2G6WA

Suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
383
structure length
383
Chain Sequence
SWQEKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Suicide inhibition of alpha-oxamine synthases: structures of the covalent adducts of 8-amino-7-oxononanoate synthase with trifluoroalanine.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 8-amino-7-oxononanoate synthase
total genus 133
structure length 383
sequence length 383
ec nomenclature ec 2.3.1.47: 8-amino-7-oxononanoate synthase.
pdb deposition date 2006-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2g6wA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2g6wA01
3GZCA 1W7NA 3AELA 1WYVA 1MGVA 3WZFA 2BI3A 3AEMA 1DJUA 3IF2A 1V2FA 1MAQA 3F0HA 3EI6A 4W1VA 1D7UA 4TMRA 4H51A 2EPJA 4JE5A 3FZ8A 1N8PA 2CJDA 3BCXA 1M7YA 3RCHB 3WKSA 1M32A 1YAAA 3MKJA 1MLYA 1JG8A 2Q7WA 5F8VA 2W7KA 1ASNA 3AEJA 3AATA 1IAXA 4K2BA 2XBNA 4RLGA 4Y0IA 4RJYA 2DOUA 1MLZA 1YJYA 1QZ9A 3ACZA 3JU7A 3NX3A 2FNIA 2AY5A 4MSOA 4PFFA 1IX7A 3NUIA 1ASDA 2E7UA 1LS3A 4PIWA 1G7XA 4MQQA 8AATA 3DR4A 2JJEA 2ZY5A 4JEXA 4A72A 3JZLA 1AHXA 1AJSB 2YKVA 3OKSA 1AY4A 3ELPA 2Z61A 1P3WA 1AJRA 4TV7A 4A0FA 3EI7A 4M2MA 5M4BA 1BJNA 1ECXA 4MQRA 5FT6A 1M0OA 1AHYA 1SFFA 1IAYA 3VK4A 4DBCA 4F4EA 1QGNA 4UOYA 2CFBA 2D65A 1CQ7A 2EZ1A 3UE8A 4ZSYA 1GEWA 3AEMC 3LVMA 3VK2A 1AIBA 4A0HA 2C44A 1ARSA 3E2FA 2YKYA 4RJ0A 1YNUA 1PMMA 4OTLA 5C6UA 1C0NA 4UHNA 1N2TA 4GE4A 4BHDA 2VMPA 1QITA 1AAWA 2O1BA 3FRKA 3FD0A 2HP2A 3VOMA 2VGZA 3LVLB 3MC6C 2HZPA 5G0AA 1BKGA 3EI9A 1UKJA 2BIGA 2BI9A 1H0CA 2CJGA 1SZKA 2BWOA 2V1PA 2VMOA 1M4NA 3NUBA 1B5OA 1OXOA 4ZDPA 3LY1A 1AX4A 2AY7A 2HUUA 1CQ8A 1WYTA 2E54A 1ARTA 1EQBA 4F5FA 4F5IA 3KGXA 4IX8A 3K40A 4E3QA 1ASFA 4WYEA 4R2NA 3ZRQA 1DKAA 3K7YA 4ZDOA 3BCAA 4F5KA 4ZLVA 2ZYJA 3TFUA 1ASBA 5G4IA 2BWNA 4RKCA 4W5KA 1B9HA 3Q8NA 1ZODA 3E2ZB 4ITGA 4OBUA 1V2EA 4WLJA 3WCOA 1AICA 2W8VA 3HMUA 4CVQA 4F5JA 3ZRRA 2DGLA 3DXVA 3CBFA 2D5YA 2W7FA 5IWQA 2VMUA 2O0RA 1GEYA 2PB2A 1DTYA 2AY3A 3AOWA 3ASBA 3NU8A 3TQXA 3HL2A 1TOGA 2VMRA 3I4JA 4W91A 1ASGA 4E3RA 4XJOA 4R8DA 1ASEA 1B8GA 3COGA 4EB7A 1KKJA 2JGTA 1IX8A 2VMQA 1GDEA 3BN1A 2VMNA 3EZSA 5AX8A 4AZJA 2FN6A 4Q6RA 1XEYA 3I16A 3ECDA 4W8IA 3GJUA 2HOXA 2QB2A 3ATHA 4PVFA 1ELUA 1Z7DA 3WKRA 3MBBA 1CL1A 1CZCA 2HOZA 4MKJA 4BA4A 1ELQA 3FTBA 1QISA 2EGYA 3MAUA 1LC8A 4GDYA 4WBTA 4CBRA 1BJOA 4Y0DA 3B46A 2VIAA 3A9XA 3RCHA 4R5ZA 1LK9A 9AATA 1ARIA 2JJGA 4O6ZA 4RKDA 2D64A 1O69A 2DKJA 3D6KA 1T3IA 2W7JA 2W7HA 4EFFA 1V2DA 1W7LA 3G7QA 4WYAA 1UU0A 4J8LA 1KKPA 3NNKA 3PD6B 3PPLA 2YCTA 2YCPA 3RUYA 3TATA 1C7NA 1RV3A 1WYVB 1MDZA 2QMAA 3QI6A 3QBOA 1VEFA 3A2BA 4IXSA 1TARA 4N0BA 4XK1A 2QBTA 3MADA 4GE7A 2AY2A 1KMJA 4LC3A 4QGRA 2CJHA 1GC3A 4GSAA 4MY5A 1S0AA 1X2AA 2AEUA 2VMSA 4TN4A 3WCNA 4F5LA 5F9SA 4A6RA 1BJOB 3AEPA 3HDOA 5EAAA 5FT8A 4WYFA 4CXRA 2AY6A 3DYDA 1N31A 3TCMA 1EJIA 1YIYA 4KXKA 3GWPA 1S09A 3DU4A 3GSBA 1Z3ZA 3L8AA 3RBLA 1TOKA 3LVJA 1MDXA 2O7CA 2X8UA 1AAMA 1BQDA 1W7MA 3LV2A 2W8WA 5EIGB 5JAYA 5K8BA 5J8QA 5I92A 3W1JA 3HLMA 4AO4A 1UU2A 2D61A 3PGYA 4CXQA 2E7IA 3BB8A 1FG7A 3NYUA 1D7RA 2D63A 1J04A 2VIBA 2Z20A 2CY8A 3A8UX 2XH1A 1LKCA 2W8JA 3CQ6A 2ORDA 3R4TA 3R9AA 1AJSA 1TPLA 2VLFA 4EMYA 1SPAA 3MAFA 2F8JA 2ZUKA 1BT4A 4HVKA 2CANA 3LG0A 3EUCA 3IHJA 2FNUA 1WKHA 1PFFA 3H14A 4XJPA 3E2ZA 3FFRA 2R0TA 1TASA 4A6UA 3FCRA 2AY8A 5D5SA 1C7GA 4XQ2A 1D7VA 2YRRA 1GBNA 1LC7A 3FVUA 2DGKA 3N75A 4DQ6A 1E5EA 2ZY2A 2ZSLA 3AEJC 1GC2A 2W8UA 4WD2A 1OATA 2HUFA 3HVYA 4ATQA 2C7TA 2FQ6A 1DGEA 2AY1A 2BKWA 2PO3A 2CH2A 1FG3A 3FQAA 4LNJA 3FKDA 1CS1A 2ZSMA 1PMOA 4EB5A 1AHGA 1ARHA 2C81A 4WYDA 2D66A 3ZZKA 1O4SA 3BWNA 1S06A 4WP0A 3B8XA 3WLXA 4WB0A 2YKXA 4MGRA 1ASLA 2GMUA 3N0LA 5EAVA 4CBSA 2W7EA 3FZ6A 4OBVA 1G7WA 4Y0HA 5M4DA 4L0OA 2HUIA 3BWOA 5EUDA 4E77A 3VK3A 1MDOA 3PDBA 3KKIA 2OKJA 4RAEA 3UWCA 3II0A 5EUEA 2VMVA 1SZSA 1O61A 1AY8A 4GEBA 2X3LA 5BJ3A 1S08A 3USFA 2EZ2A 3DXWA 5G4JA 2CINA 4A0GA 3HQTA 2BYJA 1YJSA 1GC0A 1SF2A 1C9CA 2GSAA 3WY7A 4AH3A 3NTJA 5E5IA 4OC9A 4IXZA 5G2PA 4ZWMA 4WB0B 4AZKA 1WYTB 2D7YA 1ASAA 1IBJA 2FM1A 3HT4A 2Z9WA 4M2KA 1B5PA 3B1EA 2R5EA 3AENA 3FZ7A 1BJWA 1CQ6A 2VYCA 3KE3A 5FT4A 2OGAA 1I29A 1W3UA 2VI9A 3DC1A 4XJMA 3PAAA 2ZY3A 1WYUA 5DJ1A 3QPGA 4AOAA 3UAKA 1MAPA 1RVYA 1Y4IA 2VMZA 4IXOA 3FVSA 4W1WA 1CJ0A 4DGTA 1PG8A 1AKCA 2QA3A 4HF8A 3DR7A 3GZDC 2AY9A 1QJ5A 2OQXA 2JJFA 4B98A 4XJLA 1I48A 3NYSA 3JTXA 3FQ8A 4ZM3A 1G4XA 1WYUB 4A6TA 2VGVA 4F5HA 4GE9A 5LHAA 2DR1A 5M49A 1X28A 2YKUA 1WKGA 2RFVA 3BCBA 3E9KA 4FL0A 3NDNA 4KAMA 3AENB 4ZAHA 5BJ4A 1BJ4A 1FC4A 1V72A 3HBXA 2R5CB 3MAFB 2FYFA 2JJHA 5LH9A 2VLHA 3RI6A 3KGWA 3PDXA 3ZRPA 1XI9A 2VGUA 1OXPA 4WYGA 2V0YA 5D95A 7AATA 2HOYA 2BIAA 1I41A 2DKBA 4EU1A 1KL1A 1M0NA 1KL2A 1SZUA 1VP4A 4ATPA 3F6TA 1TOEA 2VMYA 1C4KA 3A9YA 1E5FA 3G0TA 3GBXA 4R5FA 1LW5A 4Q31A 4NOGA 4RM1A 1ZC9A 1OHYA 2JISA 3PDBB 3ISLA 5M46A 1AMQA 1JS6A 3JW9A 1BS0A 3CQ4A 3DZZA 4LW2A 3E77A 1RVUA 3AOVA 4BQ0A 3TFTA 1X0MA 2BYLA 1TATA 1AIAA 5HDMA 1AMSA 1TOJA 4F5MA 4JF0A 2R5CA 3EI5A 3L44A 4ZASA 2VGTA 3I5TA 1ZOBA 2W7DA 4J5UA 5DX5A 3DRDA 1EG5A 1O62A 2OGEA 1CZEA 1DGDA 1M0QA 3PD6A 4LW4A 2WKAA 5DJ9A 3BWNC 3EIBA 1AHEA 1VJOA 5E3KA 3ELEA 3NU7A 1LC5A 1U08A 5HHYA 4XAUA 3QN6A 2DGMA 2NMPA 1J32A 1YIZA 4LNMA 3MC6A 2BIEA 4WXGA 3CAIA 3PJ0A 1M6SA 2C0RA 4Q75A 4U1TA 3FVXA 4IYOB 3EIAA 3W1HA 3WX9A 2VI8A 1DFOA 2X5DA 2VMWA 3FQ7A 3MEBA 4WXFA 3AEOA 1TOIA 2Z1ZA 3M5UA 4P7YA 2AY4A 4U2HA 4BMKA 1CL2A 1AMAA 3F9TA 3RQ1A 3W1IA 5TF5A 2W7MA 2CB1A 4BA5A 4ZDLA 3QHXA 4K2IA 2BI2A 3ZZJA 4B9BA 5EQCA 1AKBA 1IUGA 2EO5A 2GB3A 2VGSA 1ORDA 2ZP7A 2OATA 3P6KA 1SVVA 2W7LA 1GD9A 4WYCA 3LVKA 3BV0A 4GRXA 2YCNA 4W1XA 4JE5D 5EUNA 1JF9A 3JWAA 2G6WA 4ADDA 1YJZA 2CTZA 3WGCA 1UU1A 1BQAA 4WXBA 1YOOA 3N5MA 4RITA 4I8AA 1X29A 4UQVA 2JG2A 3FDDA 2ZC0A 2W7GA 1ASMA 3NRAA 3BC8A 4JEZA 3VAXA 2EH6A 4KYOA 2Z9UA 1AHFA 4F5GA 2E7JA 1OHVA 3DODA 3H7FA 1QIRA 2AATA 2OKKA 3FSLA 4PFNA 4ZWVA 3AV7A 4Q76A 5G09A 1AY5A 2CH1A 1ARGA 2VMXA 4OT8A 3GETA 3PA9A 1S07A 4N0WA 3G8MA 3NYTA 4JEVA 4RIZA 4XEWA 1OHWA 2HP1A 3OP7A 1ASCA 4JEWA 2WK7A 3LWSA 1LW4A 2QLRA 2GMSA 3CQ5A 4WLHA 4AO9A 2YHKA 5FT5A 1M0PA 2Z9VA 3FFHA 4IYOA 3A9ZA 5G2QA 5DB5A 3QM2A 4OCAA 3T32A 2CSTA 4JF1A 2R2NA 1AKAA 3FDBA 4A0RA 1QJ3A 3E2YA 1GEXA 4MKKA 3RBFA 1GCKA 4M2JA 5E4ZA 1I43A 3WGBA 4OMAA 2Z1YA 4P3MA 2AEVA 3E6GA 4OYTA 3EI8A 1B4XA 2BI1A 1IVRA 4ITXA 2W7IA 4ZM4A 2ZY4A 2WK8A 2WK9A 5EFSA 1B9IA 2YOBA 1IX6A 4IW7A 1BW0A 2ZJGA 1WSTA 4ADEA 4MQPA 3GR9A 1GC4A 4LNLA 1W23A 3QGUA 1G4VA 1RV4A 2YRIA 3JWBA 5EIGA 1DJ9A 2BHXA 1H1CA 4FFCA 2TPLA 4A00A 4K2MA 2PB0A 4IY7A 4ADCA 3EZ1A 2Z9XA 1JS3A 2VGWA 2BI5A 2VMTA 3BS8A 4UHOA 3PIUA 3B1CA 2BWPA 5HXXA 1C7OA 2GQNA 4ZSWA 2D7ZA 2HORA 1AMRA 2W8TA 3ASAA 3K28A 3VP6A 1DJEA 4JEYA 2X5FA 2QB3A 3GZDA 1KMKA 3B1DA 1D7SA 4UHMA 4ADBA 4ISYA 3P1TA 4E1OA 1D2FA 2Z67A 1IJIA
