2G6WA

Suicide inhibition of a-oxamine synthase: structures of the covalent adducts of 8-amino-7-oxonanoate synthase with trifluoroalanine
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
383
structure length
383
Chain Sequence
SWQEKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVKPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Suicide inhibition of alpha-oxamine synthases: structures of the covalent adducts of 8-amino-7-oxononanoate synthase with trifluoroalanine.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 8-amino-7-oxononanoate synthase
total genus 133
structure length 383
sequence length 383
ec nomenclature ec 2.3.1.47: 8-amino-7-oxononanoate synthase.
pdb deposition date 2006-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2g6wA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2g6wA01
3BWOA 1S09A 1D7RA 4N0WA 5G09A 3QN6A 3AATA 3RBLA 3DRDA 3HLMA 1WYTB 1X29A 3LY1A 1TARA 3LG0A 3NDNA 1RVYA 1CJ0A 3NU7A 2VYCA 3EI8A 3MKJA 1B9IA 2R0TA 1ARHA 1C7GA 1Z7DA 1W7NA 4ZLVA 3EIAA 1S07A 2ZSMA 4IXSA 4W1XA 2DOUA 4ZSYA 2W7KA 1QZ9A 3RCHA 1AMSA 4J5UA 2OKJA 2HUFA 3BN1A 3ASAA 4HF8A 1ARSA 3RI6A 3GJUA 1KL2A 4A0GA 1WYUA 4AZJA 3ZRQA 1BT4A 3HT4A 1PG8A 1BJNA 3LWSA 2YCPA 4IW7A 2W8JA 1AMAA 2D7YA 2YKXA 4JE5D 5FT6A 4J8LA 4AO9A 3NYUA 4BA5A 3GETA 3M5UA 4W91A 4MQRA 1B9HA 2BWOA 3AOVA 3F0HA 3RQ1A 4GRXA 1MDXA 1GBNA 1JS6A 4E77A 1FG7A 2CY8A 5D5SA 4WD2A 9AATA 3PPLA 4RKDA 4CXRA 2QMAA 2JGTA 4Q31A 2OGAA 4WB0A 1ECXA 2GSAA 1RV4A 4MSOA 4RITA 1SZSA 2E7IA 2VMQA 3WCNA 3FZ8A 1W23A 3PGYA 1G4VA 1YOOA 1ELQA 2V0YA 1OXPA 3B8XA 3D6KA 2V1PA 1AHGA 3JWAA 4DBCA 3I16A 2FQ6A 5IWQA 2D64A 3H14A 5M4BA 5G2PA 2BKWA 2VI9A 3RCHB 2D5YA 4PFFA 4AOAA 2C44A 3DR4A 2YKVA 4WXFA 3PDBB 1OXOA 5LH9A 4JEZA 3MBBA 4GE7A 3JW9A 4A72A 1KMKA 2YOBA 4ADCA 1ASMA 1AY8A 1DJEA 3NNKA 2BYLA 1AAWA 2CINA 3FTBA 1ASBA 2CANA 1LKCA 2X5DA 4QGRA 1TOIA 2VLHA 4Y0DA 5FT8A 1RV3A 1MGVA 1E5EA 4ADDA 4EU1A 5M49A 4WYFA 1TOGA 3FFHA 4LC3A 4OC9A 5EIGB 4N0BA 3E2YA 2BIEA 2VMSA 5K8BA 4K2MA 2HUIA 4IY7A 2AY2A 3MAFA 4KXKA 4M2JA 5EQCA 4AZKA 5C6UA 3ZRRA 5E4ZA 1V2EA 2EH6A 2W8WA 4JEXA 4MQPA 1PFFA 7AATA 2O1BA 2W7JA 4Q75A 2QA3A 4A0FA 1LW5A 4CVQA 1IBJA 1DFOA 2VGWA 2Z9WA 3P1TA 4GSAA 1ARIA 2D66A 5HHYA 1JF9A 3VK4A 4UHOA 4WXGA 3NYSA 4ZWMA 3HL2A 2W7DA 3DZZA 2HUUA 4TV7A 2Z9VA 3BCBA 1C7OA 2OKKA 2AY7A 1C0NA 1UU1A 5G4IA 3W1JA 2AY9A 1S08A 4F5FA 4HVKA 2OGEA 4OYTA 4OTLA 1KKPA 1OHYA 2FM1A 1B4XA 1PMMA 3B46A 3FRKA 1MAPA 4M2MA 3KGXA 2BI1A 1ASNA 2O0RA 2C81A 1FG3A 4A0RA 2VMWA 5F9SA 1YAAA 4LW2A 2C0RA 1AX4A 4E3RA 1ASAA 3PIUA 3IF2A 1ZODA 1ASFA 4PVFA 4CXQA 2FN6A 3W1HA 5G2QA 3F6TA 3AENA 4F5IA 2ZP7A 3BCAA 4B98A 2D61A 3G7QA 3QM2A 3HMUA 5DJ1A 3TCMA 5FT5A 4OMAA 3AELA 2VMNA 1SFFA 1N2TA 4ZWVA 4L0OA 4IXOA 1M32A 1WYVA 4WYCA 1D2FA 2HOXA 1TOKA 3BCXA 1C4KA 5HXXA 5FT4A 3A8UX 3ECDA 3LVKA 4IYOB 3WKSA 3LVLB 3FCRA 2BWNA 3PDBA 4FL0A 3B1EA 3AENB 1BJOA 3OKSA 4DQ6A 2W7LA 1IUGA 4FFCA 2Z1ZA 1IX7A 4WXBA 5E5IA 3EZ1A 5HDMA 4UOYA 5BJ4A 4MY5A 3TQXA 3VAXA 3E2FA 3K7YA 2HZPA 4RJYA 1ASCA 3ZRPA 5AX8A 1WKHA 1YJSA 4WBTA 3JWBA 4XQ2A 3DXWA 4E3QA 3RUYA 5EFSA 2WK8A 2QBTA 3EI6A 1IX8A 2W7HA 1DKAA 1AMQA 1ASLA 1YJZA 2ZJGA 1ORDA 3QGUA 1BS0A 1QIRA 4EB7A 1DGEA 3LVJA 3QPGA 2VMPA 1LS3A 3N0LA 4RKCA 2BIAA 2VGVA 3NYTA 1WYTA 5I92A 4A6TA 3Q8NA 2AY8A 3I5TA 4K2BA 2YKUA 2AY1A 3HBXA 2D63A 4B9BA 3WCOA 4CBRA 4JEYA 1I48A 4JE5A 1YNUA 4JEWA 3BC8A 3GBXA 1ASDA 1B8GA 1AIBA 4P3MA 4BHDA 3GR9A 4R8DA 5EAVA 1TPLA 3MADA 4Q76A 2GQNA 