMA 4A6TA 3DR4A 1FG3A 2VMPA 4Y0DA 3VP6A 4RKCA 1U08A 4JEWA 2DR1A 4LW2A 1D2FA 2X3LA 3LVMA 1D7SA 1ARTA 2G7JA 4E77A 2NMPA 7AATA 2VGZA 2DGMA 3RUYA 2O1BA 4N0WA 1ARGA 5FT5A 5F9SA 1S0AA 2AY2A 2JISA 2VGSA 4TV7A 1AMAA 5C6UA 1W7LA 5I92A 2W7DA 2ZP7A 3B1EA 3DC1A 2Z1YA 3DR7A 3GZCA 1CS1A 1M0OA 1O61A 4AOAA 4A6UA 1G4VA 5FT8A 1AHGA 2PB0A 1Z3ZA 3P1TA 1N2TA 1ASLA 1BS0A 5G09A 2PO3A 1PFFA 2VGVA 3AENB 1BJWA 1YIZA 1X0MA 4R2NA 2EYQA 3FCRA 4IXOA 4AZJA 3NUBA 2AY4A 2YCPA 1AY4A 1AJSA 1ARHA 3CQ5A 3RCHA 4NOGA 4ZDPA 1W7NA 5E3KA 2Z9VA 3MC6A 1S07A 2VMSA 3EIAA 4R5ZA 3AATA 4RM1A 1WSTA 5EIGA 3LG0A 4MKJA 3AOVA 4F5HA 1CQ7A 1SVVA 1QJ3A 4O6ZA 3WX9A 2VLHA 4F5KA 3NNKA 2W8VA 2D65A 1QJ5A 2E7JA 4MQRA 5FT6A 2VGUA 4BMKA 1WYVA 4ZDLA 2VI8A 1AY8A 3UWCA 4J8LA 2QSRA 4CBRA 1LS3A 4WP0A 1B4XA 5M4BA 1YIYA 3ATHA 2WK9A 3GETA 3EI9A 2VMRA 4OC9A 4PFFA 1RVYA 2Z9UA 3AV7A 4E3RA 3FZ8A 3QHXA 1SZKA 3DU4A 3EI5A 5DJ1A 3DXVA 1IJIA 3EI8A 3R4TA 2ZC0A 4JEYA 3JWAA 2CJDA 4WYFA 4FFCA 3EIBA 4OMAA 4A00A 2WB6A 2C7TA 3BCXA 1S08A 3PDBB 4XJMA 1AIAA 2AY9A 3NX3A 4XJOA 1BQAA 1CQ8A 2EZ1A 3BC8A 1YAAA 2CJGA 4K05A 3FQ8A 3B1DA 4OBVA 2AEVA 4TMRA 2Q7WA 2AEUA 4WB0B 2E7UA 2VMVA 1V72A 3EI6A 2HORA 1S06A 3K7YA 1DJUA 3QM2A 4HF8A 3R9AA 4IYOB 3RBLA 3ISLA 4ZM3A 2D66A 1Z7DA 2BWPA 3IHJA 3WGCA 4EFFA 4W5KA 2OKKA 3AENA 1V2FA 2BI1A 3FQ7A 2Z20A 5FT4A 2D64A 3AELA 1WYTB 1KL1A 4JF0A 1IUGA 3N7NA 1C7NA 4RIZA 4RJYA 2JJEA 1O69A 1M4NA 2FQ6A 3NYUA 1AMRA 1EQBA 2VIBA 3AEPA 4WXGA 3FQAA 4CBSA 2CSTA 4R8DA 4DGTA 3II0A 3HBXA 2C44A 2AY1A 2BI9A 1BJNA 2OGEA 1TOGA 3H7FA 1AAMA 2CJHA 1YJSA 5E4ZA 2YOBA 1UKJA 4ADDA 4ZAHA 1G4XA 2ZJGA 4CXQA 1OHYA 3VK2A 1M32A 4ADCA 3N4RA 3EUCA 4WD2A 3JTXA 1MDXA 1AHYA 2ORDA 3FD0A 4WLHA 1YNUA 4WXBA 1IBJA 3GZDA 1OHVA 2BHXA 2CTZA 2ZYJA 1YJZA 2VMYA 2W7EA 4JEZA 3MC6C 5G2PA 3BV0A 4JE5D 4MGRA 4B9BA 2YCNA 4BQ0A 2AY3A 1MAQA 1WYUA 1MAPA 2R0TA 2WK8A 2R5EA 2W7GA 4AH3A 4EB5A 1TPLA 4ZSYA 1G7WA 4Y0IA 1WKHA 3AOWA 1LC5A 2JG2A 3DZZA 2ZY3A 3WKRA 1AKCA 2VLFA 1B8GA 2ZUKA 3FZ6A 4BA4A 4XJPA 5G4JA 1C9CA 3PDBA 3UE8A 1AIBA 3VK4A 1PMOA 3FFHA 5EUEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N31 A;  2G6W A;  2C81 A;  1ASN A;  4WB0 A;  3HL2 A;  2BKW A;  3ELE A;  3OKS A;  1GC4 A;  4IYO A;  4OT8 A;  4W1X A;  3B1C A;  2TPL A;  3LWS A;  4RKD A;  2VMZ A;  1ZC9 A;  1DJ9 A;  2D7Y A;  3GR9 A;  1WYT A;  1VP4 A;  3VK3 A;  5M46 A;  2HOZ A;  1ORD A;  1SZU A;  3IF2 A;  3ZZK A;  1X28 A;  1AAW A;  1I48 A;  2YCT A;  1AY5 A;  1DJE A;  2YKU A;  4LW4 A;  4LNJ A;  3M5U A;  1TAT A;  4Q76 A;  3USF A;  3H14 A;  4CVQ A;  2VMQ A;  1KMK A;  1MDZ A;  1TAR A;  1ASB A;  3OP7 A;  1PG8 A;  2OKJ A;  3RI6 A;  3W1I A;  3I4J A;  4OCA A;  4WLJ A;  3FKD A;  3EZS A;  2VGT A;  4KYO A;  3CQ4 A;  3FVS A;  1AMS A;  4EU1 A;  5JAY A;  1N8P A;  4IX8 A;  4UOY A;  2EGY A;  4L0O A;  2HZP A;  5EQC A;  5IWQ A;  1ASF A;  4FL0 A;  1DKA A;  1SPA A;  4WYE A;  1ZOB A;  2CB1 A;  3G0T A;  3MAD A;  4LNM A;  1ZOD A;  1TAS A;  3I16 A;  1VEF A;  1B9H A;  4ZWV A;  1UU0 A;  4ZLV A;  4K2I A;  1GEX A;  5D95 A;  4M2M A;  4XEW A;  2GMU A;  1B5P A;  3ASB A;  1AIC A;  2HUF A;  4GE7 A;  4XAU A;  3B46 A;  4A72 A;  3TCM A;  3L8A A;  3PDX A;  3BS8 A;  4AO4 A;  2OQX A;  3A9Z A;  2Z1Z A;  1AJR A;  1DGD A;  4P7Y A;  1BQD A;  2BI2 A;  3HT4 A;  4WYC A;  2R5C B;  4GEB A;  4OYT A;  3DRD A;  3GWP A;  4JF1 A;  4ZSW A;  5HHY A;  3L44 A;  2AY6 A;  3GJU A;  4MKK A;  1C4K A;  1CZE A;  2FM1 A;  3EZ1 A;  3GZD C;  3K40 A;  4ATQ A;  4AZK A;  1C7G A;  3A2B A;  3F0H A;  2JJF A;  2W7K A;  2DGL A;  3CQ6 A;  2W7I A;  1ELU A;  1D7R A;  3B8X A;  1G7X A;  1KKJ A;  2F8J A;  4Q31 A;  1ASE A;  4GE4 A;  3WKS A;  1C0N A;  1H1C A;  3COG A;  3W1H A;  4MSO A;  2ZSL A;  1GC3 A;  2O7C A;  1QIT A;  2W7H A;  1J32 A;  2BIG A;  