chains in the Genus database with same CATH superfamily
3GZCA 1W7NA 3AELA 1WYVA 1MGVA 3WZFA 2BI3A 3AEMA 1DJUA 5KTBA 3IF2A 1V2FA 1MAQA 3F0HA 3EI6A 4W1VA 1D7UA 4TMRA 4H51A 2EPJA 4H63Q 4JE5A 3FZ8A 1N8PA 2CJDA 3BCXA 1M7YA 3RCHB 3WKSA 1M32A 2A1VA 1YAAA 3MKJA 1MLYA 1JG8A 2Q7WA 5F8VA 2W7KA 1ASNA 3AEJA 3AATA 1IAXA 4K2BA 2XBNA 4RLGA 4Y0IA 4RJYA 2DOUA 1MLZA 1YJYA 1QZ9A 3ACZA 3JU7A 3NX3A 2FNIA 2AY5A 4MSOA 4PFFA 1IX7A 3NUIA 1ASDA 2E7UA 1LS3A 4PIWA 1G7XA 4MQQA 8AATA 3DR4A 2JJEA 2ZY5A 4JEXA 4A72A 3JZLA 1AHXA 1AJSB 2YKVA 3OKSA 1AY4A 3ELPA 2Z61A 1P3WA 1AJRA 4TV7A 4A0FA 3EI7A 4M2MA 5M4BA 1BJNA 1ECXA 4MQRA 5FT6A 1M0OA 1AHYA 1SFFA 1IAYA 3VK4A 4DBCA 4F4EA 1QGNA 4UOYA 2CFBA 2D65A 1CQ7A 2EZ1A 3UE8A 4ZSYA 1GEWA 3AEMC 3LVMA 3VK2A 1AIBA 4A0HA 2C44A 1ARSA 3E2FA 2YKYA 4RJ0A 1YNUA 1PMMA 4OTLA 5C6UA 1C0NA 4UHNA 1N2TA 4GE4A 4BHDA 2VMPA 1QITA 1AAWA 2O1BA 3FRKA 3FD0A 2HP2A 3VOMA 2VGZA 3LVLB 3MC6C 2HZPA 5G0AA 1BKGA 3EI9A 1UKJA 2BIGA 2BI9A 1H0CA 3N4RA 2CJGA 1SZKA 2BWOA 2V1PA 2VMOA 1M4NA 3NUBA 1B5OA 1OXOA 4ZDPA 3LY1A 2KFPA 1AX4A 2AY7A 2HUUA 1CQ8A 1WYTA 2E54A 1ARTA 1EQBA 4F5FA 4F5IA 3KGXA 4IX8A 3K40A 4E3QA 1ASFA 4WYEA 4R2NA 3ZRQA 1DKAA 3K7YA 4ZDOA 3BCAA 4F5KA 4ZLVA 2ZYJA 3TFUA 1ASBA 5G4IA 2BWNA 4RKCA 4W5KA 1B9HA 3Q8NA 1ZODA 3E2ZB 4ITGA 4OBUA 1V2EA 4WLJA 3WCOA 1AICA 2W8VA 3HMUA 4CVQA 4F5JA 3ZRRA 2DGLA 3DXVA 3CBFA 2D5YA 2W7FA 5IWQA 2VMUA 2O0RA 1GEYA 2PB2A 1DTYA 2AY3A 3AOWA 3ASBA 3NU8A 3TQXA 3HL2A 1TOGA 2VMRA 3I4JA 4W91A 1ASGA 4E3RA 4XJOA 4R8DA 1ASEA 1B8GA 3COGA 4EB7A 1KKJA 2JGTA 1IX8A 2VMQA 1GDEA 3BN1A 2VMNA 3EZSA 5AX8A 4AZJA 2FN6A 4Q6RA 1XEYA 3I16A 3ECDA 4W8IA 3GJUA 2HOXA 2QB2A 3ATHA 4PVFA 1ELUA 1Z7DA 3WKRA 3MBBA 1CL1A 1CZCA 2HOZA 4MKJA 4BA4A 1ELQA 3FTBA 1QISA 2EGYA 3MAUA 1LC8A 4GDYA 4WBTA 4CBRA 3N7NA 1BJOA 4Y0DA 3B46A 2VIAA 3A9XA 3RCHA 4R5ZA 1LK9A 9AATA 1ARIA 2JJGA 4O6ZA 4RKDA 2D64A 1O69A 2DKJA 3D6KA 1T3IA 2W7JA 2W7HA 4EFFA 1V2DA 1W7LA 3G7QA 4WYAA 1UU0A 4J8LA 1KKPA 3NNKA 3PD6B 3PPLA 2YCTA 2YCPA 3RUYA 3TATA 1C7NA 1RV3A 1WYVB 3N4SA 1MDZA 2QMAA 3QI6A 3QBOA 1VEFA 3A2BA 4IXSA 1TARA 4N0BA 4XK1A 2QBTA 3MADA 4GE7A 2AY2A 1KMJA 4LC3A 4QGRA 2CJHA 1GC3A 4GSAA 4MY5A 1S0AA 1X2AA 2AEUA 2VMSA 4TN4A 3WCNA 4F5LA 5F9SA 4A6RA 1BJOB 3AEPA 3HDOA 5EAAA 5FT8A 4WYFA 4CXRA 2AY6A 3DYDA 1N31A 3TCMA 1EJIA 1YIYA 4KXKA 3GWPA 1S09A 3DU4A 3GSBA 1Z3ZA 3L8AA 3RBLA 1TOKA 3LVJA 1MDXA 2O7CA 2X8UA 1AAMA 1BQDA 1W7MA 3LV2A 2W8WA 5EIGB 5JAYA 5K8BA 5J8QA 5I92A 3W1JA 3HLMA 4AO4A 1UU2A 2D61A 3PGYA 4CXQA 2E7IA 3BB8A 1FG7A 3NYUA 1D7RA 2WB6A 2D63A 1J04A 2VIBA 2Z20A 2CY8A 3A8UX 2XH1A 1LKCA 2W8JA 3CQ6A 2ORDA 3R4TA 3R9AA 1AJSA 1TPLA 2VLFA 4EMYA 1SPAA 3MAFA 2F8JA 2ZUKA 1BT4A 4HVKA 2CANA 3LG0A 3EUCA 3IHJA 2FNUA 1WKHA 1PFFA 3H14A 4XJPA 3E2ZA 3FFRA 2R0TA 1TASA 4A6UA 3FCRA 2AY8A 5D5SA 1C7GA 4XQ2A 1D7VA 2YRRA 1GBNA 1LC7A 3FVUA 2DGKA 3N75A 4DQ6A 1E5EA 2ZY2A 2ZSLA 3AEJC 1GC2A 2W8UA 4WD2A 1OATA 2HUFA 3HVYA 4ATQA 2C7TA 2FQ6A 1DGEA 2AY1A 2BKWA 2PO3A 2CH2A 1FG3A 3FQAA 4LNJA 3FKDA 1CS1A 2ZSMA 1PMOA 4EB5A 1AHGA 1ARHA 2C81A 4WYDA 2D66A 3ZZKA 1O4SA 3BWNA 1S06A 4WP0A 3B8XA 3WLXA 4WB0A 2YKXA 4MGRA 1ASLA 2GMUA 3N0LA 5EAVA 4CBSA 2W7EA 3FZ6A 4OBVA 1G7WA 4Y0HA 5M4DA 4L0OA 2HUIA 3BWOA 5EUDA 4E77A 3VK3A 1MDOA 3PDBA 3KKIA 2OKJA 4RAEA 3UWCA 3II0A 5EUEA 2VMVA 1SZSA 1O61A 1AY8A 4GEBA 2X3LA 5BJ3A 1S08A 3USFA 2EZ2A 3DXWA 5G4JA 2CINA 4A0GA 3HQTA 2BYJA 1YJSA 1GC0A 1SF2A 1C9CA 2GSAA 3WY7A 4AH3A 3NTJA 5E5IA 4OC9A 4IXZA 5G2PA 4ZWMA 4WB0B 4AZKA 1WYTB 2D7YA 1ASAA 1IBJA 2FM1A 3HT4A 2Z9WA 4M2KA 1B5PA 3B1EA 2R5EA 3AENA 3FZ7A 1BJWA 1CQ6A 2VYCA 3KE3A 5FT4A 2OGAA 4K05A 2G7JA 1I29A 1W3UA 2VI9A 3DC1A 4XJMA 3PAAA 2ZY3A 1WYUA 5DJ1A 3QPGA 4AOAA 3UAKA 1MAPA 1RVYA 1Y4IA 2VMZA 4IXOA 3FVSA 4W1WA 1CJ0A 4DGTA 1PG8A 1AKCA 2QA3A 4HF8A 3DR7A 3GZDC 2AY9A 1QJ5A 2OQXA 2JJFA 4B98A 4XJLA 1I48A 3NYSA 3JTXA 3FQ8A 4ZM3A 1G4XA 1WYUB 4A6TA 2VGVA 4F5HA 4GE9A 5LHAA 2DR1A 5M49A 1X28A 2YKUA 1WKGA 2RFVA 3BCBA 3E9KA 4FL0A 3NDNA 4KAMA 3AENB 4ZAHA 5BJ4A 1BJ4A 1FC4A 1V72A 3HBXA 2R5CB 3MAFB 2FYFA 2JJHA 5LH9A 2VLHA 3RI6A 1KAFA 3KGWA 3PDXA 3ZRPA 1XI9A 2VGUA 1OXPA 4WYGA 2V0YA 5D95A 7AATA 2HOYA 2BIAA 1I41A 2DKBA 4EU1A 1KL1A 1M0NA 1KL2A 1SZUA 1VP4A 4ATPA 3F6TA 1TOEA 2VMYA 1C4KA 3A9YA 1E5FA 3G0TA 3GBXA 4R5FA 1LW5A 4Q31A 4NOGA 4RM1A 1ZC9A 1OHYA 2JISA 3PDBB 3ISLA 5M46A 1AMQA 1JS6A 3JW9A 1BS0A 3CQ4A 3DZZA 4LW2A 3E77A 1RVUA 3AOVA 4BQ0A 3TFTA 1X0MA 2BYLA 1TATA 1AIAA 5HDMA 1AMSA 1TOJA 4F5MA 4JF0A 2R5CA 3EI5A 3L44A 4ZASA 2VGTA 3I5TA 1ZOBA 2W7DA 4J5UA 5DX5A 3DRDA 1EG5A 1O62A 2OGEA 1CZEA 1DGDA 1M0QA 3PD6A 4LW4A 2WKAA 5DJ9A 3BWNC 3EIBA 1AHEA 1VJOA 5E3KA 3ELEA 3NU7A 1LC5A 1U08A 5HHYA 4XAUA 3QN6A 2DGMA 2NMPA 1J32A 1YIZA 4LNMA 3MC6A 2BIEA 4WXGA 3CAIA 3PJ0A 1M6SA 2C0RA 4Q75A 4U1TA 3FVXA 4IYOB 3EIAA 3W1HA 3WX9A 2VI8A 1DFOA 2X5DA 2VMWA 3FQ7A 3MEBA 4WXFA 3AEOA 1TOIA 2Z1ZA 3M5UA 4P7YA 2AY4A 4U2HA 4BMKA 1CL2A 2QSRA 1AMAA 3F9TA 3RQ1A 3W1IA 5TF5A 2W7MA 2CB1A 4BA5A 4ZDLA 3QHXA 4K2IA 2BI2A 3ZZJA 4B9BA 5EQCA 1AKBA 1IUGA 2EO5A 2GB3A 2VGSA 1ORDA 2ZP7A 2OATA 3P6KA 1SVVA 2W7LA 