1AHEA 1XI9A 1DJUA 4ZM3A 4WYEA 4KAMA 2BI3A 1M6SA 1JG8A 3EI7A 4ITXA 1AJSB 1O69A 3PJ0A 1CQ8A 4MQQA 1AAMA 1CS1A 4ATQA 3AOWA 4Y0HA 2VMVA 1MDOA 1AKAA 4R2NA 1AHFA 4EFFA 4F5KA 3BWNC 2DR1A 3AEPA 4XAUA 3TFUA 3AEJC 3EI5A 4ZAHA 3K40A 3A9XA 3AEMA 1QJ5A 2QB2A 3GSBA 3NU8A 1BJ4A 4TMRA 3B1DA 1TATA 2W7EA 3GZDA 3L8AA 2VMZA 2AY3A 3A9YA 4XJMA 2AATA 1MAQA 2ZYJA 4IX8A 3HDOA 5TF5A 3CQ4A 2AY4A 4IXZA 2CJDA 2HP1A 2JJHA 2HOYA 4XEWA 2HORA 1AHYA 1YIYA 3MAFB 4EMYA 1G4XA 1I29A 4R5FA 1S0AA 1J04A 1IVRA 2CH1A 2GMUA 4KYOA 4PIWA 2VMOA 3PA9A 4A6UA 4GE9A 1CQ6A 2DGMA 2D7ZA 1YIZA 2C7TA 2OQXA 1GC3A 1H1CA 1G7XA 1SZKA 1WKGA 3CQ5A 3FVXA 3JZLA 1QITA 3FQ8A 3MC6C 2AEUA 3R4TA 3L44A 1EJIA 4JF0A 4MKJA 5D95A 2VMUA 3RBFA 1CL2A 3MAUA 4E1OA 4NOGA 4OT8A 1GEYA 3FVUA 5M4DA 4Y0IA 3FVSA 1P3WA 4Q6RA 2X3LA 1D7UA 3DODA 5EUDA 2ZY4A 1GCKA 2XH1A 2BI5A 2BI2A 3QBOA 1BJWA 3NX3A 3T32A 2WK9A 1V2DA 1WSTA 1GC4A 4XJOA 3GZCA 1ELUA 1GD9A 2W8TA 3KE3A 1IAYA 2CH2A 3NRAA 2AEVA 3QHXA 4AH3A 4ZDLA 1V72A 5DJ9A 2ZUKA 2R2NA 5BJ3A 1MDZA 1CZCA 1O62A 3LVMA 3UAKA 2ZY5A 2XBNA 3WLXA 1S06A 1LW4A 4WB0B 2ZC0A 3VP6A 4XJPA 3KKIA 3FSLA 2ZSLA 3VOMA 5EUEA 1BKGA 2Z61A 2Z20A 4A00A 4F5JA 1UKJA 4WLJA 5EUNA 4DGTA 2Q7WA 1DJ9A 1X28A 3BS8A 2VMRA 1C9CA 3CQ6A 1TOJA 2WK7A 2BHXA 1GEWA 3GWPA 4F5GA 2W7IA 1DTYA 3FZ6A 1M0OA 1EG5A 2CTZA 3B1CA 1AY5A 2VGUA 4WYGA 5F8VA 3FD0A 1E5FA 4K2IA 3ACZA 2YHKA 4BMKA 3AEMC 1M0NA 2DKBA 1KKJA 2E7JA 3AEJA 2OATA 3EIBA 1Z3ZA 2YCNA 2VGTA 3BWNA 3GZDC 1X2AA 2D65A 2PO3A 4ZDOA 4W1VA 1G7WA 2AY5A 2O7CA 2RFVA 3PD6A 3W1IA 2W7GA 2AY6A 1B5PA 4OCAA 4ATPA 2X8UA 3PDXA 1CL1A 2QB3A 1LK9A 1AKBA 3G8MA 3K28A 4BA4A 2VMTA 3FKDA 1ZC9A 1AIAA 3VK2A 2TPLA 1OHVA 1RVUA 2R5EA 1IX6A 4ZM4A 3EZSA 3PAAA 4PFNA 1ASEA 1U08A 5M46A 4WYAA 2QLRA 3AV7A 3UWCA 3E2ZA 3WGBA 4ZDPA 3FQAA 3E77A 1JS3A 2E7UA 3EUCA 1GDEA 4LW4A 5G4JA 2CFBA 2WKAA 1UU0A 4JEVA 5LHAA 1LC5A 4UQVA 2EZ1A 2CJHA 3E6GA 2PB0A 1O61A 2R5CB 3BV0A 2Z67A 3II0A 1GC0A 4MGRA 2VGZA 1M7YA 4AO4A 1N8PA 1OATA 1BQDA 1V2FA 1D7SA 4RAEA 2W7MA 5EIGA 4WP0A 1CQ7A 1SPAA 5E3KA 4EB5A 3ELPA 4MKKA 1YJYA 3F9TA 3CBFA 3ELEA 1KMJA 1O4SA 1VJOA 2GB3A 1QISA 1GC2A 1BJOB 3FDDA 4ADBA 2VLFA 3TFTA 4ZSWA 4P7YA 4W8IA 5JAYA 4RJ0A 4U1TA 1XEYA 3A9ZA 2F8JA 1VP4A 2VGSA 1I41A 3P6KA 4CBSA 3FDBA 4WYDA 3TATA 2ZY2A 2VIAA 1AKCA 1AHXA 3PD6B 4H51A 2CB1A 2E54A 1WYUB 1W7LA 1H0CA 2X5FA 1T3IA 3N5MA 1BW0A 4RLGA 5DX5A 4LNLA 3ZZJA 2EZ2A 3R9AA 2VMYA 4A0HA 4JF1A 1B5OA 1LC7A 1FC4A 3ZZKA 1M0QA 2FYFA 2NMPA 2Z1YA 3FQ7A 1SVVA 3WZFA 1DGDA 3ISLA 2BI9A 1AJRA 1EQBA 2FNIA 2G6WA 3DU4A 3N75A 4A6RA 1CZEA 2JG2A 2ZY3A 4XJLA 3HVYA 1I43A 4I8AA 4F4EA 4GE4A 5DB5A 4F5MA 1WYVB 2VIBA 2W8UA 3OP7A 1J32A 1W7MA 3DYDA 2DGKA 4IYOA 2PB2A 3MEBA 2W7FA 2W8VA 3LV2A 1AMRA 5EAAA 4OBVA 1MLYA 3VK3A 3ATHA 3ASBA 4ZASA 1IJIA 2ORDA 5J8QA 2EPJA 2BWPA 1AY4A 1SF2A 1X0MA 2HOZA 2FNUA 1AJSA 3EI9A 2BIGA 2EGYA 4LNMA 1M0PA 3QI6A 4ISYA 4XK1A 2YCTA 1KL1A 2YRRA 3NTJA 4GEBA 3E9KA 1IAXA 2HP2A 2VI8A 2BYJA 2R5CA 4ITGA 3MC6A 3I4JA 4TN4A 3UE8A 1LC8A 2Z9UA 1OHWA 3JTXA 1W3UA 4LNJA 1PMOA 4UHNA 2DKJA 4GDYA 1TASA 2JJFA 4R5ZA 4O6ZA 3HQTA 1ZOBA 2YKYA 1ARTA 2CJGA 4F5HA 3WGCA 1N31A 1AICA 3NUBA 4ADEA 3COGA 2EO5A 3IHJA 1QJ3A 4RIZA 4OBUA 4UHMA 2CSTA 2GMSA 3H7FA 2DGLA 3JU7A 4WLHA 4F5LA 1TOEA 3WX9A 3G0TA 5G0AA 2Z9XA 3CAIA 3DR7A 1QGNA 4M2KA 3FFRA 1D7VA 3WKRA 1M4NA 1VEFA 8AATA 3BB8A 3A2BA 3NUIA 2YRIA 4RM1A 1BQAA 2JISA 4W5KA 1ASGA 2JJGA 1UU2A 3KGWA 1SZUA 3DC1A 4U2HA 1C7NA 3DXVA 3AEOA 1ARGA 1GEXA 4W1WA 1MLZA 3USFA 3E2ZB 3FZ7A 3WY7A 2JJEA 2VMXA 4BQ0A 1Y4IA