3E2F A;  5EAA A;  2Z9X A;  5EUN A;  3Q8N A;  4DQ6 A;  4OTL A;  3QPG A;  4KAM A;  2CH1 A;  1ASC A;  3BCB A;  3KKI A;  4F4E A;  3FDD A;  1E5F A;  2W8U A;  4RIT A;  1GCK A;  4F5L A;  3UAK A;  1S09 A;  2CFB A;  1BJO B;  1ARS A;  3HVY A;  2Z67 A;  1GEY A;  1CJ0 A;  1SF2 A;  2OAT A;  1SZS A;  1TOI A;  1YOO A;  2JJG A;  4E3Q A;  2JGT A;  2R2N A;  2HP2 A;  4Q75 A;  4Q6R A;  2DOU A;  2BYJ A;  2YKV A;  3FVX A;  4UHM A;  2V1P A;  1ECX A;  2OGA A;  1M6S A;  3A9X A;  2AY7 A;  3MBB A;  1YJY A;  1LC8 A;  2WK7 A;  3MEB A;  4N0B A;  1QZ9 A;  2WKA A;  1WKG A;  3ASA A;  3QI6 A;  1XEY A;  1Y4I A;  2W7J A;  1M0P A;  3N75 A;  3NU8 A;  3WCN A;  3LV2 A;  1TOK A;  4IW7 A;  1TOJ A;  4H51 A;  1I41 A;  2YHK A;  3WY7 A;  3D6K A;  4J5U A;  1JG8 A;  3WLX A;  5G0A A;  2VMN A;  3VOM A;  2CH2 A;  2BIE A;  2W7L A;  2R5C A;  1FC4 A;  4F5M A;  4TN4 A;  1AHF A;  4KXK A;  3NYS A;  1LW5 A;  4GRX A;  1ELQ A;  3DYD A;  1OXP A;  3KGX A;  4W91 A;  5EFS A;  1ARI A;  3E6G A;  3NRA A;  2X5D A;  5DX5 A;  1V2D A;  2GB3 A;  3AEM A;  4ZWM A;  3CAI A;  1KMJ A;  2GSA A;  4WXF A;  1DFO A;  1KL2 A;  3QGU A;  1JS6 A;  3BWN C;  1QIS A;  2CIN A;  2QLR A;  2QBT A;  5G4I A;  1BJ4 A;  3JW9 A;  2XH1 A;  4JEX A;  3FSL A;  4ADE A;  3PGY A;  3E2Z B;  3RQ1 A;  4ATP A;  3HLM A;  1LC7 A;  2BI3 A;  2DKB A;  1M0Q A;  3WZF A;  5BJ4 A;  2E54 A;  1T3I A;  2JJH A;  3E2Y A;  2HOX A;  4IXZ A;  2EO5 A;  1CL2 A;  1P3W A;  3ZRR A;  2W7F A;  1LK9 A;  4F5F A;  2QB2 A;  2AAT A;  3NDN A;  1OHW A;  1BJO A;  1KKP A;  1AHX A;  2RFV A;  1DTY A;  9AAT A;  4HVK A;  4WYD A;  3E77 A;  2GQN A;  1IAX A;  1I43 A;  2ZY4 A;  3TFT A;  3MAF B;  5BJ3 A;  2VMU A;  2HP1 A;  2QB3 A;  4ZM4 A;  3FZ7 A;  4M2J A;  5AX8 A;  2O0R A;  3WCO A;  2V0Y A;  3VAX A;  2QMA A;  2ZY5 A;  3T32 A;  2X8U A;  1D7V A;  4IY7 A;  2XBN A;  1EJI A;  3G8M A;  4A0H A;  3GSB A;  4E1O A;  3RBF A;  4UHO A;  1EG5 A;  1ASA A;  3JZL A;  4U2H A;  2CY8 A;  2VIA A;  4W1W A;  4P3M A;  2DGK A;  4JEV A;  4CXR A;  5LH9 A;  1QGN A;  3GBX A;  1GC0 A;  4K2B A;  3KE3 A;  3CBF A;  4A6R A;  1AKB A;  4ADB A;  2X5F A;  2YRR A;  4Y0H A;  3ECD A;  4B98 A;  2W8T A;  3KGW A;  1OAT A;  1GEW A;  3QN6 A;  5EUD A;  1SFF A;  1UU1 A;  3BN1 A;  3HQT A;  4K2M A;  3ACZ A;  3BWN A;  4A0F A;  3JU7 A;  1XI9 A;  2FNI A;  3I5T A;  1ASD A;  1V2E A;  2Z61 A;  3AEJ A;  3BWO A;  1C7O A;  3PJ0 A;  1M0N A;  2FNU A;  3BCA A;  3ELP A;  5D5S A;  2BWN A;  2PB2 A;  1OXO A;  1IX8 A;  2VI9 A;  4LC3 A;  3MKJ A;  3LVK A;  3FVU A;  3LVJ A;  1UU2 A;  1M7Y A;  1MDO A;  4F5J A;  2D7Z A;  3ZZJ A;  2CAN A;  3FTB A;  3K28 A;  3NYT A;  3PIU A;  4ZAS A;  3F9T A;  2C0R A;  3FDB A;  3E2Z A;  3PD6 B;  4ISY A;  4IXS A;  1VJO A;  4GDY A;  1BKG A;  5HXX A;  1GDE A;  4BA5 A;  1CZC A;  5J8Q A;  3FFR A;  2DKJ A;  4GSA A;  1B9I A;  2W8J A;  4EMY A;  2VMX A;  3W1J A;  1AMQ A;  1AHE A;  1WYU B;  4ZDO A;  2FYF A;  2BIA A;  3WGB A;  1BT4 A;  1DGE A;  1O4S A;  2EH6 A;  2YRI A;  3AEM C;  3LVL B;  4XK1 A;  4W1V A;  2BWO A;  4XJL A;  3F6T A;  1MLY A;  1RV4 A;  2VMO A;  3DOD A;  3G7Q A;  2AY5 A;  4MY5 A;  1CL1 A;  1MLZ A;  5M4D A;  5EAV A;  3MAF A;  3TFU A;  1ASG A;  1GD9 A;  5K8B A;  4WYA A;  2HOY A;  2VGW A;  3TQX A;  4MQP A;  2D5Y A;  1B5O A;  3N0L A;  1W3U A;  3LY1 A;  5F8V A;  1RVU A;  4F5I A;  1D7U A;  3AEO A;  2AY8 A;  2W8W A;  1GC2 A;  3ZRQ A;  3JWB A;  4RAE A;  2BYL A;  3P6K A;  3PAA A;  4DBC A;  1JF9 A;  1AKA A;  3FRK A;  4LNL A;  4F5G A;  1E5E A;  1BW0 A;  3HDO A;  8AAT A;  5TF5 A;  4PIW A;  2GMS A;  4ITG A;  4OBU A;  4PFN A;  3A8U X;  2HUU A;  1JS3 A;  4RJ0 A;  2Z9W A;  1ASM A;  4I8A A;  1IAY A;  1LKC A;  3E9K A;  3NUI A;  4A0R A;  1I29 A;  4W8I A;  4AO9 A;  2D63 A;  1PMM A;  2EPJ A;  2VMW A;  