1GD9A 4WYCA 3LVKA 3BV0A 4GRXA 2YCNA 4W1XA 4JE5D 5EUNA 1JF9A 3JWAA 2G6WA 4ADDA 1YJZA 2CTZA 3WGCA 1UU1A 1BQAA 4WXBA 1YOOA 3N5MA 4RITA 4I8AA 1X29A 4UQVA 2JG2A 3FDDA 2ZC0A 2W7GA 1ASMA 3NRAA 3BC8A 4JEZA 3VAXA 2EH6A 4KYOA 2Z9UA 1AHFA 4F5GA 2E7JA 1OHVA 3DODA 3H7FA 1QIRA 2AATA 2OKKA 3FSLA 4PFNA 4ZWVA 3AV7A 4Q76A 5G09A 1AY5A 2CH1A 1ARGA 2VMXA 4OT8A 3GETA 3PA9A 1S07A 4N0WA 3G8MA 3NYTA 4JEVA 4RIZA 4XEWA 1OHWA 2HP1A 3OP7A 1ASCA 4JEWA 2WK7A 3H9XA 3LWSA 1LW4A 2QLRA 2GMSA 3CQ5A 4WLHA 4AO9A 2YHKA 5FT5A 1M0PA 2Z9VA 3FFHA 4IYOA 3A9ZA 5G2QA 5DB5A 3QM2A 4OCAA 3T32A 2CSTA 4JF1A 2FKIA 2R2NA 1AKAA 3FDBA 3N4XA 4A0RA 1QJ3A 3E2YA 1GEXA 4MKKA 3RBFA 1GCKA 4M2JA 5E4ZA 1I43A 3WGBA 4OMAA 2Z1YA 4P3MA 2AEVA 2EYQA 3E6GA 4OYTA 3EI8A 1B4XA 2BI1A 1IVRA 4ITXA 2W7IA 4ZM4A 2ZY4A 2WK8A 2WK9A 5EFSA 1B9IA 2YOBA 1IX6A 4IW7A 1BW0A 2ZJGA 1WSTA 4ADEA 4MQPA 3GR9A 1GC4A 4LNLA 1W23A 3QGUA 1G4VA 1RV4A 2YRIA 3JWBA 5EIGA 1DJ9A 2BHXA 1H1CA 4FFCA 2TPLA 4A00A 4K2MA 2PB0A 4IY7A 4ADCA 3EZ1A 2Z9XA 1JS3A 2VGWA 2BI5A 2VMTA 3BS8A 4UHOA 3PIUA 3B1CA 2BWPA 5HXXA 1C7OA 2GQNA 4ZSWA 2D7ZA 2HORA 1AMRA 2W8TA 3ASAA 3K28A 3VP6A 1DJEA 4JEYA 2X5FA 2QB3A 3GZDA 1KMKA 3B1DA 1D7SA 4UHMA 4ADBA 4ISYA 3P1TA 4E1OA 1D2FA 2Z67A 1IJIA
chains in the Genus database with same CATH topology
3GZCA 1W7NA 3AELA 1WYVA 1MGVA 3WZFA 2BI3A 3AEMA 1DJUA 5KTBA 3IF2A 1V2FA 1MAQA 3F0HA 3EI6A 4W1VA 1D7UA 4TMRA 4H51A 2EPJA 4H63Q 4JE5A 3FZ8A 1N8PA 2CJDA 3BCXA 1M7YA 3RCHB 3WKSA 1M32A 2A1VA 1YAAA 3MKJA 1MLYA 1JG8A 2Q7WA 5F8VA 2W7KA 1ASNA 3AEJA 3AATA 1IAXA 4K2BA 2XBNA 4RLGA 4Y0IA 4RJYA 2DOUA 1MLZA 1YJYA 1QZ9A 3ACZA 3JU7A 3NX3A 2FNIA 2AY5A 4MSOA 4PFFA 1IX7A 3NUIA 1ASDA 2E7UA 1LS3A 4PIWA 1G7XA 4MQQA 8AATA 3DR4A 2JJEA 2ZY5A 4JEXA 4A72A 3JZLA 1AHXA 1AJSB 2YKVA 3OKSA 1AY4A 3ELPA 2Z61A 1P3WA 1AJRA 4TV7A 4A0FA 3EI7A 4M2MA 5M4BA 1BJNA 1ECXA 4MQRA 5FT6A 1M0OA 1AHYA 1SFFA 1IAYA 3VK4A 4DBCA 4F4EA 1QGNA 4UOYA 2CFBA 2D65A 1CQ7A 2EZ1A 3UE8A 4ZSYA 1GEWA 3AEMC 3LVMA 3VK2A 1AIBA 4A0HA 2C44A 1ARSA 3E2FA 2YKYA 4RJ0A 1YNUA 1PMMA 4OTLA 5C6UA 1C0NA 4UHNA 1N2TA 4GE4A 4BHDA 2VMPA 1QITA 1AAWA 2O1BA 3FRKA 3FD0A 2HP2A 3VOMA 2VGZA 3LVLB 3MC6C 2HZPA 5G0AA 1BKGA 3EI9A 1UKJA 2BIGA 2BI9A 1H0CA 3N4RA 2CJGA 1SZKA 2BWOA 2V1PA 2VMOA 1M4NA 3NUBA 1B5OA 1OXOA 4ZDPA 3LY1A 2KFPA 1AX4A 2AY7A 2HUUA 1CQ8A 1WYTA 2E54A 1ARTA 1EQBA 4F5FA 4F5IA 3KGXA 4IX8A 3K40A 4E3QA 1ASFA 4WYEA 4R2NA 3ZRQA 1DKAA 3K7YA 4ZDOA 3BCAA 4F5KA 4ZLVA 2ZYJA 3TFUA 1ASBA 5G4IA 2BWNA 4RKCA 4W5KA 1B9HA 3Q8NA 1ZODA 3E2ZB 4ITGA 4OBUA 1V2EA 4WLJA 3WCOA 1AICA 2W8VA 3HMUA 4CVQA 4F5JA 3ZRRA 2DGLA 3DXVA 3CBFA 2D5YA 2W7FA 5IWQA 2VMUA 2O0RA 1GEYA 2PB2A 1DTYA 2AY3A 3AOWA 3ASBA 3NU8A 3TQXA 3HL2A 1TOGA 2VMRA 3I4JA 4W91A 1ASGA 4E3RA 4XJOA 4R8DA 1ASEA 1B8GA 3COGA 4EB7A 1KKJA 2JGTA 1IX8A 2VMQA 1GDEA 3BN1A 2VMNA 3EZSA 5AX8A 4AZJA 2FN6A 4Q6RA 1XEYA 3I16A 3ECDA 4W8IA 3GJUA 2HOXA 2QB2A 3ATHA 4PVFA 1ELUA 1Z7DA 3WKRA 3MBBA 1CL1A 1CZCA 2HOZA 4MKJA 4BA4A 1ELQA 3FTBA 1QISA 2EGYA 3MAUA 1LC8A 4GDYA 4WBTA 4CBRA 3N7NA 1BJOA 4Y0DA 3B46A 2VIAA 3A9XA 3RCHA 4R5ZA 1LK9A 9AATA 1ARIA 2JJGA 4O6ZA 4RKDA 2D64A 1O69A 2DKJA 3D6KA 1T3IA 2W7JA 2W7HA 4EFFA 1V2DA 1W7LA 3G7QA 4WYAA 1UU0A 4J8LA 1KKPA 3NNKA 3PD6B 3PPLA 2YCTA 2YCPA 3RUYA 3TATA 1C7NA 1RV3A 1WYVB 3N4SA 1MDZA 2QMAA 3QI6A 3QBOA 1VEFA 3A2BA 4IXSA 1TARA 4N0BA 4XK1A 2QBTA 3MADA 4GE7A 2AY2A 1KMJA 4LC3A 4QGRA 2CJHA 1GC3A 4GSAA 4MY5A 1S0AA 1X2AA 2AEUA 2VMSA 4TN4A 3WCNA 4F5LA 5F9SA 4A6RA 1BJOB 3AEPA 3HDOA 5EAAA 5FT8A 4WYFA 4CXRA 2AY6A 3DYDA 1N31A 3TCMA 1EJIA 1YIYA 4KXKA 3GWPA 1S09A 3DU4A 3GSBA 1Z3ZA 3L8AA 3RBLA 1TOKA 3LVJA 1MDXA 2O7CA 2X8UA 1AAMA 1BQDA 1W7MA 3LV2A 2W8WA 5EIGB 5JAYA 5K8BA 5J8QA 5I92A 3W1JA 3HLMA 4AO4A 1UU2A 2D61A 3PGYA 4CXQA 2E7IA 3BB8A 1FG7A 3NYUA 1D7RA 2WB6A 2D63A 1J04A 2VIBA 2Z20A 2CY8A 3A8UX 2XH1A 1LKCA 2W8JA 3CQ6A 2ORDA 3R4TA 3R9AA 1AJSA 1TPLA 2VLFA 4EMYA 1SPAA 3MAFA 2F8JA 2ZUKA 1BT4A 4HVKA 2CANA 3LG0A 3EUCA 3IHJA 2FNUA 1WKHA 1PFFA 3H14A 4XJPA 3E2ZA 3FFRA 2R0TA 1TASA 4A6UA 3FCRA 2AY8A 5D5SA 1C7GA 4XQ2A 1D7VA 2YRRA 1GBNA 1LC7A 3FVUA 2DGKA 3N75A 4DQ6A 1E5EA 2ZY2A 2ZSLA 3AEJC 1GC2A 2W8UA 4WD2A 1OATA 2HUFA 3HVYA 4ATQA 2C7TA 2FQ6A 1DGEA 2AY1A 2BKWA 2PO3A 2CH2A 1FG3A 3FQAA 4LNJA 3FKDA 1CS1A 2ZSMA 1PMOA 4EB5A 1AHGA 1ARHA 2C81A 4WYDA 2D66A 3ZZKA 1O4SA 3BWNA 1S06A 4WP0A 3B8XA 3WLXA 4WB0A 2YKXA 4MGRA 1ASLA 2GMUA 3N0LA 5EAVA 4CBSA 2W7EA 3FZ6A 4OBVA 1G7WA 4Y0HA 5M4DA 4L0OA 2HUIA 3BWOA 5EUDA 4E77A 3VK3A 1MDOA 3PDBA 3KKIA 2OKJA 4RAEA 3UWCA 3II0A 5EUEA 2VMVA 1SZSA 1O61A 1AY8A 4GEBA 2X3LA 5BJ3A 1S08A 3USFA 2EZ2A 3DXWA 5G4JA 2CINA 4A0GA 3HQTA 2BYJA 1YJSA 1GC0A 1SF2A 1C9CA 2GSAA 3WY7A 4AH3A 3NTJA 5E5IA 4OC9A 4IXZA 5G2PA 4ZWMA 4WB0B 4AZKA 1WYTB 2D7YA 1ASAA 1IBJA 2FM1A 3HT4A 2Z9WA 4M2KA 1B5PA 3B1EA 2R5EA 3AENA 3FZ7A 1BJWA 1CQ6A 2VYCA 3KE3A 5FT4A 2OGAA 4K05A 2G7JA 1I29A 1W3UA 2VI9A 3DC1A 4XJMA 3PAAA 2ZY3A 1WYUA 5DJ1A 3QPGA 4AOAA 3UAKA 1MAPA 1RVYA 1Y4IA 2VMZA 4IXOA 3FVSA 4W1WA 1CJ0A 4DGTA 1PG8A 1AKCA 2QA3A 4HF8A 3DR7A 3GZDC 2AY9A 1QJ5A 2OQXA 2JJFA 4B98A 4XJLA 1I48A 3NYSA 3JTXA 3FQ8A 4ZM3A 1G4XA 1WYUB 4A6TA 2VGVA 4F5HA 4GE9A 5LHAA 2DR1A 5M49A 1X28A 2YKUA 1WKGA 2RFVA 3BCBA 3E9KA 4FL0A 3NDNA 4KAMA 3AENB 4ZAHA 5BJ4A 1BJ4A 1FC4A 1V72A 3HBXA 2R5CB 3MAFB 2FYFA 2JJHA 5LH9A 2VLHA 3RI6A 3KGWA 3PDXA 3ZRPA 1XI9A 2VGUA 1OXPA 4WYGA 2V0YA 5D95A 7AATA 2HOYA 2BIAA 1I41A 2DKBA 4EU1A 1KL1A 1M0NA 1KL2A 1SZUA 1VP4A 4ATPA 3F6TA 1TOEA 2VMYA 1C4KA 3A9YA 1E5FA 3G0TA 3GBXA 4R5FA 1LW5A 4Q31A 4NOGA 4RM1A 1ZC9A 1OHYA 2JISA 3PDBB 3ISLA 5M46A 1AMQA 1JS6A 3JW9A 1BS0A 3CQ4A 3DZZA 4LW2A 3E77A 1RVUA 3AOVA 4BQ0A 3TFTA 1X0MA 2BYLA 1TATA 1AIAA 5HDMA 1AMSA 1TOJA 4F5MA 4JF0A 2R5CA 3EI5A 3L44A 4ZASA 2VGTA 3I5TA 1ZOBA 2W7DA 4J5UA 5DX5A 3DRDA 1EG5A 1O62A 2OGEA 1CZEA 1DGDA 1M0QA 3PD6A 4LW4A 2WKAA 5DJ9A 3BWNC 3EIBA 1AHEA 1VJOA 5E3KA 3ELEA 3NU7A 1LC5A 1U08A 5HHYA 4XAUA 3QN6A 2DGMA 2NMPA 1J32A 1YIZA 4LNMA 3MC6A 2BIEA 4WXGA 