chains in the Genus database with same CATH superfamily
3BWOA 1S09A 1D7RA 4N0WA 5G09A 3QN6A 3AATA 3RBLA 3DRDA 3HLMA 1WYTB 1X29A 3LY1A 1TARA 3LG0A 3NDNA 1RVYA 1CJ0A 3NU7A 2VYCA 3EI8A 3MKJA 1B9IA 2R0TA 1ARHA 1C7GA 1Z7DA 1W7NA 4ZLVA 3EIAA 1S07A 2ZSMA 4IXSA 4W1XA 2DOUA 4ZSYA 2W7KA 1QZ9A 3RCHA 1AMSA 4J5UA 2OKJA 2HUFA 3BN1A 3ASAA 4HF8A 1ARSA 3RI6A 3GJUA 1KL2A 4A0GA 1WYUA 4AZJA 3ZRQA 1BT4A 3HT4A 1PG8A 1BJNA 3LWSA 2YCPA 4IW7A 2W8JA 1AMAA 2D7YA 2YKXA 4JE5D 4K05A 5FT6A 4J8LA 4AO9A 3NYUA 4BA5A 3GETA 3M5UA 4W91A 4MQRA 1B9HA 2BWOA 3AOVA 3F0HA 3RQ1A 4GRXA 1MDXA 1GBNA 1JS6A 4E77A 1FG7A 2CY8A 2KFPA 5D5SA 4WD2A 9AATA 3PPLA 4RKDA 4CXRA 2QMAA 2JGTA 4Q31A 2OGAA 4WB0A 1ECXA 2GSAA 1RV4A 4MSOA 4RITA 1SZSA 2E7IA 2VMQA 3WCNA 3FZ8A 1W23A 3PGYA 1G4VA 1YOOA 1ELQA 2V0YA 1OXPA 3B8XA 3D6KA 2V1PA 1AHGA 3JWAA 4DBCA 3I16A 2FQ6A 5IWQA 2D64A 3H14A 5M4BA 5G2PA 2BKWA 2VI9A 3RCHB 2D5YA 4PFFA 4AOAA 2C44A 3DR4A 2YKVA 4WXFA 3PDBB 1OXOA 5LH9A 4JEZA 3MBBA 4GE7A 3JW9A 4A72A 1KMKA 2YOBA 4ADCA 1ASMA 1AY8A 1DJEA 3NNKA 2BYLA 1AAWA 2CINA 3FTBA 1ASBA 2CANA 1LKCA 2X5DA 4QGRA 1TOIA 2VLHA 4Y0DA 5FT8A 1RV3A 1MGVA 1E5EA 4ADDA 4EU1A 5M49A 4WYFA 1TOGA 3FFHA 4LC3A 4OC9A 5EIGB 2A1VA 4N0BA 3E2YA 2BIEA 2VMSA 5K8BA 4K2MA 2HUIA 4IY7A 2AY2A 3MAFA 4KXKA 4M2JA 5EQCA 4AZKA 5C6UA 3ZRRA 5E4ZA 1V2EA 2EH6A 2W8WA 4JEXA 4MQPA 1PFFA 7AATA 2O1BA 2W7JA 4Q75A 2QA3A 4A0FA 1LW5A 4CVQA 1IBJA 1DFOA 2VGWA 2Z9WA 3P1TA 4GSAA 1ARIA 2D66A 5HHYA 1JF9A 3VK4A 4UHOA 4WXGA 3NYSA 4ZWMA 3HL2A 2W7DA 3DZZA 2HUUA 4TV7A 2Z9VA 3BCBA 1C7OA 2OKKA 2AY7A 1C0NA 1UU1A 5G4IA 3W1JA 2AY9A 1S08A 4F5FA 4HVKA 2OGEA 4OYTA 2WB6A 4OTLA 1KKPA 1OHYA 2FM1A 1B4XA 1PMMA 3B46A 3FRKA 1MAPA 4M2MA 3KGXA 2BI1A 1ASNA 2O0RA 2C81A 1FG3A 4A0RA 2VMWA 5F9SA 1YAAA 4LW2A 2C0RA 1AX4A 4E3RA 1ASAA 3PIUA 3IF2A 1ZODA 1ASFA 4PVFA 4CXQA 2FN6A 3W1HA 5G2QA 3F6TA 3AENA 4F5IA 2ZP7A 3BCAA 4B98A 2D61A 3G7QA 3QM2A 3HMUA 5DJ1A 3TCMA 5FT5A 4OMAA 3AELA 2VMNA 1SFFA 1N2TA 4ZWVA 4L0OA 4IXOA 1M32A 1WYVA 4WYCA 1D2FA 2HOXA 1TOKA 3BCXA 1C4KA 5HXXA 5FT4A 3A8UX 3ECDA 3LVKA 4IYOB 3WKSA 3LVLB 3FCRA 2BWNA 3PDBA 4FL0A 3B1EA 3AENB 1BJOA 3OKSA 4DQ6A 2W7LA 1IUGA 4FFCA 2Z1ZA 1IX7A 4WXBA 5E5IA 3EZ1A 5HDMA 3H9XA 4UOYA 5BJ4A 4MY5A 3TQXA 3VAXA 3E2FA 3K7YA 2HZPA 4RJYA 1ASCA 3ZRPA 5AX8A 1WKHA 1YJSA 4WBTA 3JWBA 4XQ2A 3DXWA 4E3QA 3RUYA 3N4SA 5EFSA 2WK8A 2QBTA 3EI6A 1IX8A 2W7HA 1DKAA 1AMQA 1ASLA 1YJZA 2ZJGA 1ORDA 3QGUA 1BS0A 1QIRA 4EB7A 1DGEA 3LVJA 3QPGA 2VMPA 1LS3A 3N0LA 4RKCA 2BIAA 2VGVA 3NYTA 1WYTA 5I92A 4A6TA 3Q8NA 2AY8A 3I5TA 4K2BA 2YKUA 2AY1A 3HBXA 2D63A 4B9BA 3WCOA 4CBRA 4JEYA 1I48A 4JE5A 1YNUA 4JEWA 3BC8A 3GBXA 1ASDA 1B8GA 1AIBA 4P3MA 4BHDA 3GR9A 4R8DA 5EAVA 1TPLA 3MADA 4Q76A 2GQNA 1AHEA 1XI9A 1DJUA 4ZM3A 4WYEA 4KAMA 2BI3A 1M6SA 1JG8A 3EI7A 4ITXA 1AJSB 1O69A 3PJ0A 1CQ8A 4MQQA 1AAMA 1CS1A 4ATQA 3AOWA 4Y0HA 2VMVA 2FKIA 1MDOA 1AKAA 4R2NA 1AHFA 4EFFA 4F5KA 3BWNC 2DR1A 3AEPA 4XAUA 3TFUA 3AEJC 3EI5A 4ZAHA 3K40A 2QSRA 3A9XA 3AEMA 1QJ5A 2QB2A 3GSBA 3NU8A 1BJ4A 4TMRA 3B1DA 1TATA 2W7EA 3GZDA 3L8AA 2VMZA 2AY3A 3A9YA 4XJMA 3N4RA 2AATA 1MAQA 2ZYJA 4IX8A 3HDOA 5TF5A 3CQ4A 2AY4A 4IXZA 2CJDA 2HP1A 2JJHA 2HOYA 4XEWA 2HORA 1AHYA 1YIYA 3MAFB 4EMYA 1G4XA 1I29A 4R5FA 1S0AA 1J04A 1IVRA 2CH1A 2GMUA 4KYOA 4PIWA 2VMOA 3PA9A 4A6UA 4GE9A 1CQ6A 2DGMA 2D7ZA 1YIZA 2C7TA 2OQXA 1GC3A 1H1CA 1G7XA 1SZKA 1WKGA 3CQ5A 3FVXA 3JZLA 1QITA 3FQ8A 3MC6C 2AEUA 3R4TA 3L44A 1EJIA 4JF0A 4MKJA 5D95A 2VMUA 3RBFA 1CL2A 3MAUA 4E1OA 4NOGA 4OT8A 1GEYA 