3NU7 A;  4ITX A;  4UQV A;  1AJS B;  1QIR A;  2E7I A;  5LHA A;  3EI7 A;  3RCH B;  4XQ2 A;  1AX4 A;  1MGV A;  5G2Q A;  2YKX A;  1GBN A;  2ZY2 A;  2VMT A;  1FG7 A;  4JE5 A;  2QA3 A;  1X29 A;  4A0G A;  1IX7 A;  1LW4 A;  3HMU A;  5EIG B;  1TOE A;  1O62 A;  1W7M A;  3NTJ A;  4WYG A;  4UHN A;  5E5I A;  2HUI A;  3PD6 A;  2EZ2 A;  4EB7 A;  1IX6 A;  1H0C A;  3BB8 A;  3PPL A;  4BHD A;  3AEJ C;  4R5F A;  4PVF A;  1J04 A;  1WYV B;  4RLG A;  3TAT A;  3ZRP A;  4U1T A;  1RV3 A;  5DJ9 A;  5DB5 A;  1X2A A;  3N5M A;  1CQ6 A;  3A9Y A;  3MAU A;  4M2K A;  2FN6 A;  1IVR A;  2W7M A;  5M49 A;  2BI5 A;  2VYC A;  4MQQ A;  3QBO A;  2D61 A;  3DXW A;  4GE9 A;  2ZSM A;  2YKY A;  4WBT A;  1W23 A;  3PA9 A;  4QGR A;  5HDM A;  4A6T A;  3DR4 A;  1FG3 A;  2VMP A;  4Y0D A;  3VP6 A;  4RKC A;  1U08 A;  4JEW A;  2DR1 A;  4LW2 A;  1D2F A;  2X3L A;  3LVM A;  1D7S A;  1ART A;  4E77 A;  2NMP A;  7AAT A;  2VGZ A;  2DGM A;  3RUY A;  2O1B A;  4N0W A;  1ARG A;  5FT5 A;  5F9S A;  1S0A A;  2AY2 A;  2JIS A;  2VGS A;  4TV7 A;  1AMA A;  5C6U A;  1W7L A;  5I92 A;  2W7D A;  2ZP7 A;  3B1E A;  3DC1 A;  2Z1Y A;  3DR7 A;  3GZC A;  1CS1 A;  1M0O A;  1O61 A;  4AOA A;  4A6U A;  1G4V A;  5FT8 A;  1AHG A;  2PB0 A;  1Z3Z A;  3P1T A;  1N2T A;  1ASL A;  1BS0 A;  5G09 A;  2PO3 A;  1PFF A;  2VGV A;  3AEN B;  1BJW A;  1YIZ A;  1X0M A;  4R2N A;  3FCR A;  4IXO A;  4AZJ A;  3NUB A;  2AY4 A;  2YCP A;  1AY4 A;  1AJS A;  1ARH A;  3CQ5 A;  3RCH A;  4NOG A;  4ZDP A;  1W7N A;  5E3K A;  2Z9V A;  3MC6 A;  1S07 A;  2VMS A;  3EIA A;  4R5Z A;  3AAT A;  4RM1 A;  1WST A;  5EIG A;  3LG0 A;  4MKJ A;  3AOV A;  4F5H A;  1CQ7 A;  1SVV A;  1QJ3 A;  4O6Z A;  3WX9 A;  2VLH A;  4F5K A;  3NNK A;  2W8V A;  2D65 A;  1QJ5 A;  2E7J A;  4MQR A;  5FT6 A;  2VGU A;  4BMK A;  1WYV A;  4ZDL A;  2VI8 A;  1AY8 A;  3UWC A;  4J8L A;  4CBR A;  1LS3 A;  4WP0 A;  1B4X A;  5M4B A;  1YIY A;  3ATH A;  2WK9 A;  3GET A;  3EI9 A;  2VMR A;  4OC9 A;  4PFF A;  1RVY A;  2Z9U A;  3AV7 A;  4E3R A;  3FZ8 A;  3QHX A;  1SZK A;  3DU4 A;  3EI5 A;  5DJ1 A;  3DXV A;  1IJI A;  3EI8 A;  3R4T A;  2ZC0 A;  4JEY A;  3JWA A;  2CJD A;  4WYF A;  4FFC A;  3EIB A;  4OMA A;  4A00 A;  2C7T A;  3BCX A;  1S08 A;  3PDB B;  4XJM A;  1AIA A;  2AY9 A;  3NX3 A;  4XJO A;  1BQA A;  1CQ8 A;  2EZ1 A;  3BC8 A;  1YAA A;  2CJG A;  3FQ8 A;  3B1D A;  4OBV A;  2AEV A;  4TMR A;  2Q7W A;  2AEU A;  4WB0 B;  2E7U A;  2VMV A;  1V72 A;  3EI6 A;  2HOR A;  1S06 A;  3K7Y A;  1DJU A;  3QM2 A;  4HF8 A;  3R9A A;  4IYO B;  3RBL A;  3ISL A;  4ZM3 A;  2D66 A;  1Z7D A;  2BWP A;  3IHJ A;  3WGC A;  4EFF A;  4W5K A;  2OKK A;  3AEN A;  1V2F A;  2BI1 A;  3FQ7 A;  2Z20 A;  5FT4 A;  2D64 A;  3AEL A;  1WYT B;  1KL1 A;  4JF0 A;  1IUG A;  1C7N A;  4RIZ A;  4RJY A;  2JJE A;  1O69 A;  1M4N A;  2FQ6 A;  3NYU A;  1AMR A;  1EQB A;  2VIB A;  3AEP A;  4WXG A;  3FQA A;  4CBS A;  2CST A;  4R8D A;  4DGT A;  3II0 A;  3HBX A;  2C44 A;  2AY1 A;  2BI9 A;  1BJN A;  2OGE A;  1TOG A;  3H7F A;  1AAM A;  2CJH A;  1YJS A;  5E4Z A;  2YOB A;  1UKJ A;  4ADD A;  4ZAH A;  1G4X A;  2ZJG A;  4CXQ A;  1OHY A;  3VK2 A;  1M32 A;  4ADC A;  3EUC A;  4WD2 A;  3JTX A;  1MDX A;  1AHY A;  2ORD A;  3FD0 A;  4WLH A;  1YNU A;  4WXB A;  1IBJ A;  3GZD A;  1OHV A;  2BHX A;  2CTZ A;  2ZYJ A;  1YJZ A;  2VMY A;  2W7E A;  4JEZ A;  3MC6 C;  5G2P A;  3BV0 A;  4JE5 D;  4MGR A;  4B9B A;  2YCN A;  4BQ0 A;  2AY3 A;  1MAQ A;  1WYU A;  1MAP A;  2R0T A;  2WK8 A;  2R5E A;  2W7G A;  4AH3 A;  4EB5 A;  1TPL A;  4ZSY A;  1G7W A;  4Y0I A;  1WKH A;  3AOW A;  1LC5 A;  2JG2 A;  3DZZ A;  2ZY3 A;  3WKR A;  1AKC A;  2VLF A;  1B8G A;  2ZUK A;  3FZ6 A;  4BA4 A;  4XJP A;  5G4J A;  1C9C A;  3PDB A;  3UE8 A;  1AIB A;  3VK4 A;  1PMO A;  3FFH A;  5EUE A; 