3CAIA 3PJ0A 1M6SA 2C0RA 4Q75A 4U1TA 3FVXA 4IYOB 3EIAA 3W1HA 3WX9A 2VI8A 1DFOA 2X5DA 2VMWA 3FQ7A 3MEBA 4WXFA 3AEOA 1TOIA 2Z1ZA 3M5UA 4P7YA 2AY4A 4U2HA 4BMKA 1CL2A 2QSRA 1AMAA 3F9TA 3RQ1A 3W1IA 5TF5A 2W7MA 2CB1A 4BA5A 4ZDLA 3QHXA 4K2IA 2BI2A 3ZZJA 4B9BA 5EQCA 1AKBA 1IUGA 2EO5A 2GB3A 2VGSA 1ORDA 2ZP7A 2OATA 3P6KA 1SVVA 2W7LA 1GD9A 4WYCA 3LVKA 3BV0A 4GRXA 2YCNA 4W1XA 4JE5D 5EUNA 1JF9A 3JWAA 2G6WA 4ADDA 1YJZA 2CTZA 3WGCA 1UU1A 1BQAA 4WXBA 1YOOA 3N5MA 4RITA 4I8AA 1X29A 4UQVA 2JG2A 3FDDA 2ZC0A 2W7GA 1ASMA 3NRAA 3BC8A 4JEZA 3VAXA 2EH6A 4KYOA 2Z9UA 1AHFA 4F5GA 2E7JA 1OHVA 3DODA 3H7FA 1QIRA 2AATA 2OKKA 3FSLA 4PFNA 4ZWVA 3AV7A 4Q76A 5G09A 1AY5A 2CH1A 1ARGA 2VMXA 4OT8A 3GETA 3PA9A 1S07A 4N0WA 3G8MA 3NYTA 4JEVA 4RIZA 4XEWA 1OHWA 2HP1A 3OP7A 1ASCA 4JEWA 2WK7A 3H9XA 3LWSA 1LW4A 2QLRA 2GMSA 3CQ5A 4WLHA 4AO9A 2YHKA 5FT5A 1M0PA 2Z9VA 3FFHA 4IYOA 3A9ZA 5G2QA 5DB5A 3QM2A 4OCAA 3T32A 2CSTA 4JF1A 2FKIA 2R2NA 1AKAA 3FDBA 3N4XA 4A0RA 1QJ3A 3E2YA 1GEXA 4MKKA 3RBFA 1GCKA 4M2JA 5E4ZA 1I43A 3WGBA 4OMAA 2Z1YA 4P3MA 2AEVA 2EYQA 3E6GA 4OYTA 3EI8A 1B4XA 2BI1A 1IVRA 4ITXA 2W7IA 4ZM4A 2ZY4A 2WK8A 2WK9A 5EFSA 1B9IA 2YOBA 1IX6A 4IW7A 1BW0A 2ZJGA 1WSTA 4ADEA 4MQPA 3GR9A 1GC4A 4LNLA 1W23A 3QGUA 1G4VA 1RV4A 2YRIA 3JWBA 5EIGA 1DJ9A 2BHXA 1H1CA 4FFCA 2TPLA 4A00A 4K2MA 2PB0A 4IY7A 4ADCA 3EZ1A 2Z9XA 1JS3A 2VGWA 2BI5A 2VMTA 3BS8A 4UHOA 3PIUA 3B1CA 2BWPA 5HXXA 1C7OA 2GQNA 4ZSWA 2D7ZA 2HORA 1AMRA 2W8TA 3ASAA 3K28A 3VP6A 1DJEA 4JEYA 2X5FA 2QB3A 3GZDA 1KMKA 3B1DA 1D7SA 4UHMA 4ADBA 4ISYA 3P1TA 4E1OA 1D2FA 2Z67A 1IJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZC A;  1W7N A;  3AEL A;  1WYV A;  1MGV A;  3WZF A;  2BI3 A;  3AEM A;  1DJU A;  3IF2 A;  1V2F A;  1MAQ A;  3F0H A;  3EI6 A;  4W1V A;  1D7U A;  4TMR A;  4H51 A;  2EPJ A;  4JE5 A;  3FZ8 A;  1N8P A;  2CJD A;  3BCX A;  1M7Y A;  3RCH B;  3WKS A;  1M32 A;  1YAA A;  3MKJ A;  1MLY A;  1JG8 A;  2Q7W A;  5F8V A;  2W7K A;  1ASN A;  3AEJ A;  3AAT A;  1IAX A;  4K2B A;  2XBN A;  4RLG A;  4Y0I A;  4RJY A;  2DOU A;  1MLZ A;  1YJY A;  1QZ9 A;  3ACZ A;  3JU7 A;  3NX3 A;  2FNI A;  2AY5 A;  4MSO A;  4PFF A;  1IX7 A;  3NUI A;  1ASD A;  2E7U A;  1LS3 A;  4PIW A;  1G7X A;  4MQQ A;  8AAT A;  3DR4 A;  2JJE A;  2ZY5 A;  4JEX A;  4A72 A;  3JZL A;  1AHX A;  1AJS B;  2YKV A;  3OKS A;  1AY4 A;  3ELP A;  2Z61 A;  1P3W A;  1AJR A;  4TV7 A;  4A0F A;  3EI7 A;  4M2M A;  5M4B A;  1BJN A;  1ECX A;  4MQR A;  5FT6 A;  1M0O A;  1AHY A;  1SFF A;  1IAY A;  3VK4 A;  4DBC A;  4F4E A;  1QGN A;  4UOY A;  2CFB A;  2D65 A;  1CQ7 A;  2EZ1 A;  3UE8 A;  4ZSY A;  1GEW A;  3AEM C;  3LVM A;  3VK2 A;  1AIB A;  4A0H A;  2C44 A;  1ARS A;  3E2F A;  2YKY A;  4RJ0 A;  1YNU A;  1PMM A;  4OTL A;  5C6U A;  1C0N A;  4UHN A;  1N2T A;  4GE4 A;  4BHD A;  2VMP A;  1QIT A;  1AAW A;  2O1B A;  3FRK A;  3FD0 A;  2HP2 A;  3VOM A;  2VGZ A;  3LVL B;  3MC6 C;  2HZP A;  5G0A A;  1BKG A;  3EI9 A;  1UKJ A;  2BIG A;  2BI9 A;  1H0C A;  2CJG A;  1SZK A;  2BWO A;  2V1P A;  2VMO A;  1M4N A;  3NUB A;  1B5O A;  1OXO A;  4ZDP A;  3LY1 A;  1AX4 A;  2AY7 A;  2HUU A;  1CQ8 A;  1WYT A;  2E54 A;  1ART A;  1EQB A;  4F5F A;  4F5I A;  3KGX A;  4IX8 A;  3K40 A;  4E3Q A;  1ASF A;  4WYE A;  4R2N A;  3ZRQ A;  1DKA A;  3K7Y A;  4ZDO A;  3BCA A;  4F5K A;  4ZLV A;  2ZYJ A;  3TFU A;  1ASB A;  5G4I A;  2BWN A;  4RKC A;  4W5K A;  1B9H A;  3Q8N A;  1ZOD A;  3E2Z B;  4ITG A;  4OBU A;  1V2E A;  4WLJ A;  3WCO A;  1AIC A;  2W8V A;  3HMU A;  4CVQ A;  4F5J A;  3ZRR A;  2DGL A;  3DXV A;  3CBF A;  2D5Y A;  2W7F A;  5IWQ A;  2VMU A;  2O0R A;  1GEY A;  2PB2 A;  1DTY A;  2AY3 A;  3AOW A;  3ASB A;  3NU8 A;  3TQX A;  3HL2 A;  1TOG A;  2VMR A;  3I4J A;  4W91 A;  1ASG A;  4E3R A;  4XJO A;  4R8D A;  1ASE A;  1B8G A;  3COG A;  4EB7 A;  1KKJ A;  2JGT A;  1IX8 A;  2VMQ A;  1GDE A;  3BN1 A;  2VMN A;  3EZS A;  5AX8 A;  4AZJ A;  2FN6 A;  4Q6R A;  1XEY A;  3I16 A;  3ECD A;  4W8I A;  3GJU A;  2HOX A;  2QB2 A;  3ATH A;  4PVF A;  1ELU A;  1Z7D A;  3WKR A;  3MBB A;  1CL1 A;  1CZC A;  2HOZ A;  4MKJ A;  4BA4 A;  1ELQ A;  3FTB A;  1QIS A;  2EGY A;  3MAU A;  1LC8 A;  4GDY A;  4WBT A;  4CBR A;  1BJO A;  4Y0D A;  3B46 A;  2VIA A;  3A9X A;  3RCH A;  4R5Z A;  1LK9 A;  9AAT A;  1ARI A;  2JJG A;  4O6Z A;  4RKD A;  2D64 A;  1O69 A;  2DKJ A;  3D6K A;  1T3I A;  2W7J A;  2W7H A;  4EFF A;  1V2D A;  1W7L A;  3G7Q A;  4WYA A;  1UU0 A;  4J8L A;  1KKP A;  3NNK A;  3PD6 B;  3PPL A;  2YCT A;  2YCP A;  3RUY A;  3TAT A;  1C7N A;  1RV3 A;  1WYV B;  1MDZ A;  2QMA A;  3QI6 A;  3QBO A;  1VEF A;  3A2B A;  4IXS A;  1TAR A;  4N0B A;  4XK1 A;  2QBT A;  3MAD A;  4GE7 A;  2AY2 A;  1KMJ A;  4LC3 A;  4QGR A;  2CJH A;  1GC3 A;  4GSA A;  4MY5 A;  1S0A A;  1X2A A;  2AEU A;  2VMS A;  4TN4 A;  3WCN A;  4F5L A;  5F9S A;  4A6R A;  1BJO B;  3AEP A;  3HDO A;  5EAA A;  5FT8 A;  4WYF A;  4CXR A;  2AY6 A;  3DYD A;  1N31 A;  3TCM A;  1EJI A;  1YIY A;  4KXK A;  3GWP A;  1S09 A;  3DU4 A;  3GSB A;  1Z3Z A;  3L8A A;  3RBL A;  1TOK A;  3LVJ A;  1MDX A;  2O7C A;  2X8U A;  1AAM A;  1BQD A;  1W7M A;  3LV2 A;  2W8W A;  5EIG B;  5JAY A;  5K8B A;  5J8Q A;  5I92 A;  3W1J A;  3HLM A;  4AO4 A;  1UU2 A;  2D61 A;  3PGY A;  4CXQ A;  2E7I A;  3BB8 A;  1FG7 A;  3NYU A;  1D7R A;  2D63 A;  1J04 A;  2VIB A;  2Z20 A;  2CY8 A;  3A8U X;  2XH1 A;  1LKC A;  2W8J A;  3CQ6 A;  2ORD A;  3R4T A;  3R9A A;  1AJS A;  1TPL A;  2VLF A;  4EMY A;  1SPA A;  3MAF A;  2F8J A;  2ZUK A;  1BT4 A;  4HVK A;  2CAN A;  3LG0 A;  3EUC A;  3IHJ A;  2FNU A;  1WKH A;  1PFF A;  3H14 A;  4XJP A;  3E2Z A;  3FFR A;  2R0T A;  1TAS A;  4A6U A;  3FCR A;  2AY8 A;  5D5S A;  1C7G A;  4XQ2 A;  1D7V A;  2YRR A;  1GBN A;  1LC7 A;  3FVU A;  2DGK A;  3N75 A;  4DQ6 A;  1E5E A;  2ZY2 A;  2ZSL A;  3AEJ C;  1GC2 A;  2W8U A;  4WD2 A;  1OAT A;  2HUF A;  3HVY A;  4ATQ A;  2C7T A;  2FQ6 A;  1DGE A;  2AY1 A;  2BKW A;  2PO3 A;  2CH2 A;  1FG3 