3FVUA 5M4DA 4Y0IA 3FVSA 1P3WA 4Q6RA 2X3LA 1D7UA 3DODA 5EUDA 2ZY4A 1GCKA 2XH1A 2BI5A 2BI2A 3QBOA 1BJWA 3NX3A 3T32A 2G7JA 2WK9A 1V2DA 1WSTA 1GC4A 4XJOA 3GZCA 1ELUA 1GD9A 2W8TA 3KE3A 1IAYA 2CH2A 3NRAA 2AEVA 3QHXA 4AH3A 4ZDLA 1V72A 5DJ9A 2ZUKA 2R2NA 5BJ3A 1MDZA 1CZCA 1O62A 3LVMA 3UAKA 2ZY5A 2XBNA 3WLXA 1S06A 1LW4A 4WB0B 2ZC0A 3VP6A 4XJPA 3KKIA 3FSLA 2ZSLA 3VOMA 5EUEA 1BKGA 2Z61A 2Z20A 4A00A 4F5JA 1UKJA 4WLJA 5EUNA 4DGTA 2Q7WA 1DJ9A 1X28A 3BS8A 2VMRA 1C9CA 3CQ6A 1TOJA 2WK7A 2BHXA 1GEWA 3GWPA 4F5GA 2W7IA 1DTYA 3FZ6A 1M0OA 1EG5A 2CTZA 3B1CA 1AY5A 2VGUA 4WYGA 5F8VA 3FD0A 1E5FA 4K2IA 3ACZA 2YHKA 4BMKA 3AEMC 1M0NA 2DKBA 1KKJA 2E7JA 3AEJA 2OATA 3EIBA 1Z3ZA 2YCNA 2VGTA 3BWNA 3GZDC 1X2AA 2D65A 2PO3A 4ZDOA 4W1VA 1KAFA 1G7WA 2AY5A 2O7CA 2RFVA 3PD6A 3W1IA 2W7GA 2AY6A 1B5PA 4OCAA 4ATPA 2X8UA 3PDXA 1CL1A 2QB3A 1LK9A 1AKBA 3G8MA 3K28A 4BA4A 5KTBA 2VMTA 3FKDA 1ZC9A 1AIAA 3VK2A 2TPLA 1OHVA 1RVUA 2R5EA 1IX6A 4ZM4A 3EZSA 3PAAA 4PFNA 1ASEA 1U08A 5M46A 4WYAA 2QLRA 3AV7A 3UWCA 3E2ZA 3WGBA 4ZDPA 3FQAA 3E77A 1JS3A 2E7UA 3EUCA 1GDEA 4LW4A 5G4JA 2CFBA 2WKAA 1UU0A 4JEVA 5LHAA 1LC5A 4UQVA 2EZ1A 2CJHA 3E6GA 2PB0A 1O61A 2R5CB 3BV0A 2Z67A 3II0A 1GC0A 4MGRA 2VGZA 1M7YA 4AO4A 1N8PA 1OATA 1BQDA 1V2FA 1D7SA 4RAEA 2W7MA 5EIGA 4WP0A 1CQ7A 1SPAA 5E3KA 4EB5A 3ELPA 4MKKA 1YJYA 3F9TA 3CBFA 3ELEA 1KMJA 1O4SA 1VJOA 2GB3A 1QISA 1GC2A 1BJOB 3FDDA 4ADBA 2VLFA 3TFTA 4ZSWA 4P7YA 4W8IA 5JAYA 4RJ0A 4U1TA 1XEYA 3A9ZA 2F8JA 1VP4A 2VGSA 1I41A 3P6KA 4CBSA 3FDBA 4WYDA 3TATA 2ZY2A 2VIAA 1AKCA 1AHXA 3PD6B 4H51A 2CB1A 2E54A 1WYUB 1W7LA 1H0CA 2X5FA 1T3IA 3N5MA 1BW0A 4RLGA 5DX5A 4LNLA 3ZZJA 2EZ2A 3R9AA 2VMYA 4A0HA 4JF1A 1B5OA 1LC7A 1FC4A 3ZZKA 1M0QA 2FYFA 2NMPA 2Z1YA 3FQ7A 1SVVA 3WZFA 1DGDA 3ISLA 2BI9A 1AJRA 1EQBA 2FNIA 2G6WA 3DU4A 3N75A 4A6RA 1CZEA 2JG2A 2ZY3A 4XJLA 3HVYA 1I43A 4I8AA 4F4EA 4GE4A 5DB5A 4F5MA 1WYVB 2VIBA 2W8UA 3OP7A 1J32A 1W7MA 3DYDA 2DGKA 4IYOA 2PB2A 3MEBA 2W7FA 2W8VA 3LV2A 1AMRA 5EAAA 4OBVA 1MLYA 3VK3A 3ATHA 3ASBA 4ZASA 1IJIA 2ORDA 5J8QA 2EPJA 2BWPA 1AY4A 1SF2A 1X0MA 2HOZA 2FNUA 1AJSA 3EI9A 2BIGA 2EGYA 4LNMA 1M0PA 3QI6A 4ISYA 4XK1A 2YCTA 1KL1A 2YRRA 3NTJA 4GEBA 3E9KA 1IAXA 2HP2A 2VI8A 2BYJA 2R5CA 3N4XA 4H63Q 4ITGA 3MC6A 3I4JA 4TN4A 3UE8A 1LC8A 2Z9UA 1OHWA 3JTXA 1W3UA 4LNJA 1PMOA 4UHNA 2DKJA 4GDYA 1TASA 2JJFA 4R5ZA 4O6ZA 3HQTA 1ZOBA 2YKYA 1ARTA 2CJGA 4F5HA 3WGCA 1N31A 1AICA 3NUBA 3N7NA 4ADEA 3COGA 2EO5A 3IHJA 1QJ3A 4RIZA 4OBUA 4UHMA 2CSTA 2GMSA 3H7FA 2DGLA 3JU7A 4WLHA 2EYQA 4F5LA 1TOEA 3WX9A 3G0TA 5G0AA 2Z9XA 3CAIA 3DR7A 1QGNA 4M2KA 3FFRA 1D7VA 3WKRA 1M4NA 1VEFA 8AATA 3BB8A 3A2BA 3NUIA 2YRIA 4RM1A 1BQAA 2JISA 4W5KA 1ASGA 2JJGA 1UU2A 3KGWA 1SZUA 3DC1A 4U2HA 1C7NA 3DXVA 3AEOA 1ARGA 1GEXA 4W1WA 1MLZA 3USFA 3E2ZB 3FZ7A 3WY7A 2JJEA 2VMXA 4BQ0A 1Y4IA
chains in the Genus database with same CATH topology
3BWOA 1S09A 1D7RA 4N0WA 5G09A 3QN6A 3AATA 3RBLA 3DRDA 3HLMA 1WYTB 1X29A 3LY1A 1TARA 3LG0A 3NDNA 1RVYA 1CJ0A 3NU7A 2VYCA 3EI8A 3MKJA 1B9IA 2R0TA 1ARHA 1C7GA 1Z7DA 1W7NA 4ZLVA 3EIAA 1S07A 2ZSMA 4IXSA 4W1XA 2DOUA 4ZSYA 2W7KA 1QZ9A 3RCHA 1AMSA 4J5UA 2OKJA 2HUFA 3BN1A 3ASAA 4HF8A 1ARSA 3RI6A 3GJUA 1KL2A 4A0GA 1WYUA 4AZJA 3ZRQA 1BT4A 3HT4A 1PG8A 1BJNA 3LWSA 2YCPA 4IW7A 2W8JA 1AMAA 2D7YA 2YKXA 4JE5D 4K05A 5FT6A 4J8LA 4AO9A 3NYUA 4BA5A 3GETA 3M5UA 4W91A 4MQRA 1B9HA 2BWOA 3AOVA 3F0HA 3RQ1A 4GRXA 1MDXA 1GBNA 1JS6A 4E77A 1FG7A 2CY8A 2KFPA 5D5SA 4WD2A 9AATA 3PPLA 4RKDA 4CXRA 2QMAA 2JGTA 4Q31A 2OGAA 4WB0A 1ECXA 2GSAA 