#chains in the Genus database with same CATH topology
 1N31 A;  2G6W A;  2A1V A;  2C81 A;  1ASN A;  4WB0 A;  3HL2 A;  2BKW A;  3ELE A;  3OKS A;  1GC4 A;  4IYO A;  4OT8 A;  4W1X A;  3B1C A;  2TPL A;  3LWS A;  4RKD A;  2VMZ A;  1ZC9 A;  1DJ9 A;  2D7Y A;  3GR9 A;  1WYT A;  1VP4 A;  3VK3 A;  5M46 A;  2HOZ A;  1ORD A;  1SZU A;  3IF2 A;  3ZZK A;  1X28 A;  1AAW A;  1I48 A;  2YCT A;  1AY5 A;  1DJE A;  2YKU A;  4LW4 A;  4LNJ A;  3M5U A;  1TAT A;  4Q76 A;  3USF A;  3H14 A;  4CVQ A;  2VMQ A;  1KMK A;  1MDZ A;  1TAR A;  1ASB A;  3OP7 A;  1PG8 A;  2OKJ A;  3RI6 A;  3W1I A;  3I4J A;  4OCA A;  4WLJ A;  3FKD A;  3EZS A;  2VGT A;  4KYO A;  3CQ4 A;  3FVS A;  3N4X A;  1AMS A;  4EU1 A;  5JAY A;  1N8P A;  4IX8 A;  4UOY A;  2EGY A;  4L0O A;  2HZP A;  5EQC A;  5IWQ A;  1ASF A;  4FL0 A;  1DKA A;  1SPA A;  4WYE A;  1ZOB A;  2CB1 A;  3G0T A;  3MAD A;  4LNM A;  1ZOD A;  1TAS A;  3I16 A;  1VEF A;  1B9H A;  4ZWV A;  1UU0 A;  4ZLV A;  4K2I A;  1GEX A;  5D95 A;  4M2M A;  4XEW A;  2GMU A;  1B5P A;  3ASB A;  1AIC A;  2HUF A;  4GE7 A;  4XAU A;  3B46 A;  4A72 A;  3TCM A;  3L8A A;  3PDX A;  3BS8 A;  4AO4 A;  2OQX A;  3A9Z A;  2Z1Z A;  1AJR A;  1DGD A;  4P7Y A;  1BQD A;  2BI2 A;  3HT4 A;  4WYC A;  2R5C B;  4GEB A;  4OYT A;  3DRD A;  3GWP A;  4JF1 A;  4ZSW A;  5HHY A;  3L44 A;  2AY6 A;  3GJU A;  4MKK A;  1C4K A;  1CZE A;  2FM1 A;  3EZ1 A;  3GZD C;  3K40 A;  4ATQ A;  4AZK A;  1C7G A;  3A2B A;  3F0H A;  2JJF A;  2W7K A;  2DGL A;  3CQ6 A;  2W7I A;  1ELU A;  2FKI A;  1D7R A;  3B8X A;  1G7X A;  3N4S A;  1KKJ A;  2F8J A;  4Q31 A;  1ASE A;  4GE4 A;  3WKS A;  1C0N A;  1H1C A;  3COG A;  3W1H A;  4MSO A;  2ZSL A;  1GC3 A;  2O7C A;  1QIT A;  2W7H A;  1J32 A;  2BIG A;  3E2F A;  5EAA A;  2Z9X A;  5EUN A;  3Q8N A;  4DQ6 A;  4OTL A;  3QPG A;  2KFP A;  4KAM A;  2CH1 A;  1ASC A;  3BCB A;  3KKI A;  4F4E A;  3FDD A;  1E5F A;  2W8U A;  4RIT A;  1GCK A;  4F5L A;  3UAK A;  1S09 A;  2CFB A;  1BJO B;  1ARS A;  3HVY A;  2Z67 A;  1GEY A;  1CJ0 A;  1SF2 A;  2OAT A;  1SZS A;  1TOI A;  1YOO A;  2JJG A;  4E3Q A;  2JGT A;  2R2N A;  2HP2 A;  4Q75 A;  4Q6R A;  2DOU A;  2BYJ A;  2YKV A;  3FVX A;  4UHM A;  2V1P A;  1ECX A;  2OGA A;  1M6S A;  3A9X A;  2AY7 A;  3MBB A;  1YJY A;  1LC8 A;  2WK7 A;  3MEB A;  4N0B A;  1QZ9 A;  2WKA A;  1WKG A;  3ASA A;  3QI6 A;  1XEY A;  1Y4I A;  2W7J A;  1M0P A;  3N75 A;  3NU8 A;  3WCN A;  3LV2 A;  1TOK A;  4IW7 A;  1TOJ A;  4H51 A;  1I41 A;  2YHK A;  3WY7 A;  3D6K A;  4J5U A;  1JG8 A;  3WLX A;  5G0A A;  2VMN A;  3VOM A;  2CH2 A;  2BIE A;  2W7L A;  2R5C A;  1FC4 A;  4F5M A;  4TN4 A;  1AHF A;  4KXK A;  3NYS A;  1LW5 A;  4GRX A;  1ELQ A;  3DYD A;  1OXP A;  3KGX A;  4W91 A;  5EFS A;  1ARI A;  3E6G A;  3NRA A;  2X5D A;  5DX5 A;  1V2D A;  2GB3 A;  3AEM A;  4ZWM A;  3CAI A;  1KMJ A;  2GSA A;  4WXF A;  1DFO A;  1KL2 A;  3QGU A;  1JS6 A;  3BWN C;  1QIS A;  2CIN A;  2QLR A;  2QBT A;  5G4I A;  1BJ4 A;  3JW9 A;  2XH1 A;  4JEX A;  3FSL A;  4ADE A;  3PGY A;  3E2Z B;  3RQ1 A;  4ATP A;  3HLM A;  1LC7 A;  2BI3 A;  2DKB A;  1M0Q A;  3WZF A;  5BJ4 A;  2E54 A;  1T3I A;  2JJH A;  3E2Y A;  2HOX A;  4IXZ A;  2EO5 A;  1CL2 A;  1P3W A;  3ZRR A;  2W7F A;  1LK9 A;  4F5F A;  2QB2 A;  2AAT A;  3NDN A;  1OHW A;  1BJO A;  1KKP A;  1AHX A;  2RFV A;  1DTY A;  9AAT A;  4HVK A;  4WYD A;  3E77 A;  2GQN A;  1IAX A;  1I43 A;  2ZY4 A;  3TFT A;  3MAF B;  5BJ3 A;  2VMU A;  2HP1 A;  2QB3 A;  4ZM4 A;  3FZ7 A;  4M2J A;  5AX8 A;  2O0R A;  3WCO A;  2V0Y A;  3VAX A;  2QMA A;  2ZY5 A;  3T32 A;  2X8U A;  1D7V A;  4IY7 A;  2XBN A;  1EJI A;  3G8M A;  4A0H A;  3GSB A;  4E1O A;  3RBF A;  4UHO A;  1EG5 A;  1ASA A;  3JZL A;  4U2H A;  2CY8 A;  2VIA A;  3H9X A;  4W1W A;  4P3M A;  2DGK A;  4JEV