A;  3FQA A;  4LNJ A;  3FKD A;  1CS1 A;  2ZSM A;  1PMO A;  4EB5 A;  1AHG A;  1ARH A;  2C81 A;  4WYD A;  2D66 A;  3ZZK A;  1O4S A;  3BWN A;  1S06 A;  4WP0 A;  3B8X A;  3WLX A;  4WB0 A;  2YKX A;  4MGR A;  1ASL A;  2GMU A;  3N0L A;  5EAV A;  4CBS A;  2W7E A;  3FZ6 A;  4OBV A;  1G7W A;  4Y0H A;  5M4D A;  4L0O A;  2HUI A;  3BWO A;  5EUD A;  4E77 A;  3VK3 A;  1MDO A;  3PDB A;  3KKI A;  2OKJ A;  4RAE A;  3UWC A;  3II0 A;  5EUE A;  2VMV A;  1SZS A;  1O61 A;  1AY8 A;  4GEB A;  2X3L A;  5BJ3 A;  1S08 A;  3USF A;  2EZ2 A;  3DXW A;  5G4J A;  2CIN A;  4A0G A;  3HQT A;  2BYJ A;  1YJS A;  1GC0 A;  1SF2 A;  1C9C A;  2GSA A;  3WY7 A;  4AH3 A;  3NTJ A;  5E5I A;  4OC9 A;  4IXZ A;  5G2P A;  4ZWM A;  4WB0 B;  4AZK A;  1WYT B;  2D7Y A;  1ASA A;  1IBJ A;  2FM1 A;  3HT4 A;  2Z9W A;  4M2K A;  1B5P A;  3B1E A;  2R5E A;  3AEN A;  3FZ7 A;  1BJW A;  1CQ6 A;  2VYC A;  3KE3 A;  5FT4 A;  2OGA A;  1I29 A;  1W3U A;  2VI9 A;  3DC1 A;  4XJM A;  3PAA A;  2ZY3 A;  1WYU A;  5DJ1 A;  3QPG A;  4AOA A;  3UAK A;  1MAP A;  1RVY A;  1Y4I A;  2VMZ A;  4IXO A;  3FVS A;  4W1W A;  1CJ0 A;  4DGT A;  1PG8 A;  1AKC A;  2QA3 A;  4HF8 A;  3DR7 A;  3GZD C;  2AY9 A;  1QJ5 A;  2OQX A;  2JJF A;  4B98 A;  4XJL A;  1I48 A;  3NYS A;  3JTX A;  3FQ8 A;  4ZM3 A;  1G4X A;  1WYU B;  4A6T A;  2VGV A;  4F5H A;  4GE9 A;  5LHA A;  2DR1 A;  5M49 A;  1X28 A;  2YKU A;  1WKG A;  2RFV A;  3BCB A;  3E9K A;  4FL0 A;  3NDN A;  4KAM A;  3AEN B;  4ZAH A;  5BJ4 A;  1BJ4 A;  1FC4 A;  1V72 A;  3HBX A;  2R5C B;  3MAF B;  2FYF A;  2JJH A;  5LH9 A;  2VLH A;  3RI6 A;  3KGW A;  3PDX A;  3ZRP A;  1XI9 A;  2VGU A;  1OXP A;  4WYG A;  2V0Y A;  5D95 A;  7AAT A;  2HOY A;  2BIA A;  1I41 A;  2DKB A;  4EU1 A;  1KL1 A;  1M0N A;  1KL2 A;  1SZU A;  1VP4 A;  4ATP A;  3F6T A;  1TOE A;  2VMY A;  1C4K A;  3A9Y A;  1E5F A;  3G0T A;  3GBX A;  4R5F A;  1LW5 A;  4Q31 A;  4NOG A;  4RM1 A;  1ZC9 A;  1OHY A;  2JIS A;  3PDB B;  3ISL A;  5M46 A;  1AMQ A;  1JS6 A;  3JW9 A;  1BS0 A;  3CQ4 A;  3DZZ A;  4LW2 A;  3E77 A;  1RVU A;  3AOV A;  4BQ0 A;  3TFT A;  1X0M A;  2BYL A;  1TAT A;  1AIA A;  5HDM A;  1AMS A;  1TOJ A;  4F5M A;  4JF0 A;  2R5C A;  3EI5 A;  3L44 A;  4ZAS A;  2VGT A;  3I5T A;  1ZOB A;  2W7D A;  4J5U A;  5DX5 A;  3DRD A;  1EG5 A;  1O62 A;  2OGE A;  1CZE A;  1DGD A;  1M0Q A;  3PD6 A;  4LW4 A;  2WKA A;  5DJ9 A;  3BWN C;  3EIB A;  1AHE A;  1VJO A;  5E3K A;  3ELE A;  3NU7 A;  1LC5 A;  1U08 A;  5HHY A;  4XAU A;  3QN6 A;  2DGM A;  2NMP A;  1J32 A;  1YIZ A;  4LNM A;  3MC6 A;  2BIE A;  4WXG A;  3CAI A;  3PJ0 A;  1M6S A;  2C0R A;  4Q75 A;  4U1T A;  3FVX A;  4IYO B;  3EIA A;  3W1H A;  3WX9 A;  2VI8 A;  1DFO A;  2X5D A;  2VMW A;  3FQ7 A;  3MEB A;  4WXF A;  3AEO A;  1TOI A;  2Z1Z A;  3M5U A;  4P7Y A;  2AY4 A;  4U2H A;  4BMK A;  1CL2 A;  1AMA A;  3F9T A;  3RQ1 A;  3W1I A;  5TF5 A;  2W7M A;  2CB1 A;  4BA5 A;  4ZDL A;  3QHX A;  4K2I A;  2BI2 A;  3ZZJ A;  4B9B A;  5EQC A;  1AKB A;  1IUG A;  2EO5 A;  2GB3 A;  2VGS A;  1ORD A;  2ZP7 A;  2OAT A;  3P6K A;  1SVV A;  2W7L A;  1GD9 A;  4WYC A;  3LVK A;  3BV0 A;  4GRX A;  2YCN A;  4W1X A;  4JE5 D;  5EUN A;  1JF9 A;  3JWA A;  2G6W A;  4ADD A;  1YJZ A;  2CTZ A;  3WGC A;  1UU1 A;  1BQA A;  4WXB A;  1YOO A;  3N5M A;  4RIT A;  4I8A A;  1X29 A;  4UQV A;  2JG2 A;  3FDD A;  2ZC0 A;  2W7G A;  1ASM A;  3NRA A;  3BC8 A;  4JEZ A;  3VAX A;  2EH6 A;  4KYO A;  2Z9U A;  1AHF A;  4F5G A;  2E7J A;  1OHV A;  3DOD A;  3H7F A;  1QIR A;  2AAT A;  2OKK A;  3FSL A;  4PFN A;  4ZWV A;  3AV7 A;  4Q76 A;  5G09 A;  1AY5 A;  2CH1 A;  1ARG A;  2VMX A;  4OT8 A;  3GET A;  3PA9 A;  1S07 A;  4N0W A;  3G8M A;  3NYT A;  4JEV A;  4RIZ A;  4XEW A;  1OHW A;  2HP1 A;  3OP7 A;  1ASC A;  4JEW A;  2WK7 A;  3LWS A;  1LW4 A;  2QLR A;  2GMS A;  3CQ5 A;  4WLH A;  4AO9 A;  2YHK A;  5FT5 A;  1M0P A;  2Z9V A;  3FFH A;  4IYO A;  3A9Z A;  5G2Q A;  5DB5 A;  3QM2 A;  4OCA A;  3T32 A;  2CST A;  4JF1 A;  2R2N A;  1AKA A;  3FDB A;  4A0R A;  1QJ3 A;  3E2Y A;  1GEX A;  4MKK A;  3RBF A;  1GCK A;  4M2J A;  5E4Z A;  1I43 A;  3WGB A;  4OMA A;  2Z1Y A;  4P3M A;  2AEV A;  3E6G A;  4OYT A;  3EI8 A;  1B4X A;  2BI1 A;  1IVR A;  4ITX A;  2W7I A;  4ZM4 A;  2ZY4 A;  2WK8 A;  2WK9 A;  5EFS A;  1B9I A;  2YOB A;  1IX6 A;  4IW7 A;  1BW0 A;  2ZJG A;  1WST A;  4ADE A;  4MQP A;  3GR9 A;  1GC4 A;  4LNL A;  1W23 A;  3QGU A;  1G4V A;  1RV4 A;  2YRI A;  3JWB A;  5EIG A;  1DJ9 A;  2BHX A;  1H1C A;  4FFC A;  2TPL A;  4A00 A;  4K2M A;  2PB0 A;  4IY7 A;  4ADC A;  3EZ1 A;  2Z9X A;  1JS3 A;  2VGW A;  2BI5 A;  2VMT A;  3BS8 A;  4UHO A;  3PIU A;  3B1C A;  2BWP A;  5HXX A;  1C7O A;  2GQN A;  4ZSW A;  2D7Z A;  2HOR A;  1AMR A;  2W8T A;  3ASA A;  3K28 A;  3VP6 A;  1DJE A;  4JEY A;  2X5F A;  2QB3 A;  3GZD A;  1KMK A;  3B1D A;  1D7S A;  4UHM A;  4ADB A;  4ISY A;  3P1T A;  4E1O A;  1D2F A;  2Z67 A;  1IJI A; 
#chains in the Genus database with same CATH topology
 3GZC A;  1W7N A;  3AEL A;  1WYV A;  1MGV A;  3WZF A;  2BI3 A;  3AEM A;  1DJU A;  5KTB A;  3IF2 A;  1V2F A;  1MAQ A;  3F0H A;  3EI6 A;  4W1V A;  1D7U A;  4TMR A;  4H51 A;  2EPJ A;  4H63 Q;  4JE5 A;  3FZ8 A;  1N8P A;  2CJD A;  3BCX A;  1M7Y A;  3RCH B;  3WKS A;  1M32 A;  2A1V A;  1YAA A;  3MKJ A;  1MLY A;  1JG8 A;  2Q7W A;  5F8V A;  2W7K A;  1ASN A;  3AEJ A;  3AAT A;  1IAX A;  4K2B A;  2XBN A;  4RLG A;  4Y0I A;  4RJY A;  2DOU A;  1MLZ A;  1YJY A;  1QZ9 A;  3ACZ A;  3JU7 A;  3NX3 A;  2FNI A;  2AY5 A;  4MSO A;  4PFF A;  1IX7 A;  3NUI A;  1ASD A;  2E7U A;  1LS3 A;  4PIW A;  1G7X A;  4MQQ A;  8AAT A;  3DR4 A;  2JJE A;  2ZY5 A;  4JEX A;  4A72 A;  3JZL A;  1AHX A;  1AJS B;  2YKV A;  3OKS A;  1AY4 A;  3ELP A;  2Z61 A;  1P3W A;  1AJR A;  4TV7 A;  4A0F A;  3EI7 A;  4M2M A;  5M4B A;  1BJN A;  1ECX A;  4MQR A;  5FT6 A;  1M0O A;  1AHY A;  1SFF A;  1IAY A;  3VK4 A;  4DBC A;  4F4E A;  1QGN A;  4UOY A;  2CFB A;  2D65 A;  1CQ7 A;  2EZ1 