1RV4A 4MSOA 4RITA 1SZSA 2E7IA 2VMQA 3WCNA 3FZ8A 1W23A 3PGYA 1G4VA 1YOOA 1ELQA 2V0YA 1OXPA 3B8XA 3D6KA 2V1PA 1AHGA 3JWAA 4DBCA 3I16A 2FQ6A 5IWQA 2D64A 3H14A 5M4BA 5G2PA 2BKWA 2VI9A 3RCHB 2D5YA 4PFFA 4AOAA 2C44A 3DR4A 2YKVA 4WXFA 3PDBB 1OXOA 5LH9A 4JEZA 3MBBA 4GE7A 3JW9A 4A72A 1KMKA 2YOBA 4ADCA 1ASMA 1AY8A 1DJEA 3NNKA 2BYLA 1AAWA 2CINA 3FTBA 1ASBA 2CANA 1LKCA 2X5DA 4QGRA 1TOIA 2VLHA 4Y0DA 5FT8A 1RV3A 1MGVA 1E5EA 4ADDA 4EU1A 5M49A 4WYFA 1TOGA 3FFHA 4LC3A 4OC9A 5EIGB 2A1VA 4N0BA 3E2YA 2BIEA 2VMSA 5K8BA 4K2MA 2HUIA 4IY7A 2AY2A 3MAFA 4KXKA 4M2JA 5EQCA 4AZKA 5C6UA 3ZRRA 5E4ZA 1V2EA 2EH6A 2W8WA 4JEXA 4MQPA 1PFFA 7AATA 2O1BA 2W7JA 4Q75A 2QA3A 4A0FA 1LW5A 4CVQA 1IBJA 1DFOA 2VGWA 2Z9WA 3P1TA 4GSAA 1ARIA 2D66A 5HHYA 1JF9A 3VK4A 4UHOA 4WXGA 3NYSA 4ZWMA 3HL2A 2W7DA 3DZZA 2HUUA 4TV7A 2Z9VA 3BCBA 1C7OA 2OKKA 2AY7A 1C0NA 1UU1A 5G4IA 3W1JA 2AY9A 1S08A 4F5FA 4HVKA 2OGEA 4OYTA 2WB6A 4OTLA 1KKPA 1OHYA 2FM1A 1B4XA 1PMMA 3B46A 3FRKA 1MAPA 4M2MA 3KGXA 2BI1A 1ASNA 2O0RA 2C81A 1FG3A 4A0RA 2VMWA 5F9SA 1YAAA 4LW2A 2C0RA 1AX4A 4E3RA 1ASAA 3PIUA 3IF2A 1ZODA 1ASFA 4PVFA 4CXQA 2FN6A 3W1HA 5G2QA 3F6TA 3AENA 4F5IA 2ZP7A 3BCAA 4B98A 2D61A 3G7QA 3QM2A 3HMUA 5DJ1A 3TCMA 5FT5A 4OMAA 3AELA 2VMNA 1SFFA 1N2TA 4ZWVA 4L0OA 4IXOA 1M32A 1WYVA 4WYCA 1D2FA 2HOXA 1TOKA 3BCXA 1C4KA 5HXXA 5FT4A 3A8UX 3ECDA 3LVKA 4IYOB 3WKSA 3LVLB 3FCRA 2BWNA 3PDBA 4FL0A 3B1EA 3AENB 1BJOA 3OKSA 4DQ6A 2W7LA 1IUGA 4FFCA 2Z1ZA 1IX7A 4WXBA 5E5IA 3EZ1A 5HDMA 3H9XA 4UOYA 5BJ4A 4MY5A 3TQXA 3VAXA 3E2FA 3K7YA 2HZPA 4RJYA 1ASCA 3ZRPA 5AX8A 1WKHA 1YJSA 4WBTA 3JWBA 4XQ2A 3DXWA 4E3QA 3RUYA 3N4SA 5EFSA 2WK8A 2QBTA 3EI6A 1IX8A 2W7HA 1DKAA 1AMQA 1ASLA 1YJZA 2ZJGA 1ORDA 3QGUA 1BS0A 1QIRA 4EB7A 1DGEA 3LVJA 3QPGA 2VMPA 1LS3A 3N0LA 4RKCA 2BIAA 2VGVA 3NYTA 1WYTA 5I92A 4A6TA 3Q8NA 2AY8A 3I5TA 4K2BA 2YKUA 2AY1A 3HBXA 2D63A 4B9BA 3WCOA 4CBRA 4JEYA 1I48A 4JE5A 1YNUA 4JEWA 3BC8A 3GBXA 1ASDA 1B8GA 1AIBA 4P3MA 4BHDA 3GR9A 4R8DA 5EAVA 1TPLA 3MADA 4Q76A 2GQNA 1AHEA 1XI9A 1DJUA 4ZM3A 4WYEA 4KAMA 2BI3A 1M6SA 1JG8A 3EI7A 4ITXA 1AJSB 1O69A 3PJ0A 1CQ8A 4MQQA 1AAMA 1CS1A 4ATQA 3AOWA 4Y0HA 2VMVA 2FKIA 1MDOA 1AKAA 4R2NA 1AHFA 4EFFA 4F5KA 3BWNC 2DR1A 3AEPA 4XAUA 3TFUA 3AEJC 3EI5A 4ZAHA 3K40A 2QSRA 3A9XA 3AEMA 1QJ5A 2QB2A 3GSBA 3NU8A 1BJ4A 4TMRA 3B1DA 1TATA 2W7EA 3GZDA 3L8AA 2VMZA 2AY3A 3A9YA 4XJMA 3N4RA 2AATA 1MAQA 2ZYJA 4IX8A 3HDOA 5TF5A 3CQ4A 2AY4A 4IXZA 2CJDA 2HP1A 2JJHA 2HOYA 4XEWA 2HORA 1AHYA 1YIYA 3MAFB 4EMYA 1G4XA 1I29A 4R5FA 1S0AA 1J04A 1IVRA 2CH1A 2GMUA 4KYOA 4PIWA 2VMOA 3PA9A 4A6UA 4GE9A 1CQ6A 2DGMA 2D7ZA 1YIZA 2C7TA 2OQXA 1GC3A 1H1CA 1G7XA 1SZKA 1WKGA 3CQ5A 3FVXA 3JZLA 1QITA 3FQ8A 3MC6C 2AEUA 3R4TA 3L44A 1EJIA 4JF0A 4MKJA 5D95A 2VMUA 3RBFA 1CL2A 3MAUA 4E1OA 4NOGA 4OT8A 1GEYA 3FVUA 5M4DA 4Y0IA 3FVSA 1P3WA 4Q6RA 2X3LA 1D7UA 3DODA 5EUDA 2ZY4A 1GCKA 2XH1A 2BI5A 2BI2A 3QBOA 1BJWA 3NX3A 3T32A 2G7JA 2WK9A 1V2DA 1WSTA 1GC4A 4XJOA 3GZCA 1ELUA 1GD9A 2W8TA 3KE3A 1IAYA 2CH2A 3NRAA 2AEVA 3QHXA 4AH3A 4ZDLA 1V72A 5DJ9A 2ZUKA 2R2NA 5BJ3A 1MDZA 1CZCA 1O62A 3LVMA 3UAKA 2ZY5A 2XBNA 3WLXA 1S06A 1LW4A 4WB0B 2ZC0A 3VP6A 4XJPA 3KKIA 3FSLA 2ZSLA 3VOMA 5EUEA 1BKGA 2Z61A 2Z20A 4A00A 4F5JA 1UKJA 4WLJA 5EUNA 4DGTA 2Q7WA 1DJ9A 1X28A 3BS8A 2VMRA 1C9CA 3CQ6A 1TOJA 2WK7A 2BHXA 1GEWA 3GWPA 4F5GA 2W7IA 1DTYA 3FZ6A 1M0OA 1EG5A 2CTZA 3B1CA 1AY5A 2VGUA 4WYGA 5F8VA 3FD0A 1E5FA 4K2IA 3ACZA 2YHKA 4BMKA 3AEMC 1M0NA 2DKBA 1KKJA 2E7JA 3AEJA 2OATA 3EIBA 1Z3ZA 2YCNA 2VGTA 3BWNA 3GZDC 