A;  4CXR A;  5LH9 A;  1QGN A;  3GBX A;  1GC0 A;  4K2B A;  3KE3 A;  3CBF A;  4A6R A;  1AKB A;  4ADB A;  2X5F A;  2YRR A;  4Y0H A;  3ECD A;  4B98 A;  2W8T A;  3KGW A;  1OAT A;  1GEW A;  3QN6 A;  5EUD A;  1SFF A;  1UU1 A;  3BN1 A;  3HQT A;  4K2M A;  3ACZ A;  3BWN A;  4A0F A;  3JU7 A;  1XI9 A;  2FNI A;  3I5T A;  1ASD A;  1V2E A;  2Z61 A;  3AEJ A;  3BWO A;  1C7O A;  3PJ0 A;  1M0N A;  2FNU A;  3BCA A;  3ELP A;  5D5S A;  2BWN A;  2PB2 A;  1OXO A;  1IX8 A;  2VI9 A;  4LC3 A;  3MKJ A;  3LVK A;  3FVU A;  3LVJ A;  1UU2 A;  1M7Y A;  1MDO A;  4F5J A;  2D7Z A;  3ZZJ A;  2CAN A;  3FTB A;  3K28 A;  3NYT A;  3PIU A;  4ZAS A;  3F9T A;  2C0R A;  3FDB A;  3E2Z A;  3PD6 B;  4ISY A;  4IXS A;  1VJO A;  4GDY A;  1BKG A;  5HXX A;  1GDE A;  4BA5 A;  1CZC A;  5J8Q A;  3FFR A;  2DKJ A;  4GSA A;  1B9I A;  2W8J A;  4EMY A;  2VMX A;  3W1J A;  1AMQ A;  1AHE A;  1WYU B;  4ZDO A;  2FYF A;  2BIA A;  3WGB A;  1BT4 A;  1DGE A;  1O4S A;  2EH6 A;  2YRI A;  3AEM C;  3LVL B;  4XK1 A;  4W1V A;  2BWO A;  4XJL A;  3F6T A;  1MLY A;  1RV4 A;  2VMO A;  3DOD A;  3G7Q A;  2AY5 A;  4MY5 A;  1CL1 A;  1MLZ A;  5M4D A;  5EAV A;  3MAF A;  3TFU A;  1ASG A;  1GD9 A;  5K8B A;  4WYA A;  2HOY A;  2VGW A;  3TQX A;  4MQP A;  2D5Y A;  1B5O A;  1KAF A;  3N0L A;  1W3U A;  3LY1 A;  5F8V A;  1RVU A;  4F5I A;  1D7U A;  3AEO A;  2AY8 A;  2W8W A;  1GC2 A;  3ZRQ A;  3JWB A;  4RAE A;  2BYL A;  3P6K A;  3PAA A;  4DBC A;  1JF9 A;  1AKA A;  3FRK A;  4LNL A;  4F5G A;  1E5E A;  1BW0 A;  3HDO A;  8AAT A;  5TF5 A;  4PIW A;  2GMS A;  4ITG A;  5KTB A;  4OBU A;  4PFN A;  3A8U X;  2HUU A;  1JS3 A;  4RJ0 A;  2Z9W A;  1ASM A;  4I8A A;  1IAY A;  1LKC A;  3E9K A;  3NUI A;  4A0R A;  1I29 A;  4W8I A;  4AO9 A;  4H63 Q;  2D63 A;  1PMM A;  2EPJ A;  2VMW A;  3NU7 A;  4ITX A;  4UQV A;  1AJS B;  1QIR A;  2E7I A;  5LHA A;  3EI7 A;  3RCH B;  4XQ2 A;  1AX4 A;  1MGV A;  5G2Q A;  2YKX A;  1GBN A;  2ZY2 A;  2VMT A;  1FG7 A;  4JE5 A;  2QA3 A;  1X29 A;  4A0G A;  1IX7 A;  1LW4 A;  3HMU A;  5EIG B;  1TOE A;  1O62 A;  1W7M A;  3NTJ A;  4WYG A;  4UHN A;  5E5I A;  2HUI A;  3PD6 A;  2EZ2 A;  4EB7 A;  1IX6 A;  1H0C A;  3BB8 A;  3PPL A;  4BHD A;  3AEJ C;  4R5F A;  4PVF A;  1J04 A;  1WYV B;  4RLG A;  3TAT A;  3ZRP A;  4U1T A;  1RV3 A;  5DJ9 A;  5DB5 A;  1X2A A;  3N5M A;  1CQ6 A;  3A9Y A;  3MAU A;  4M2K A;  2FN6 A;  1IVR A;  2W7M A;  5M49 A;  2BI5 A;  2VYC A;  4MQQ A;  3QBO A;  2D61 A;  3DXW A;  4GE9 A;  2ZSM A;  2YKY A;  4WBT A;  1W23 A;  3PA9 A;  4QGR A;  5HDM A;  4A6T A;  3DR4 A;  1FG3 A;  2VMP A;  4Y0D A;  3VP6 A;  4RKC A;  1U08 A;  4JEW A;  2DR1 A;  4LW2 A;  1D2F A;  2X3L A;  3LVM A;  1D7S A;  1ART A;  2G7J A;  4E77 A;  2NMP A;  7AAT A;  2VGZ A;  2DGM A;  3RUY A;  2O1B A;  4N0W A;  1ARG A;  5FT5 A;  5F9S A;  1S0A A;  2AY2 A;  2JIS A;  2VGS A;  4TV7 A;  1AMA A;  5C6U A;  1W7L A;  5I92 A;  2W7D A;  2ZP7 A;  3B1E A;  3DC1 A;  2Z1Y A;  3DR7 A;  3GZC A;  1CS1 A;  1M0O A;  1O61 A;  4AOA A;  4A6U A;  1G4V A;  5FT8 A;  1AHG A;  2PB0 A;  1Z3Z A;  3P1T A;  1N2T A;  1ASL A;  1BS0 A;  5G09 A;  2PO3 A;  1PFF A;  2VGV A;  3AEN B;  1BJW A;  1YIZ A;  1X0M A;  4R2N A;  2EYQ A;  3FCR A;  4IXO A;  4AZJ A;  3NUB A;  2AY4 A;  2YCP A;  1AY4 A;  1AJS A;  1ARH A;  3CQ5 A;  3RCH A;  4NOG A;  4ZDP A;  1W7N A;  5E3K A;  2Z9V A;  3MC6 A;  1S07 A;  2VMS A;  3EIA A;  4R5Z A;  3AAT A;  4RM1 A;  1WST A;  5EIG A;  3LG0 A;  4MKJ A;  3AOV A;  4F5H A;  1CQ7 A;  1SVV A;  1QJ3 A;  4O6Z A;  3WX9 A;  2VLH A;  4F5K A;  3NNK A;  2W8V A;  2D65 A;  1QJ5 A;  2E7J A;  4MQR A;  5FT6 A;  2VGU A;  4BMK A;  1WYV A;  4ZDL A;  2VI8 A;  1AY8 A;  3UWC A;  4J8L A;  2QSR A;  4CBR A;  1LS3 A;  4WP0 A;  1B4X A;  5M4B A;  1YIY A;  3ATH A;  2WK9 A;  3GET A;  3EI9 