A;  3UE8 A;  4ZSY A;  1GEW A;  3AEM C;  3LVM A;  3VK2 A;  1AIB A;  4A0H A;  2C44 A;  1ARS A;  3E2F A;  2YKY A;  4RJ0 A;  1YNU A;  1PMM A;  4OTL A;  5C6U A;  1C0N A;  4UHN A;  1N2T A;  4GE4 A;  4BHD A;  2VMP A;  1QIT A;  1AAW A;  2O1B A;  3FRK A;  3FD0 A;  2HP2 A;  3VOM A;  2VGZ A;  3LVL B;  3MC6 C;  2HZP A;  5G0A A;  1BKG A;  3EI9 A;  1UKJ A;  2BIG A;  2BI9 A;  1H0C A;  3N4R A;  2CJG A;  1SZK A;  2BWO A;  2V1P A;  2VMO A;  1M4N A;  3NUB A;  1B5O A;  1OXO A;  4ZDP A;  3LY1 A;  2KFP A;  1AX4 A;  2AY7 A;  2HUU A;  1CQ8 A;  1WYT A;  2E54 A;  1ART A;  1EQB A;  4F5F A;  4F5I A;  3KGX A;  4IX8 A;  3K40 A;  4E3Q A;  1ASF A;  4WYE A;  4R2N A;  3ZRQ A;  1DKA A;  3K7Y A;  4ZDO A;  3BCA A;  4F5K A;  4ZLV A;  2ZYJ A;  3TFU A;  1ASB A;  5G4I A;  2BWN A;  4RKC A;  4W5K A;  1B9H A;  3Q8N A;  1ZOD A;  3E2Z B;  4ITG A;  4OBU A;  1V2E A;  4WLJ A;  3WCO A;  1AIC A;  2W8V A;  3HMU A;  4CVQ A;  4F5J A;  3ZRR A;  2DGL A;  3DXV A;  3CBF A;  2D5Y A;  2W7F A;  5IWQ A;  2VMU A;  2O0R A;  1GEY A;  2PB2 A;  1DTY A;  2AY3 A;  3AOW A;  3ASB A;  3NU8 A;  3TQX A;  3HL2 A;  1TOG A;  2VMR A;  3I4J A;  4W91 A;  1ASG A;  4E3R A;  4XJO A;  4R8D A;  1ASE A;  1B8G A;  3COG A;  4EB7 A;  1KKJ A;  2JGT A;  1IX8 A;  2VMQ A;  1GDE A;  3BN1 A;  2VMN A;  3EZS A;  5AX8 A;  4AZJ A;  2FN6 A;  4Q6R A;  1XEY A;  3I16 A;  3ECD A;  4W8I A;  3GJU A;  2HOX A;  2QB2 A;  3ATH A;  4PVF A;  1ELU A;  1Z7D A;  3WKR A;  3MBB A;  1CL1 A;  1CZC A;  2HOZ A;  4MKJ A;  4BA4 A;  1ELQ A;  3FTB A;  1QIS A;  2EGY A;  3MAU A;  1LC8 A;  4GDY A;  4WBT A;  4CBR A;  3N7N A;  1BJO A;  4Y0D A;  3B46 A;  2VIA A;  3A9X A;  3RCH A;  4R5Z A;  1LK9 A;  9AAT A;  1ARI A;  2JJG A;  4O6Z A;  4RKD A;  2D64 A;  1O69 A;  2DKJ A;  3D6K A;  1T3I A;  2W7J A;  2W7H A;  4EFF A;  1V2D A;  1W7L A;  3G7Q A;  4WYA A;  1UU0 A;  4J8L A;  1KKP A;  3NNK A;  3PD6 B;  3PPL A;  2YCT A;  2YCP A;  3RUY A;  3TAT A;  1C7N A;  1RV3 A;  1WYV B;  3N4S A;  1MDZ A;  2QMA A;  3QI6 A;  3QBO A;  1VEF A;  3A2B A;  4IXS A;  1TAR A;  4N0B A;  4XK1 A;  2QBT A;  3MAD A;  4GE7 A;  2AY2 A;  1KMJ A;  4LC3 A;  4QGR A;  2CJH A;  1GC3 A;  4GSA A;  4MY5 A;  1S0A A;  1X2A A;  2AEU A;  2VMS A;  4TN4 A;  3WCN A;  4F5L A;  5F9S A;  4A6R A;  1BJO B;  3AEP A;  3HDO A;  5EAA A;  5FT8 A;  4WYF A;  4CXR A;  2AY6 A;  3DYD A;  1N31 A;  3TCM A;  1EJI A;  1YIY A;  4KXK A;  3GWP A;  1S09 A;  3DU4 A;  3GSB A;  1Z3Z A;  3L8A A;  3RBL A;  1TOK A;  3LVJ A;  1MDX A;  2O7C A;  2X8U A;  1AAM A;  1BQD A;  1W7M A;  3LV2 A;  2W8W A;  5EIG B;  5JAY A;  5K8B A;  5J8Q A;  5I92 A;  3W1J A;  3HLM A;  4AO4 A;  1UU2 A;  2D61 A;  3PGY A;  4CXQ A;  2E7I A;  3BB8 A;  1FG7 A;  3NYU A;  1D7R A;  2WB6 A;  2D63 A;  1J04 A;  2VIB A;  2Z20 A;  2CY8 A;  3A8U X;  2XH1 A;  1LKC A;  2W8J A;  3CQ6 A;  2ORD A;  3R4T A;  3R9A A;  1AJS A;  1TPL A;  2VLF A;  4EMY A;  1SPA A;  3MAF A;  2F8J A;  2ZUK A;  1BT4 A;  4HVK A;  2CAN A;  3LG0 A;  3EUC A;  3IHJ A;  2FNU A;  1WKH A;  1PFF A;  3H14 A;  4XJP A;  3E2Z A;  3FFR A;  2R0T A;  1TAS A;  4A6U A;  3FCR A;  2AY8 A;  5D5S A;  1C7G A;  4XQ2 A;  1D7V A;  2YRR A;  1GBN A;  1LC7 A;  3FVU A;  2DGK A;  3N75 A;  4DQ6 A;  1E5E A;  2ZY2 A;  2ZSL A;  3AEJ C;  1GC2 A;  2W8U A;  4WD2 A;  1OAT A;  2HUF A;  3HVY A;  4ATQ A;  2C7T A;  2FQ6 A;  1DGE A;  2AY1 A;  2BKW A;  2PO3 A;  2CH2 A;  1FG3 A;  3FQA A;  4LNJ A;  3FKD A;  1CS1 A;  2ZSM A;  1PMO A;  4EB5 A;  1AHG A;  1ARH A;  2C81 A;  4WYD A;  2D66 A;  3ZZK A;  1O4S A;  3BWN A;  1S06 A;  4WP0 A;  3B8X A;  3WLX A;  4WB0 A;  2YKX A;  4MGR A;  1ASL A;  2GMU A;  3N0L A;  5EAV A;  4CBS A;  2W7E A;  3FZ6 A;  4OBV A;  1G7W A;  4Y0H A;  5M4D A;  4L0O A;  2HUI A;  3BWO A;  5EUD A;  4E77 A;  3VK3 A;  1MDO A;  3PDB A;  3KKI A;  2OKJ A;  4RAE A;  3UWC A;  3II0 A;  5EUE A;  2VMV A;  1SZS A;  1O61 A;  1AY8 A;  4GEB A;  2X3L A;  5BJ3 A;  1S08 A;  3USF A;  2EZ2 A;  3DXW A;  5G4J A;  2CIN A;  4A0G A;  3HQT A;  2BYJ A;  1YJS A;  1GC0 A;  1SF2 A;  1C9C A;  2GSA A;  3WY7 A;  4AH3 A;  3NTJ A;  5E5I A;  4OC9 A;  4IXZ A;  5G2P A;  4ZWM A;  4WB0 B;  4AZK A;  1WYT B;  2D7Y A;  1ASA A;  1IBJ A;  2FM1 A;  3HT4 A;  2Z9W A;  4M2K A;  1B5P A;  3B1E A;  2R5E A;  3AEN A;  3FZ7 A;  1BJW A;  1CQ6 A;  2VYC A;  3KE3 A;  5FT4 A;  2OGA A;  4K05 A;  2G7J A;  1I29 A;  1W3U A;  2VI9 A;  3DC1 A;  4XJM A;  3PAA A;  2ZY3 A;  1WYU A;  5DJ1 A;  3QPG A;  4AOA A;  3UAK A;  1MAP A;  1RVY A;  1Y4I A;  2VMZ A;  4IXO A;  3FVS A;  4W1W A;  1CJ0 A;  4DGT A;  1PG8 A;  1AKC A;  2QA3 A;  4HF8 A;  3DR7 A;  3GZD C;  2AY9 A;  1QJ5 A;  2OQX A;  2JJF A;  4B98 A;  4XJL A;  1I48 A;  3NYS A;  3JTX A;  3FQ8 A;  4ZM3 A;  1G4X A;  1WYU B;  4A6T A;  2VGV A;  4F5H A;  4GE9 A;  5LHA A;  2DR1 A;  5M49 A;  1X28 A;  2YKU A;  1WKG A;  2RFV A;  3BCB A;  3E9K A;  4FL0 A;  3NDN A;  4KAM A;  3AEN B;  4ZAH A;  5BJ4 A;  1BJ4 A;  1FC4 A;  1V72 A;  3HBX A;  2R5C B;  3MAF B;  2FYF A;  2JJH A;  5LH9 A;  2VLH A;  3RI6 A;  1KAF A;  3KGW A;  3PDX A;  3ZRP A;  1XI9 A;  2VGU A;  1OXP A;  4WYG A;  2V0Y A;  5D95 A;  7AAT A;  2HOY A;  2BIA A;  1I41 A;  2DKB A;  4EU1 A;  1KL1 A;  1M0N A;  1KL2 A;  1SZU A;  1VP4 A;  4ATP A;  3F6T A;  1TOE A;  2VMY A;  1C4K A;  3A9Y A;  1E5F A;  3G0T A;  3GBX A;  4R5F A;  1LW5 A;  4Q31 A;  4NOG A;  4RM1 A;  1ZC9 A;  1OHY A;  2JIS A;  3PDB B;  3ISL A;  5M46 A;  1AMQ A;  1JS6 A;  3JW9 A;  1BS0 A;  3CQ4 A;  3DZZ A;  4LW2 A;  3E77 A;  1RVU A;  3AOV A;  4BQ0 A;  3TFT A;  1X0M A;  2BYL A;  1TAT A;  1AIA A;  5HDM A;  1AMS A;  1TOJ A;  4F5M A;  4JF0 A;  2R5C A;  3EI5 A;  3L44 A;  4ZAS A;  2VGT A;  3I5T A;  1ZOB A;  2W7D A;  4J5U A;  5DX5 A;  3DRD A;  1EG5 A;  1O62 A;  2OGE A;  1CZE A;  1DGD A;  1M0Q A;  3PD6 A;  4LW4 A;  2WKA A;  5DJ9 A;  3BWN C;  3EIB A;  1AHE A;  1VJO A;  5E3K A;  3ELE A;  3NU7 A;  1LC5 A;  1U08 A;  5HHY A;  4XAU A;  3QN6 A;  2DGM A;  2NMP A;  1J32 