1X2AA 2D65A 2PO3A 4ZDOA 4W1VA 1G7WA 2AY5A 2O7CA 2RFVA 3PD6A 3W1IA 2W7GA 2AY6A 1B5PA 4OCAA 4ATPA 2X8UA 3PDXA 1CL1A 2QB3A 1LK9A 1AKBA 3G8MA 3K28A 4BA4A 5KTBA 2VMTA 3FKDA 1ZC9A 1AIAA 3VK2A 2TPLA 1OHVA 1RVUA 2R5EA 1IX6A 4ZM4A 3EZSA 3PAAA 4PFNA 1ASEA 1U08A 5M46A 4WYAA 2QLRA 3AV7A 3UWCA 3E2ZA 3WGBA 4ZDPA 3FQAA 3E77A 1JS3A 2E7UA 3EUCA 1GDEA 4LW4A 5G4JA 2CFBA 2WKAA 1UU0A 4JEVA 5LHAA 1LC5A 4UQVA 2EZ1A 2CJHA 3E6GA 2PB0A 1O61A 2R5CB 3BV0A 2Z67A 3II0A 1GC0A 4MGRA 2VGZA 1M7YA 4AO4A 1N8PA 1OATA 1BQDA 1V2FA 1D7SA 4RAEA 2W7MA 5EIGA 4WP0A 1CQ7A 1SPAA 5E3KA 4EB5A 3ELPA 4MKKA 1YJYA 3F9TA 3CBFA 3ELEA 1KMJA 1O4SA 1VJOA 2GB3A 1QISA 1GC2A 1BJOB 3FDDA 4ADBA 2VLFA 3TFTA 4ZSWA 4P7YA 4W8IA 5JAYA 4RJ0A 4U1TA 1XEYA 3A9ZA 2F8JA 1VP4A 2VGSA 1I41A 3P6KA 4CBSA 3FDBA 4WYDA 3TATA 2ZY2A 2VIAA 1AKCA 1AHXA 3PD6B 4H51A 2CB1A 2E54A 1WYUB 1W7LA 1H0CA 2X5FA 1T3IA 3N5MA 1BW0A 4RLGA 5DX5A 4LNLA 3ZZJA 2EZ2A 3R9AA 2VMYA 4A0HA 4JF1A 1B5OA 1LC7A 1FC4A 3ZZKA 1M0QA 2FYFA 2NMPA 2Z1YA 3FQ7A 1SVVA 3WZFA 1DGDA 3ISLA 2BI9A 1AJRA 1EQBA 2FNIA 2G6WA 3DU4A 3N75A 4A6RA 1CZEA 2JG2A 2ZY3A 4XJLA 3HVYA 1I43A 4I8AA 4F4EA 4GE4A 5DB5A 4F5MA 1WYVB 2VIBA 2W8UA 3OP7A 1J32A 1W7MA 3DYDA 2DGKA 4IYOA 2PB2A 3MEBA 2W7FA 2W8VA 3LV2A 1AMRA 5EAAA 4OBVA 1MLYA 3VK3A 3ATHA 3ASBA 4ZASA 1IJIA 2ORDA 5J8QA 2EPJA 2BWPA 1AY4A 1SF2A 1X0MA 2HOZA 2FNUA 1AJSA 3EI9A 2BIGA 2EGYA 4LNMA 1M0PA 3QI6A 4ISYA 4XK1A 2YCTA 1KL1A 2YRRA 3NTJA 4GEBA 3E9KA 1IAXA 2HP2A 2VI8A 2BYJA 2R5CA 3N4XA 4H63Q 4ITGA 3MC6A 3I4JA 4TN4A 3UE8A 1LC8A 2Z9UA 1OHWA 3JTXA 1W3UA 4LNJA 1PMOA 4UHNA 2DKJA 4GDYA 1TASA 2JJFA 4R5ZA 4O6ZA 3HQTA 1ZOBA 2YKYA 1ARTA 2CJGA 4F5HA 3WGCA 1N31A 1AICA 3NUBA 3N7NA 4ADEA 3COGA 2EO5A 3IHJA 1QJ3A 4RIZA 4OBUA 4UHMA 2CSTA 2GMSA 3H7FA 2DGLA 3JU7A 4WLHA 2EYQA 4F5LA 1TOEA 3WX9A 3G0TA 5G0AA 2Z9XA 3CAIA 3DR7A 1QGNA 4M2KA 3FFRA 1D7VA 3WKRA 1M4NA 1VEFA 8AATA 3BB8A 3A2BA 3NUIA 2YRIA 4RM1A 1BQAA 2JISA 4W5KA 1ASGA 2JJGA 1UU2A 3KGWA 1SZUA 3DC1A 4U2HA 1C7NA 3DXVA 3AEOA 1ARGA 1GEXA 4W1WA 1MLZA 3USFA 3E2ZB 3FZ7A 3WY7A 2JJEA 2VMXA 4BQ0A 1Y4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BWO A;  1S09 A;  1D7R A;  4N0W A;  5G09 A;  3QN6 A;  3AAT A;  3RBL A;  3DRD A;  3HLM A;  1WYT B;  1X29 A;  3LY1 A;  1TAR A;  3LG0 A;  3NDN A;  1RVY A;  1CJ0 A;  3NU7 A;  2VYC A;  3EI8 A;  3MKJ A;  1B9I A;  2R0T A;  1ARH A;  1C7G A;  1Z7D A;  1W7N A;  4ZLV A;  3EIA A;  1S07 A;  2ZSM A;  4IXS A;  4W1X A;  2DOU A;  4ZSY A;  2W7K A;  1QZ9 A;  3RCH A;  1AMS A;  4J5U A;  2OKJ A;  2HUF A;  3BN1 A;  3ASA A;  4HF8 A;  1ARS A;  3RI6 A;  3GJU A;  1KL2 A;  4A0G A;  1WYU A;  4AZJ A;  3ZRQ A;  1BT4 A;  3HT4 A;  1PG8 A;  1BJN A;  3LWS A;  2YCP A;  4IW7 A;  2W8J A;  1AMA A;  2D7Y A;  2YKX A;  4JE5 D;  5FT6 A;  4J8L A;  4AO9 A;  3NYU A;  4BA5 A;  3GET A;  3M5U A;  4W91 A;  4MQR A;  1B9H A;  2BWO A;  3AOV A;  3F0H A;  3RQ1 A;  4GRX A;  1MDX A;  1GBN A;  1JS6 A;  4E77 A;  1FG7 A;  2CY8 A;  5D5S A;  4WD2 A;  9AAT A;  3PPL A;  4RKD A;  4CXR A;  2QMA A;  2JGT A;  4Q31 A;  2OGA A;  4WB0 A;  1ECX A;  2GSA A;  1RV4 A;  4MSO A;  4RIT A;  1SZS A;  2E7I A;  2VMQ A;  3WCN A;  3FZ8 A;  1W23 A;  3PGY A;  1G4V A;  1YOO A;  1ELQ A;  2V0Y A;  1OXP A;  3B8X A;  3D6K A;  2V1P A;  1AHG A;  3JWA A;  4DBC A;  3I16 A;  2FQ6 A;  5IWQ A;  2D64 A;  3H14 A;  5M4B A;  5G2P A;  2BKW A;  2VI9 A;  3RCH B;  2D5Y A;  4PFF A;  4AOA A;  2C44 A;  3DR4 A;  2YKV A;  4WXF A;  3PDB B;  1OXO A;  5LH9 A;  4JEZ A;  3MBB A;  4GE7 A;  3JW9 