A;  2VMR A;  4OC9 A;  4PFF A;  1RVY A;  2Z9U A;  3AV7 A;  4E3R A;  3FZ8 A;  3QHX A;  1SZK A;  3DU4 A;  3EI5 A;  5DJ1 A;  3DXV A;  1IJI A;  3EI8 A;  3R4T A;  2ZC0 A;  4JEY A;  3JWA A;  2CJD A;  4WYF A;  4FFC A;  3EIB A;  4OMA A;  4A00 A;  2WB6 A;  2C7T A;  3BCX A;  1S08 A;  3PDB B;  4XJM A;  1AIA A;  2AY9 A;  3NX3 A;  4XJO A;  1BQA A;  1CQ8 A;  2EZ1 A;  3BC8 A;  1YAA A;  2CJG A;  4K05 A;  3FQ8 A;  3B1D A;  4OBV A;  2AEV A;  4TMR A;  2Q7W A;  2AEU A;  4WB0 B;  2E7U A;  2VMV A;  1V72 A;  3EI6 A;  2HOR A;  1S06 A;  3K7Y A;  1DJU A;  3QM2 A;  4HF8 A;  3R9A A;  4IYO B;  3RBL A;  3ISL A;  4ZM3 A;  2D66 A;  1Z7D A;  2BWP A;  3IHJ A;  3WGC A;  4EFF A;  4W5K A;  2OKK A;  3AEN A;  1V2F A;  2BI1 A;  3FQ7 A;  2Z20 A;  5FT4 A;  2D64 A;  3AEL A;  1WYT B;  1KL1 A;  4JF0 A;  1IUG A;  3N7N A;  1C7N A;  4RIZ A;  4RJY A;  2JJE A;  1O69 A;  1M4N A;  2FQ6 A;  3NYU A;  1AMR A;  1EQB A;  2VIB A;  3AEP A;  4WXG A;  3FQA A;  4CBS A;  2CST A;  4R8D A;  4DGT A;  3II0 A;  3HBX A;  2C44 A;  2AY1 A;  2BI9 A;  1BJN A;  2OGE A;  1TOG A;  3H7F A;  1AAM A;  2CJH A;  1YJS A;  5E4Z A;  2YOB A;  1UKJ A;  4ADD A;  4ZAH A;  1G4X A;  2ZJG A;  4CXQ A;  1OHY A;  3VK2 A;  1M32 A;  4ADC A;  3N4R A;  3EUC A;  4WD2 A;  3JTX A;  1MDX A;  1AHY A;  2ORD A;  3FD0 A;  4WLH A;  1YNU A;  4WXB A;  1IBJ A;  3GZD A;  1OHV A;  2BHX A;  2CTZ A;  2ZYJ A;  1YJZ A;  2VMY A;  2W7E A;  4JEZ A;  3MC6 C;  5G2P A;  3BV0 A;  4JE5 D;  4MGR A;  4B9B A;  2YCN A;  4BQ0 A;  2AY3 A;  1MAQ A;  1WYU A;  1MAP A;  2R0T A;  2WK8 A;  2R5E A;  2W7G A;  4AH3 A;  4EB5 A;  1TPL A;  4ZSY A;  1G7W A;  4Y0I A;  1WKH A;  3AOW A;  1LC5 A;  2JG2 A;  3DZZ A;  2ZY3 A;  3WKR A;  1AKC A;  2VLF A;  1B8G A;  2ZUK A;  3FZ6 A;  4BA4 A;  4XJP A;  5G4J A;  1C9C A;  3PDB A;  3UE8 A;  1AIB A;  3VK4 A;  1PMO A;  3FFH A;  5EUE A; 
#chains in the Genus database with same CATH homology
 1N31 A;  2G6W A;  2A1V A;  2C81 A;  1ASN A;  4WB0 A;  3HL2 A;  2BKW A;  3ELE A;  3OKS A;  1GC4 A;  4IYO A;  4OT8 A;  4W1X A;  3B1C A;  2TPL A;  3LWS A;  4RKD A;  2VMZ A;  1ZC9 A;  1DJ9 A;  2D7Y A;  3GR9 A;  1WYT A;  1VP4 A;  3VK3 A;  5M46 A;  2HOZ A;  1ORD A;  1SZU A;  3IF2 A;  3ZZK A;  1X28 A;  1AAW A;  1I48 A;  2YCT A;  1AY5 A;  1DJE A;  2YKU A;  4LW4 A;  4LNJ A;  3M5U A;  1TAT A;  4Q76 A;  3USF A;  3H14 A;  4CVQ A;  2VMQ A;  1KMK A;  1MDZ A;  1TAR A;  1ASB A;  3OP7 A;  1PG8 A;  2OKJ A;  3RI6 A;  3W1I A;  3I4J A;  4OCA A;  4WLJ A;  3FKD A;  3EZS A;  2VGT A;  4KYO A;  3CQ4 A;  3FVS A;  3N4X A;  1AMS A;  4EU1 A;  5JAY A;  1N8P A;  4IX8 A;  4UOY A;  2EGY A;  4L0O A;  2HZP A;  5EQC A;  5IWQ A;  1ASF A;  4FL0 A;  1DKA A;  1SPA A;  4WYE A;  1ZOB A;  2CB1 A;  3G0T A;  3MAD A;  4LNM A;  1ZOD A;  1TAS A;  3I16 A;  1VEF A;  1B9H A;  4ZWV A;  1UU0 A;  4ZLV A;  4K2I A;  1GEX A;  5D95 A;  4M2M A;  4XEW A;  2GMU A;  1B5P A;  3ASB A;  1AIC A;  2HUF A;  4GE7 A;  4XAU A;  3B46 A;  4A72 A;  3TCM A;  3L8A A;  3PDX A;  3BS8 A;  4AO4 A;  2OQX A;  3A9Z A;  2Z1Z A;  1AJR A;  1DGD A;  4P7Y A;  1BQD A;  2BI2 A;  3HT4 A;  4WYC A;  2R5C B;  4GEB A;  4OYT A;  3DRD A;  3GWP A;  4JF1 A;  4ZSW A;  5HHY A;  3L44 A;  2AY6 A;  3GJU A;  4MKK A;  1C4K A;  1CZE A;  2FM1 A;  3EZ1 A;  3GZD C;  3K40 A;  4ATQ A;  4AZK A;  1C7G A;  3A2B A;  3F0H A;  2JJF A;  2W7K A;  2DGL A;  3CQ6 A;  2W7I A;  1ELU A;  2FKI A;  1D7R A;  3B8X A;  1G7X A;  3N4S A;  1KKJ A;  2F8J A;  4Q31 A;  1ASE A;  4GE4 A;  3WKS A;  1C0N A;  1H1C A;  3COG A;  3W1H A;  4MSO A;  2ZSL A;  1GC3 A;  2O7C A;  1QIT A;  2W7H A;  1J32 A;  2BIG A;  3E2F A;  5EAA A;  2Z9X A;  5EUN A;  3Q8N A;  4DQ6 A;  4OTL A;  3QPG A;  2KFP A;  4KAM A;  2CH1 A;  1ASC A;  3BCB A;  3KKI A;  4F4E A;  3FDD A;  1E5F A;  