A;  1YIZ A;  4LNM A;  3MC6 A;  2BIE A;  4WXG A;  3CAI A;  3PJ0 A;  1M6S A;  2C0R A;  4Q75 A;  4U1T A;  3FVX A;  4IYO B;  3EIA A;  3W1H A;  3WX9 A;  2VI8 A;  1DFO A;  2X5D A;  2VMW A;  3FQ7 A;  3MEB A;  4WXF A;  3AEO A;  1TOI A;  2Z1Z A;  3M5U A;  4P7Y A;  2AY4 A;  4U2H A;  4BMK A;  1CL2 A;  2QSR A;  1AMA A;  3F9T A;  3RQ1 A;  3W1I A;  5TF5 A;  2W7M A;  2CB1 A;  4BA5 A;  4ZDL A;  3QHX A;  4K2I A;  2BI2 A;  3ZZJ A;  4B9B A;  5EQC A;  1AKB A;  1IUG A;  2EO5 A;  2GB3 A;  2VGS A;  1ORD A;  2ZP7 A;  2OAT A;  3P6K A;  1SVV A;  2W7L A;  1GD9 A;  4WYC A;  3LVK A;  3BV0 A;  4GRX A;  2YCN A;  4W1X A;  4JE5 D;  5EUN A;  1JF9 A;  3JWA A;  2G6W A;  4ADD A;  1YJZ A;  2CTZ A;  3WGC A;  1UU1 A;  1BQA A;  4WXB A;  1YOO A;  3N5M A;  4RIT A;  4I8A A;  1X29 A;  4UQV A;  2JG2 A;  3FDD A;  2ZC0 A;  2W7G A;  1ASM A;  3NRA A;  3BC8 A;  4JEZ A;  3VAX A;  2EH6 A;  4KYO A;  2Z9U A;  1AHF A;  4F5G A;  2E7J A;  1OHV A;  3DOD A;  3H7F A;  1QIR A;  2AAT A;  2OKK A;  3FSL A;  4PFN A;  4ZWV A;  3AV7 A;  4Q76 A;  5G09 A;  1AY5 A;  2CH1 A;  1ARG A;  2VMX A;  4OT8 A;  3GET A;  3PA9 A;  1S07 A;  4N0W A;  3G8M A;  3NYT A;  4JEV A;  4RIZ A;  4XEW A;  1OHW A;  2HP1 A;  3OP7 A;  1ASC A;  4JEW A;  2WK7 A;  3H9X A;  3LWS A;  1LW4 A;  2QLR A;  2GMS A;  3CQ5 A;  4WLH A;  4AO9 A;  2YHK A;  5FT5 A;  1M0P A;  2Z9V A;  3FFH A;  4IYO A;  3A9Z A;  5G2Q A;  5DB5 A;  3QM2 A;  4OCA A;  3T32 A;  2CST A;  4JF1 A;  2FKI A;  2R2N A;  1AKA A;  3FDB A;  3N4X A;  4A0R A;  1QJ3 A;  3E2Y A;  1GEX A;  4MKK A;  3RBF A;  1GCK A;  4M2J A;  5E4Z A;  1I43 A;  3WGB A;  4OMA A;  2Z1Y A;  4P3M A;  2AEV A;  2EYQ A;  3E6G A;  4OYT A;  3EI8 A;  1B4X A;  2BI1 A;  1IVR A;  4ITX A;  2W7I A;  4ZM4 A;  2ZY4 A;  2WK8 A;  2WK9 A;  5EFS A;  1B9I A;  2YOB A;  1IX6 A;  4IW7 A;  1BW0 A;  2ZJG A;  1WST A;  4ADE A;  4MQP A;  3GR9 A;  1GC4 A;  4LNL A;  1W23 A;  3QGU A;  1G4V A;  1RV4 A;  2YRI A;  3JWB A;  5EIG A;  1DJ9 A;  2BHX A;  1H1C A;  4FFC A;  2TPL A;  4A00 A;  4K2M A;  2PB0 A;  4IY7 A;  4ADC A;  3EZ1 A;  2Z9X A;  1JS3 A;  2VGW A;  2BI5 A;  2VMT A;  3BS8 A;  4UHO A;  3PIU A;  3B1C A;  2BWP A;  5HXX A;  1C7O A;  2GQN A;  4ZSW A;  2D7Z A;  2HOR A;  1AMR A;  2W8T A;  3ASA A;  3K28 A;  3VP6 A;  1DJE A;  4JEY A;  2X5F A;  2QB3 A;  3GZD A;  1KMK A;  3B1D A;  1D7S A;  4UHM A;  4ADB A;  4ISY A;  3P1T A;  4E1O A;  1D2F A;  2Z67 A;  1IJI A; 
#chains in the Genus database with same CATH homology
 3GZC A;  1W7N A;  3AEL A;  1WYV A;  1MGV A;  3WZF A;  2BI3 A;  3AEM A;  1DJU A;  5KTB A;  3IF2 A;  1V2F A;  1MAQ A;  3F0H A;  3EI6 A;  4W1V A;  1D7U A;  4TMR A;  4H51 A;  2EPJ A;  4H63 Q;  4JE5 A;  3FZ8 A;  1N8P A;  2CJD A;  3BCX A;  1M7Y A;  3RCH B;  3WKS A;  1M32 A;  2A1V A;  1YAA A;  3MKJ A;  1MLY A;  1JG8 A;  2Q7W A;  5F8V A;  2W7K A;  1ASN A;  3AEJ A;  3AAT A;  1IAX A;  4K2B A;  2XBN A;  4RLG A;  4Y0I A;  4RJY A;  2DOU A;  1MLZ A;  1YJY A;  1QZ9 A;  3ACZ A;  3JU7 A;  3NX3 A;  2FNI A;  2AY5 A;  4MSO A;  4PFF A;  1IX7 A;  3NUI A;  1ASD A;  2E7U A;  1LS3 A;  4PIW A;  1G7X A;  4MQQ A;  8AAT A;  3DR4 A;  2JJE A;  2ZY5 A;  4JEX A;  4A72 A;  3JZL A;  1AHX A;  1AJS B;  2YKV A;  3OKS A;  1AY4 A;  3ELP A;  2Z61 A;  1P3W A;  1AJR A;  4TV7 A;  4A0F A;  3EI7 A;  4M2M A;  5M4B A;  1BJN A;  1ECX A;  4MQR A;  5FT6 A;  1M0O A;  1AHY A;  1SFF A;  1IAY A;  3VK4 A;  4DBC A;  4F4E A;  1QGN A;  4UOY A;  2CFB A;  2D65 A;  1CQ7 A;  2EZ1 A;  3UE8 A;  4ZSY A;  1GEW A;  3AEM C;  3LVM A;  3VK2 A;  1AIB A;  4A0H A;  2C44 A;  1ARS A;  3E2F A;  2YKY A;  4RJ0 A;  1YNU A;  1PMM A;  4OTL A;  5C6U A;  1C0N A;  4UHN A;  1N2T A;  4GE4 A;  4BHD A;  2VMP A;  1QIT A;  1AAW A;  2O1B A;  3FRK A;  3FD0 A;  2HP2 A;  3VOM A;  2VGZ A;  3LVL B;  3MC6 C;  2HZP A;  5G0A A;  1BKG A;  3EI9 A;  1UKJ A;  2BIG A;  2BI9 A;  1H0C A;  3N4R A;  2CJG A;  1SZK A;  2BWO A;  2V1P A;  2VMO A;  1M4N A;  3NUB A;  1B5O A;  1OXO A;  4ZDP A;  3LY1 A;  2KFP A;  1AX4 A;  2AY7 A;  2HUU A;  1CQ8 A;  1WYT A;  2E54 A;  1ART A;  1EQB A;  4F5F A;  4F5I A;  3KGX A;  4IX8 A;  3K40 A;  4E3Q A;  1ASF A;  4WYE A;  4R2N A;  3ZRQ A;  1DKA A;  3K7Y A;  4ZDO A;  3BCA A;  4F5K A;  4ZLV A;  2ZYJ A;  3TFU A;  1ASB A;  5G4I A;  2BWN A;  4RKC A;  4W5K A;  1B9H A;  3Q8N A;  1ZOD A;  3E2Z B;  4ITG A;  4OBU A;  1V2E A;  4WLJ A;  3WCO A;  1AIC A;  2W8V A;  3HMU A;  4CVQ A;  4F5J A;  3ZRR A;  2DGL A;  3DXV A;  3CBF A;  2D5Y A;  2W7F A;  5IWQ A;  2VMU A;  2O0R A;  1GEY A;  2PB2 A;  1DTY A;  2AY3 A;  3AOW A;  3ASB A;  3NU8 A;  3TQX A;  3HL2 A;  1TOG A;  2VMR A;  3I4J A;  4W91 A;  1ASG A;  4E3R A;  4XJO A;  4R8D A;  1ASE A;  1B8G A;  3COG A;  4EB7 A;  1KKJ A;  2JGT A;  1IX8 A;  2VMQ A;  1GDE A;  3BN1 A;  2VMN A;  3EZS A;  5AX8 A;  4AZJ A;  2FN6 A;  4Q6R A;  1XEY A;  3I16 A;  3ECD A;  4W8I A;  3GJU A;  2HOX A;  2QB2 A;  3ATH A;  4PVF A;  1ELU A;  1Z7D A;  3WKR A;  3MBB A;  1CL1 A;  1CZC A;  2HOZ A;  4MKJ A;  4BA4 A;  1ELQ A;  3FTB A;  1QIS A;  2EGY A;  3MAU A;  1LC8 A;  4GDY A;  4WBT A;  4CBR A;  3N7N A;  1BJO A;  4Y0D A;  3B46 A;  2VIA A;  3A9X A;  3RCH A;  4R5Z A;  1LK9 A;  9AAT A;  1ARI A;  2JJG A;  4O6Z A;  4RKD A;  2D64 A;  1O69 A;  2DKJ A;  3D6K A;  1T3I A;  2W7J A;  2W7H A;  4EFF A;  1V2D A;  1W7L A;  3G7Q A;  4WYA A;  1UU0 A;  4J8L A;  1KKP A;  3NNK A;  3PD6 B;  3PPL A;  2YCT A;  2YCP A;  3RUY A;  3TAT A;  1C7N A;  1RV3 A;  1WYV B;  3N4S A;  1MDZ A;  2QMA A;  3QI6 A;  3QBO A;  1VEF A;  3A2B A;  4IXS A;  1TAR A;  4N0B A;  4XK1 A;  2QBT A;  3MAD A;  4GE7 A;  2AY2 A;  1KMJ A;  4LC3 A;  4QGR A;  2CJH A;  1GC3 A;  4GSA A;  4MY5 A;  1S0A A;  1X2A A;  2AEU A;  2VMS A;  4TN4 A;  3WCN A;  4F5L A;  5F9S A;  4A6R A;  1BJO B;  3AEP A;  3HDO A;  5EAA A;  5FT8 A;  4WYF A;  4CXR A;  2AY6 A;  3DYD A;  1N31 A;  3TCM A;  1EJI A;  1YIY A;  4KXK A;  3GWP A;  1S09 A;  3DU4 A;  3GSB A;  1Z3Z A;  3L8A A;  3RBL