A;  4A72 A;  1KMK A;  2YOB A;  4ADC A;  1ASM A;  1AY8 A;  1DJE A;  3NNK A;  2BYL A;  1AAW A;  2CIN A;  3FTB A;  1ASB A;  2CAN A;  1LKC A;  2X5D A;  4QGR A;  1TOI A;  2VLH A;  4Y0D A;  5FT8 A;  1RV3 A;  1MGV A;  1E5E A;  4ADD A;  4EU1 A;  5M49 A;  4WYF A;  1TOG A;  3FFH A;  4LC3 A;  4OC9 A;  5EIG B;  4N0B A;  3E2Y A;  2BIE A;  2VMS A;  5K8B A;  4K2M A;  2HUI A;  4IY7 A;  2AY2 A;  3MAF A;  4KXK A;  4M2J A;  5EQC A;  4AZK A;  5C6U A;  3ZRR A;  5E4Z A;  1V2E A;  2EH6 A;  2W8W A;  4JEX A;  4MQP A;  1PFF A;  7AAT A;  2O1B A;  2W7J A;  4Q75 A;  2QA3 A;  4A0F A;  1LW5 A;  4CVQ A;  1IBJ A;  1DFO A;  2VGW A;  2Z9W A;  3P1T A;  4GSA A;  1ARI A;  2D66 A;  5HHY A;  1JF9 A;  3VK4 A;  4UHO A;  4WXG A;  3NYS A;  4ZWM A;  3HL2 A;  2W7D A;  3DZZ A;  2HUU A;  4TV7 A;  2Z9V A;  3BCB A;  1C7O A;  2OKK A;  2AY7 A;  1C0N A;  1UU1 A;  5G4I A;  3W1J A;  2AY9 A;  1S08 A;  4F5F A;  4HVK A;  2OGE A;  4OYT A;  4OTL A;  1KKP A;  1OHY A;  2FM1 A;  1B4X A;  1PMM A;  3B46 A;  3FRK A;  1MAP A;  4M2M A;  3KGX A;  2BI1 A;  1ASN A;  2O0R A;  2C81 A;  1FG3 A;  4A0R A;  2VMW A;  5F9S A;  1YAA A;  4LW2 A;  2C0R A;  1AX4 A;  4E3R A;  1ASA A;  3PIU A;  3IF2 A;  1ZOD A;  1ASF A;  4PVF A;  4CXQ A;  2FN6 A;  3W1H A;  5G2Q A;  3F6T A;  3AEN A;  4F5I A;  2ZP7 A;  3BCA A;  4B98 A;  2D61 A;  3G7Q A;  3QM2 A;  3HMU A;  5DJ1 A;  3TCM A;  5FT5 A;  4OMA A;  3AEL A;  2VMN A;  1SFF A;  1N2T A;  4ZWV A;  4L0O A;  4IXO A;  1M32 A;  1WYV A;  4WYC A;  1D2F A;  2HOX A;  1TOK A;  3BCX A;  1C4K A;  5HXX A;  5FT4 A;  3A8U X;  3ECD A;  3LVK A;  4IYO B;  3WKS A;  3LVL B;  3FCR A;  2BWN A;  3PDB A;  4FL0 A;  3B1E A;  3AEN B;  1BJO A;  3OKS A;  4DQ6 A;  2W7L A;  1IUG A;  4FFC A;  2Z1Z A;  1IX7 A;  4WXB A;  5E5I A;  3EZ1 A;  5HDM A;  4UOY A;  5BJ4 A;  4MY5 A;  3TQX A;  3VAX A;  3E2F A;  3K7Y A;  2HZP A;  4RJY A;  1ASC A;  3ZRP A;  5AX8 A;  1WKH A;  1YJS A;  4WBT A;  3JWB A;  4XQ2 A;  3DXW A;  4E3Q A;  3RUY A;  5EFS A;  2WK8 A;  2QBT A;  3EI6 A;  1IX8 A;  2W7H A;  1DKA A;  1AMQ A;  1ASL A;  1YJZ A;  2ZJG A;  1ORD A;  3QGU A;  1BS0 A;  1QIR A;  4EB7 A;  1DGE A;  3LVJ A;  3QPG A;  2VMP A;  1LS3 A;  3N0L A;  4RKC A;  2BIA A;  2VGV A;  3NYT A;  1WYT A;  5I92 A;  4A6T A;  3Q8N A;  2AY8 A;  3I5T A;  4K2B A;  2YKU A;  2AY1 A;  3HBX A;  2D63 A;  4B9B A;  3WCO A;  4CBR A;  4JEY A;  1I48 A;  4JE5 A;  1YNU A;  4JEW A;  3BC8 A;  3GBX A;  1ASD A;  1B8G A;  1AIB A;  4P3M A;  4BHD A;  3GR9 A;  4R8D A;  5EAV A;  1TPL A;  3MAD A;  4Q76 A;  2GQN A;  1AHE A;  1XI9 A;  1DJU A;  4ZM3 A;  4WYE A;  4KAM A;  2BI3 A;  1M6S A;  1JG8 A;  3EI7 A;  4ITX A;  1AJS B;  1O69 A;  3PJ0 A;  1CQ8 A;  4MQQ A;  1AAM A;  1CS1 A;  4ATQ A;  3AOW A;  4Y0H A;  2VMV A;  1MDO A;  1AKA A;  4R2N A;  1AHF A;  4EFF A;  4F5K A;  3BWN C;  2DR1 A;  3AEP A;  4XAU A;  3TFU A;  3AEJ C;  3EI5 A;  4ZAH A;  3K40 A;  3A9X A;  3AEM A;  1QJ5 A;  2QB2 A;  3GSB A;  3NU8 A;  1BJ4 A;  4TMR A;  3B1D A;  1TAT A;  2W7E A;  3GZD A;  3L8A A;  2VMZ A;  2AY3 A;  3A9Y A;  4XJM A;  2AAT A;  1MAQ A;  2ZYJ A;  4IX8 A;  3HDO A;  5TF5 A;  3CQ4 A;  2AY4 A;  4IXZ A;  2CJD A;  2HP1 A;  2JJH A;  2HOY A;  4XEW A;  2HOR A;  1AHY A;  1YIY A;  3MAF B;  4EMY A;  1G4X A;  1I29 A;  4R5F A;  1S0A A;  1J04 A;  1IVR A;  2CH1 A;  2GMU A;  4KYO A;  4PIW A;  2VMO A;  3PA9 A;  4A6U A;  4GE9 A;  1CQ6 A;  2DGM A;  2D7Z A;  1YIZ A;  2C7T A;  2OQX A;  1GC3 A;  1H1C A;  1G7X A;  1SZK A;  1WKG A;  3CQ5 A;  3FVX A;  