2W8U A;  4RIT A;  1GCK A;  4F5L A;  3UAK A;  1S09 A;  2CFB A;  1BJO B;  1ARS A;  3HVY A;  2Z67 A;  1GEY A;  1CJ0 A;  1SF2 A;  2OAT A;  1SZS A;  1TOI A;  1YOO A;  2JJG A;  4E3Q A;  2JGT A;  2R2N A;  2HP2 A;  4Q75 A;  4Q6R A;  2DOU A;  2BYJ A;  2YKV A;  3FVX A;  4UHM A;  2V1P A;  1ECX A;  2OGA A;  1M6S A;  3A9X A;  2AY7 A;  3MBB A;  1YJY A;  1LC8 A;  2WK7 A;  3MEB A;  4N0B A;  1QZ9 A;  2WKA A;  1WKG A;  3ASA A;  3QI6 A;  1XEY A;  1Y4I A;  2W7J A;  1M0P A;  3N75 A;  3NU8 A;  3WCN A;  3LV2 A;  1TOK A;  4IW7 A;  1TOJ A;  4H51 A;  1I41 A;  2YHK A;  3WY7 A;  3D6K A;  4J5U A;  1JG8 A;  3WLX A;  5G0A A;  2VMN A;  3VOM A;  2CH2 A;  2BIE A;  2W7L A;  2R5C A;  1FC4 A;  4F5M A;  4TN4 A;  1AHF A;  4KXK A;  3NYS A;  1LW5 A;  4GRX A;  1ELQ A;  3DYD A;  1OXP A;  3KGX A;  4W91 A;  5EFS A;  1ARI A;  3E6G A;  3NRA A;  2X5D A;  5DX5 A;  1V2D A;  2GB3 A;  3AEM A;  4ZWM A;  3CAI A;  1KMJ A;  2GSA A;  4WXF A;  1DFO A;  1KL2 A;  3QGU A;  1JS6 A;  3BWN C;  1QIS A;  2CIN A;  2QLR A;  2QBT A;  5G4I A;  1BJ4 A;  3JW9 A;  2XH1 A;  4JEX A;  3FSL A;  4ADE A;  3PGY A;  3E2Z B;  3RQ1 A;  4ATP A;  3HLM A;  1LC7 A;  2BI3 A;  2DKB A;  1M0Q A;  3WZF A;  5BJ4 A;  2E54 A;  1T3I A;  2JJH A;  3E2Y A;  2HOX A;  4IXZ A;  2EO5 A;  1CL2 A;  1P3W A;  3ZRR A;  2W7F A;  1LK9 A;  4F5F A;  2QB2 A;  2AAT A;  3NDN A;  1OHW A;  1BJO A;  1KKP A;  1AHX A;  2RFV A;  1DTY A;  9AAT A;  4HVK A;  4WYD A;  3E77 A;  2GQN A;  1IAX A;  1I43 A;  2ZY4 A;  3TFT A;  3MAF B;  5BJ3 A;  2VMU A;  2HP1 A;  2QB3 A;  4ZM4 A;  3FZ7 A;  4M2J A;  5AX8 A;  2O0R A;  3WCO A;  2V0Y A;  3VAX A;  2QMA A;  2ZY5 A;  3T32 A;  2X8U A;  1D7V A;  4IY7 A;  2XBN A;  1EJI A;  3G8M A;  4A0H A;  3GSB A;  4E1O A;  3RBF A;  4UHO A;  1EG5 A;  1ASA A;  3JZL A;  4U2H A;  2CY8 A;  2VIA A;  3H9X A;  4W1W A;  4P3M A;  2DGK A;  4JEV A;  4CXR A;  5LH9 A;  1QGN A;  3GBX A;  1GC0 A;  4K2B A;  3KE3 A;  3CBF A;  4A6R A;  1AKB A;  4ADB A;  2X5F A;  2YRR A;  4Y0H A;  3ECD A;  4B98 A;  2W8T A;  3KGW A;  1OAT A;  1GEW A;  3QN6 A;  5EUD A;  1SFF A;  1UU1 A;  3BN1 A;  3HQT A;  4K2M A;  3ACZ A;  3BWN A;  4A0F A;  3JU7 A;  1XI9 A;  2FNI A;  3I5T A;  1ASD A;  1V2E A;  2Z61 A;  3AEJ A;  3BWO A;  1C7O A;  3PJ0 A;  1M0N A;  2FNU A;  3BCA A;  3ELP A;  5D5S A;  2BWN A;  2PB2 A;  1OXO A;  1IX8 A;  2VI9 A;  4LC3 A;  3MKJ A;  3LVK A;  3FVU A;  3LVJ A;  1UU2 A;  1M7Y A;  1MDO A;  4F5J A;  2D7Z A;  3ZZJ A;  2CAN A;  3FTB A;  3K28 A;  3NYT A;  3PIU A;  4ZAS A;  3F9T A;  2C0R A;  3FDB A;  3E2Z A;  3PD6 B;  4ISY A;  4IXS A;  1VJO A;  4GDY A;  1BKG A;  5HXX A;  1GDE A;  4BA5 A;  1CZC A;  5J8Q A;  3FFR A;  2DKJ A;  4GSA A;  1B9I A;  2W8J A;  4EMY A;  2VMX A;  3W1J A;  1AMQ A;  1AHE A;  1WYU B;  4ZDO A;  2FYF A;  2BIA A;  3WGB A;  1BT4 A;  1DGE A;  1O4S A;  2EH6 A;  2YRI A;  3AEM C;  3LVL B;  4XK1 A;  4W1V A;  2BWO A;  4XJL A;  3F6T A;  1MLY A;  1RV4 A;  2VMO A;  3DOD A;  3G7Q A;  2AY5 A;  4MY5 A;  1CL1 A;  1MLZ A;  5M4D A;  5EAV A;  3MAF A;  3TFU A;  1ASG A;  1GD9 A;  5K8B A;  4WYA A;  2HOY A;  2VGW A;  3TQX A;  4MQP A;  2D5Y A;  1B5O A;  3N0L A;  1W3U A;  3LY1 A;  5F8V A;  1RVU A;  4F5I A;  1D7U A;  3AEO A;  2AY8 A;  2W8W A;  1GC2 A;  3ZRQ A;  3JWB A;  4RAE A;  2BYL A;  3P6K A;  3PAA A;  4DBC A;  1JF9 A;  1AKA A;  3FRK A;  4LNL A;  4F5G A;  1E5E A;  1BW0 A;  3HDO A;  8AAT A;  5TF5 A;  4PIW A;  2GMS A;  4ITG A;  5KTB A;  4OBU A;  4PFN A;  3A8U X;  2HUU A;  1JS3 A;  4RJ0 A;  2Z9W A;  1ASM A;  4I8A A;  1IAY A;  1LKC A;  3E9K A;  3NUI A;  4A0R A;  1I29 A;  4W8I A;  4AO9 A;  4H63 Q;  2D63 A;  1PMM A;  2EPJ A;  2VMW A;  3NU7 A;  4ITX A;  4UQV A;  1AJS B;  1QIR A;  2E7I A;  5LHA A;  3EI7 A;  3RCH B;  4XQ2 A;  1AX4 A;  1MGV A;  5G2Q A;  