A;  1TOK A;  3LVJ A;  1MDX A;  2O7C A;  2X8U A;  1AAM A;  1BQD A;  1W7M A;  3LV2 A;  2W8W A;  5EIG B;  5JAY A;  5K8B A;  5J8Q A;  5I92 A;  3W1J A;  3HLM A;  4AO4 A;  1UU2 A;  2D61 A;  3PGY A;  4CXQ A;  2E7I A;  3BB8 A;  1FG7 A;  3NYU A;  1D7R A;  2WB6 A;  2D63 A;  1J04 A;  2VIB A;  2Z20 A;  2CY8 A;  3A8U X;  2XH1 A;  1LKC A;  2W8J A;  3CQ6 A;  2ORD A;  3R4T A;  3R9A A;  1AJS A;  1TPL A;  2VLF A;  4EMY A;  1SPA A;  3MAF A;  2F8J A;  2ZUK A;  1BT4 A;  4HVK A;  2CAN A;  3LG0 A;  3EUC A;  3IHJ A;  2FNU A;  1WKH A;  1PFF A;  3H14 A;  4XJP A;  3E2Z A;  3FFR A;  2R0T A;  1TAS A;  4A6U A;  3FCR A;  2AY8 A;  5D5S A;  1C7G A;  4XQ2 A;  1D7V A;  2YRR A;  1GBN A;  1LC7 A;  3FVU A;  2DGK A;  3N75 A;  4DQ6 A;  1E5E A;  2ZY2 A;  2ZSL A;  3AEJ C;  1GC2 A;  2W8U A;  4WD2 A;  1OAT A;  2HUF A;  3HVY A;  4ATQ A;  2C7T A;  2FQ6 A;  1DGE A;  2AY1 A;  2BKW A;  2PO3 A;  2CH2 A;  1FG3 A;  3FQA A;  4LNJ A;  3FKD A;  1CS1 A;  2ZSM A;  1PMO A;  4EB5 A;  1AHG A;  1ARH A;  2C81 A;  4WYD A;  2D66 A;  3ZZK A;  1O4S A;  3BWN A;  1S06 A;  4WP0 A;  3B8X A;  3WLX A;  4WB0 A;  2YKX A;  4MGR A;  1ASL A;  2GMU A;  3N0L A;  5EAV A;  4CBS A;  2W7E A;  3FZ6 A;  4OBV A;  1G7W A;  4Y0H A;  5M4D A;  4L0O A;  2HUI A;  3BWO A;  5EUD A;  4E77 A;  3VK3 A;  1MDO A;  3PDB A;  3KKI A;  2OKJ A;  4RAE A;  3UWC A;  3II0 A;  5EUE A;  2VMV A;  1SZS A;  1O61 A;  1AY8 A;  4GEB A;  2X3L A;  5BJ3 A;  1S08 A;  3USF A;  2EZ2 A;  3DXW A;  5G4J A;  2CIN A;  4A0G A;  3HQT A;  2BYJ A;  1YJS A;  1GC0 A;  1SF2 A;  1C9C A;  2GSA A;  3WY7 A;  4AH3 A;  3NTJ A;  5E5I A;  4OC9 A;  4IXZ A;  5G2P A;  4ZWM A;  4WB0 B;  4AZK A;  1WYT B;  2D7Y A;  1ASA A;  1IBJ A;  2FM1 A;  3HT4 A;  2Z9W A;  4M2K A;  1B5P A;  3B1E A;  2R5E A;  3AEN A;  3FZ7 A;  1BJW A;  1CQ6 A;  2VYC A;  3KE3 A;  5FT4 A;  2OGA A;  4K05 A;  2G7J A;  1I29 A;  1W3U A;  2VI9 A;  3DC1 A;  4XJM A;  3PAA A;  2ZY3 A;  1WYU A;  5DJ1 A;  3QPG A;  4AOA A;  3UAK A;  1MAP A;  1RVY A;  1Y4I A;  2VMZ A;  4IXO A;  3FVS A;  4W1W A;  1CJ0 A;  4DGT A;  1PG8 A;  1AKC A;  2QA3 A;  4HF8 A;  3DR7 A;  3GZD C;  2AY9 A;  1QJ5 A;  2OQX A;  2JJF A;  4B98 A;  4XJL A;  1I48 A;  3NYS A;  3JTX A;  3FQ8 A;  4ZM3 A;  1G4X A;  1WYU B;  4A6T A;  2VGV A;  4F5H A;  4GE9 A;  5LHA A;  2DR1 A;  5M49 A;  1X28 A;  2YKU A;  1WKG A;  2RFV A;  3BCB A;  3E9K A;  4FL0 A;  3NDN A;  4KAM A;  3AEN B;  4ZAH A;  5BJ4 A;  1BJ4 A;  1FC4 A;  1V72 A;  3HBX A;  2R5C B;  3MAF B;  2FYF A;  2JJH A;  5LH9 A;  2VLH A;  3RI6 A;  3KGW A;  3PDX A;  3ZRP A;  1XI9 A;  2VGU A;  1OXP A;  4WYG A;  2V0Y A;  5D95 A;  7AAT A;  2HOY A;  2BIA A;  1I41 A;  2DKB A;  4EU1 A;  1KL1 A;  1M0N A;  1KL2 A;  1SZU A;  1VP4 A;  4ATP A;  3F6T A;  1TOE A;  2VMY A;  1C4K A;  3A9Y A;  1E5F A;  3G0T A;  3GBX A;  4R5F A;  1LW5 A;  4Q31 A;  4NOG A;  4RM1 A;  1ZC9 A;  1OHY A;  2JIS A;  3PDB B;  3ISL A;  5M46 A;  1AMQ A;  1JS6 A;  3JW9 A;  1BS0 A;  3CQ4 A;  3DZZ A;  4LW2 A;  3E77 A;  1RVU A;  3AOV A;  4BQ0 A;  3TFT A;  1X0M A;  2BYL A;  1TAT A;  1AIA A;  5HDM A;  1AMS A;  1TOJ A;  4F5M A;  4JF0 A;  2R5C A;  3EI5 A;  3L44 A;  4ZAS A;  2VGT A;  3I5T A;  1ZOB A;  2W7D A;  4J5U A;  5DX5 A;  3DRD A;  1EG5 A;  1O62 A;  2OGE A;  1CZE A;  1DGD A;  1M0Q A;  3PD6 A;  4LW4 A;  2WKA A;  5DJ9 A;  3BWN C;  3EIB A;  1AHE A;  1VJO A;  5E3K A;  3ELE A;  3NU7 A;  1LC5 A;  1U08 A;  5HHY A;  4XAU A;  3QN6 A;  2DGM A;  2NMP A;  1J32 A;  1YIZ A;  4LNM A;  3MC6 A;  2BIE A;  4WXG A;  3CAI A;  3PJ0 A;  1M6S A;  2C0R A;  4Q75 A;  4U1T A;  3FVX A;  4IYO B;  3EIA A;  3W1H A;  3WX9 A;  2VI8 A;  1DFO A;  2X5D A;  2VMW A;  3FQ7 A;  3MEB A;  4WXF A;  3AEO A;  1TOI A;  2Z1Z A;  3M5U A;  4P7Y A;  2AY4 A;  4U2H A;  4BMK A;  1CL2 A;  2QSR A;  1AMA A;  3F9T A;  3RQ1 A;  3W1I A;  5TF5 A;  2W7M A;  2CB1 A;  4BA5 A;  4ZDL A;  3QHX A;  4K2I A;  2BI2 A;  3ZZJ A;  4B9B A;  5EQC A;  1AKB A;  1IUG A;  2EO5 A;  2GB3 A;  2VGS A;  1ORD A;  2ZP7 A;  2OAT A;  3P6K A;  1SVV A;  2W7L A;  1GD9 A;  4WYC A;  3LVK A;  3BV0 A;  4GRX A;  2YCN A;  4W1X A;  4JE5 D;  5EUN A;  1JF9 A;  3JWA A;  2G6W A;  4ADD A;  1YJZ A;  2CTZ A;  3WGC A;  1UU1 A;  1BQA A;  4WXB A;  1YOO A;  3N5M A;  4RIT A;  4I8A A;  1X29 A;  4UQV A;  2JG2 A;  3FDD A;  2ZC0 A;  2W7G A;  1ASM A;  3NRA A;  3BC8 A;  4JEZ A;  3VAX A;  2EH6 A;  4KYO A;  2Z9U A;  1AHF A;  4F5G A;  2E7J A;  1OHV A;  3DOD A;  3H7F A;  1QIR A;  2AAT A;  2OKK A;  3FSL A;  4PFN A;  4ZWV A;  3AV7 A;  4Q76 A;  5G09 A;  1AY5 A;  2CH1 A;  1ARG A;  2VMX A;  4OT8 A;  3GET A;  3PA9 A;  1S07 A;  4N0W A;  3G8M A;  3NYT A;  4JEV A;  4RIZ A;  4XEW A;  1OHW A;  2HP1 A;  3OP7 A;  1ASC A;  4JEW A;  2WK7 A;  3H9X A;  3LWS A;  1LW4 A;  2QLR A;  2GMS A;  3CQ5 A;  4WLH A;  4AO9 A;  2YHK A;  5FT5 A;  1M0P A;  2Z9V A;  3FFH A;  4IYO A;  3A9Z A;  5G2Q A;  5DB5 A;  3QM2 A;  4OCA A;  3T32 A;  2CST A;  4JF1 A;  2FKI A;  2R2N A;  1AKA A;  3FDB A;  3N4X A;  4A0R A;  1QJ3 A;  3E2Y A;  1GEX A;  4MKK A;  3RBF A;  1GCK A;  4M2J A;  5E4Z A;  1I43 A;  3WGB A;  4OMA A;  2Z1Y A;  4P3M A;  2AEV A;  2EYQ A;  3E6G A;  4OYT A;  3EI8 A;  1B4X A;  2BI1 A;  1IVR A;  4ITX A;  2W7I A;  4ZM4 A;  2ZY4 A;  2WK8 A;  2WK9 A;  5EFS A;  1B9I A;  2YOB A;  1IX6 A;  4IW7 A;  1BW0 A;  2ZJG A;  1WST A;  4ADE A;  4MQP A;  3GR9 A;  1GC4 A;  4LNL A;  1W23 A;  3QGU A;  1G4V A;  1RV4 A;  2YRI A;  3JWB A;  5EIG A;  1DJ9 A;  2BHX A;  1H1C A;  4FFC A;  2TPL A;  4A00 A;  4K2M A;  2PB0 A;  4IY7 A;  4ADC A;  3EZ1 A;  2Z9X A;  1JS3 A;  2VGW A;  2BI5 A;  2VMT A;  3BS8 A;  4UHO A;  3PIU A;  3B1C A;  2BWP A;  5HXX A;  1C7O A;  2GQN A;  4ZSW A;  2D7Z A;  2HOR A;  1AMR A;  2W8T A;  3ASA A;  3K28 A;  3VP6 A;  1DJE A;  4JEY A;  2X5F A;  2QB3 A;  3GZD A;  1KMK A;  3B1D A;  1D7S A;  4UHM A;  4ADB A;  4ISY A;  3P1T A;  4E1O A;  1D2F A;  2Z67 A;  1IJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...