2YKX A;  1GBN A;  2ZY2 A;  2VMT A;  1FG7 A;  4JE5 A;  2QA3 A;  1X29 A;  4A0G A;  1IX7 A;  1LW4 A;  3HMU A;  5EIG B;  1TOE A;  1O62 A;  1W7M A;  3NTJ A;  4WYG A;  4UHN A;  5E5I A;  2HUI A;  3PD6 A;  2EZ2 A;  4EB7 A;  1IX6 A;  1H0C A;  3BB8 A;  3PPL A;  4BHD A;  3AEJ C;  4R5F A;  4PVF A;  1J04 A;  1WYV B;  4RLG A;  3TAT A;  3ZRP A;  4U1T A;  1RV3 A;  5DJ9 A;  5DB5 A;  1X2A A;  3N5M A;  1CQ6 A;  3A9Y A;  3MAU A;  4M2K A;  2FN6 A;  1IVR A;  2W7M A;  5M49 A;  2BI5 A;  2VYC A;  4MQQ A;  3QBO A;  2D61 A;  3DXW A;  4GE9 A;  2ZSM A;  2YKY A;  4WBT A;  1W23 A;  3PA9 A;  4QGR A;  5HDM A;  4A6T A;  3DR4 A;  1FG3 A;  2VMP A;  4Y0D A;  3VP6 A;  4RKC A;  1U08 A;  4JEW A;  2DR1 A;  4LW2 A;  1D2F A;  2X3L A;  3LVM A;  1D7S A;  1ART A;  2G7J A;  4E77 A;  2NMP A;  7AAT A;  2VGZ A;  2DGM A;  3RUY A;  2O1B A;  4N0W A;  1ARG A;  5FT5 A;  5F9S A;  1S0A A;  2AY2 A;  2JIS A;  2VGS A;  4TV7 A;  1AMA A;  5C6U A;  1W7L A;  5I92 A;  2W7D A;  2ZP7 A;  3B1E A;  3DC1 A;  2Z1Y A;  3DR7 A;  3GZC A;  1CS1 A;  1M0O A;  1O61 A;  4AOA A;  4A6U A;  1G4V A;  5FT8 A;  1AHG A;  2PB0 A;  1Z3Z A;  3P1T A;  1N2T A;  1ASL A;  1BS0 A;  5G09 A;  2PO3 A;  1PFF A;  2VGV A;  3AEN B;  1BJW A;  1YIZ A;  1X0M A;  4R2N A;  2EYQ A;  3FCR A;  4IXO A;  4AZJ A;  3NUB A;  2AY4 A;  2YCP A;  1AY4 A;  1AJS A;  1ARH A;  3CQ5 A;  3RCH A;  4NOG A;  4ZDP A;  1W7N A;  5E3K A;  2Z9V A;  3MC6 A;  1S07 A;  2VMS A;  3EIA A;  4R5Z A;  3AAT A;  4RM1 A;  1WST A;  5EIG A;  3LG0 A;  4MKJ A;  3AOV A;  4F5H A;  1CQ7 A;  1SVV A;  1QJ3 A;  4O6Z A;  3WX9 A;  2VLH A;  4F5K A;  3NNK A;  2W8V A;  2D65 A;  1QJ5 A;  2E7J A;  4MQR A;  5FT6 A;  2VGU A;  4BMK A;  1WYV A;  4ZDL A;  2VI8 A;  1AY8 A;  3UWC A;  4J8L A;  2QSR A;  4CBR A;  1LS3 A;  4WP0 A;  1B4X A;  5M4B A;  1YIY A;  3ATH A;  2WK9 A;  3GET A;  3EI9 A;  2VMR A;  4OC9 A;  4PFF A;  1RVY A;  2Z9U A;  3AV7 A;  4E3R A;  3FZ8 A;  3QHX A;  1SZK A;  3DU4 A;  3EI5 A;  5DJ1 A;  3DXV A;  1IJI A;  3EI8 A;  3R4T A;  2ZC0 A;  4JEY A;  3JWA A;  2CJD A;  4WYF A;  4FFC A;  3EIB A;  4OMA A;  4A00 A;  2WB6 A;  2C7T A;  3BCX A;  1S08 A;  3PDB B;  4XJM A;  1AIA A;  2AY9 A;  3NX3 A;  4XJO A;  1BQA A;  1CQ8 A;  2EZ1 A;  3BC8 A;  1YAA A;  2CJG A;  4K05 A;  3FQ8 A;  3B1D A;  4OBV A;  2AEV A;  4TMR A;  2Q7W A;  2AEU A;  4WB0 B;  2E7U A;  2VMV A;  1V72 A;  3EI6 A;  2HOR A;  1S06 A;  3K7Y A;  1DJU A;  3QM2 A;  4HF8 A;  3R9A A;  4IYO B;  3RBL A;  3ISL A;  4ZM3 A;  2D66 A;  1Z7D A;  2BWP A;  3IHJ A;  3WGC A;  4EFF A;  4W5K A;  2OKK A;  3AEN A;  1V2F A;  2BI1 A;  3FQ7 A;  2Z20 A;  5FT4 A;  2D64 A;  3AEL A;  1WYT B;  1KL1 A;  4JF0 A;  1IUG A;  3N7N A;  1C7N A;  4RIZ A;  4RJY A;  2JJE A;  1O69 A;  1M4N A;  2FQ6 A;  3NYU A;  1AMR A;  1EQB A;  2VIB A;  3AEP A;  4WXG A;  3FQA A;  4CBS A;  2CST A;  4R8D A;  4DGT A;  3II0 A;  3HBX A;  2C44 A;  2AY1 A;  2BI9 A;  1BJN A;  2OGE A;  1TOG A;  3H7F A;  1AAM A;  2CJH A;  1YJS A;  5E4Z A;  2YOB A;  1UKJ A;  4ADD A;  4ZAH A;  1G4X A;  2ZJG A;  4CXQ A;  1OHY A;  3VK2 A;  1M32 A;  4ADC A;  3N4R A;  3EUC A;  4WD2 A;  3JTX A;  1MDX A;  1AHY A;  2ORD A;  3FD0 A;  4WLH A;  1YNU A;  4WXB A;  1IBJ A;  3GZD A;  1OHV A;  2BHX A;  2CTZ A;  2ZYJ A;  1YJZ A;  2VMY A;  2W7E A;  4JEZ A;  3MC6 C;  5G2P A;  3BV0 A;  4JE5 D;  4MGR A;  4B9B A;  2YCN A;  4BQ0 A;  2AY3 A;  1MAQ A;  1WYU A;  1MAP A;  2R0T A;  2WK8 A;  2R5E A;  2W7G A;  4AH3 A;  4EB5 A;  1TPL A;  4ZSY A;  1G7W A;  4Y0I A;  1WKH A;  3AOW A;  1LC5 A;  2JG2 A;  3DZZ A;  2ZY3 A;  3WKR A;  1AKC A;  2VLF A;  1B8G A;  2ZUK A;  3FZ6 A;  4BA4 A;  4XJP A;  5G4J A;  1C9C A;  3PDB A;  3UE8 A;  1AIB A;  3VK4 A;  1PMO A;  3FFH A;  5EUE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...