3JZL A;  1QIT A;  3FQ8 A;  3MC6 C;  2AEU A;  3R4T A;  3L44 A;  1EJI A;  4JF0 A;  4MKJ A;  5D95 A;  2VMU A;  3RBF A;  1CL2 A;  3MAU A;  4E1O A;  4NOG A;  4OT8 A;  1GEY A;  3FVU A;  5M4D A;  4Y0I A;  3FVS A;  1P3W A;  4Q6R A;  2X3L A;  1D7U A;  3DOD A;  5EUD A;  2ZY4 A;  1GCK A;  2XH1 A;  2BI5 A;  2BI2 A;  3QBO A;  1BJW A;  3NX3 A;  3T32 A;  2WK9 A;  1V2D A;  1WST A;  1GC4 A;  4XJO A;  3GZC A;  1ELU A;  1GD9 A;  2W8T A;  3KE3 A;  1IAY A;  2CH2 A;  3NRA A;  2AEV A;  3QHX A;  4AH3 A;  4ZDL A;  1V72 A;  5DJ9 A;  2ZUK A;  2R2N A;  5BJ3 A;  1MDZ A;  1CZC A;  1O62 A;  3LVM A;  3UAK A;  2ZY5 A;  2XBN A;  3WLX A;  1S06 A;  1LW4 A;  4WB0 B;  2ZC0 A;  3VP6 A;  4XJP A;  3KKI A;  3FSL A;  2ZSL A;  3VOM A;  5EUE A;  1BKG A;  2Z61 A;  2Z20 A;  4A00 A;  4F5J A;  1UKJ A;  4WLJ A;  5EUN A;  4DGT A;  2Q7W A;  1DJ9 A;  1X28 A;  3BS8 A;  2VMR A;  1C9C A;  3CQ6 A;  1TOJ A;  2WK7 A;  2BHX A;  1GEW A;  3GWP A;  4F5G A;  2W7I A;  1DTY A;  3FZ6 A;  1M0O A;  1EG5 A;  2CTZ A;  3B1C A;  1AY5 A;  2VGU A;  4WYG A;  5F8V A;  3FD0 A;  1E5F A;  4K2I A;  3ACZ A;  2YHK A;  4BMK A;  3AEM C;  1M0N A;  2DKB A;  1KKJ A;  2E7J A;  3AEJ A;  2OAT A;  3EIB A;  1Z3Z A;  2YCN A;  2VGT A;  3BWN A;  3GZD C;  1X2A A;  2D65 A;  2PO3 A;  4ZDO A;  4W1V A;  1G7W A;  2AY5 A;  2O7C A;  2RFV A;  3PD6 A;  3W1I A;  2W7G A;  2AY6 A;  1B5P A;  4OCA A;  4ATP A;  2X8U A;  3PDX A;  1CL1 A;  2QB3 A;  1LK9 A;  1AKB A;  3G8M A;  3K28 A;  4BA4 A;  2VMT A;  3FKD A;  1ZC9 A;  1AIA A;  3VK2 A;  2TPL A;  1OHV A;  1RVU A;  2R5E A;  1IX6 A;  4ZM4 A;  3EZS A;  3PAA A;  4PFN A;  1ASE A;  1U08 A;  5M46 A;  4WYA A;  2QLR A;  3AV7 A;  3UWC A;  3E2Z A;  3WGB A;  4ZDP A;  3FQA A;  3E77 A;  1JS3 A;  2E7U A;  3EUC A;  1GDE A;  4LW4 A;  5G4J A;  2CFB A;  2WKA A;  1UU0 A;  4JEV A;  5LHA A;  1LC5 A;  4UQV A;  2EZ1 A;  2CJH A;  3E6G A;  2PB0 A;  1O61 A;  2R5C B;  3BV0 A;  2Z67 A;  3II0 A;  1GC0 A;  4MGR A;  2VGZ A;  1M7Y A;  4AO4 A;  1N8P A;  1OAT A;  1BQD A;  1V2F A;  1D7S A;  4RAE A;  2W7M A;  5EIG A;  4WP0 A;  1CQ7 A;  1SPA A;  5E3K A;  4EB5 A;  3ELP A;  4MKK A;  1YJY A;  3F9T A;  3CBF A;  3ELE A;  1KMJ A;  1O4S A;  1VJO A;  2GB3 A;  1QIS A;  1GC2 A;  1BJO B;  3FDD A;  4ADB A;  2VLF A;  3TFT A;  4ZSW A;  4P7Y A;  4W8I A;  5JAY A;  4RJ0 A;  4U1T A;  1XEY A;  3A9Z A;  2F8J A;  1VP4 A;  2VGS A;  1I41 A;  3P6K A;  4CBS A;  3FDB A;  4WYD A;  3TAT A;  2ZY2 A;  2VIA A;  1AKC A;  1AHX A;  3PD6 B;  4H51 A;  2CB1 A;  2E54 A;  1WYU B;  1W7L A;  1H0C A;  2X5F A;  1T3I A;  3N5M A;  1BW0 A;  4RLG A;  5DX5 A;  4LNL A;  3ZZJ A;  2EZ2 A;  3R9A A;  2VMY A;  4A0H A;  4JF1 A;  1B5O A;  1LC7 A;  1FC4 A;  3ZZK A;  1M0Q A;  2FYF A;  2NMP A;  2Z1Y A;  3FQ7 A;  1SVV A;  3WZF A;  1DGD A;  3ISL A;  2BI9 A;  1AJR A;  1EQB A;  2FNI A;  2G6W A;  3DU4 A;  3N75 A;  4A6R A;  1CZE A;  2JG2 A;  2ZY3 A;  4XJL A;  3HVY A;  1I43 A;  4I8A A;  4F4E A;  4GE4 A;  5DB5 A;  4F5M A;  1WYV B;  2VIB A;  2W8U A;  3OP7 A;  1J32 A;  1W7M A;  3DYD A;  2DGK A;  4IYO A;  2PB2 A;  3MEB A;  2W7F A;  2W8V A;  3LV2 A;  1AMR A;  5EAA A;  4OBV A;  1MLY A;  3VK3 A;  3ATH A;  3ASB A;  4ZAS A;  1IJI A;  2ORD A;  5J8Q A;  2EPJ A;  2BWP A;  1AY4 A;  1SF2 A;  1X0M A;  2HOZ A;  2FNU A;  1AJS A;  3EI9 A;  2BIG A;  2EGY A;  4LNM A;  1M0P A;  3QI6 A;  4ISY A;  4XK1 A;  2YCT A;  1KL1 A;  2YRR A;  3NTJ A;  4GEB A;  3E9K A;  1IAX A;  2HP2 A;  2VI8 A;  2BYJ A;  2R5C A;  4ITG A;  3MC6 A;  3I4J A;  4TN4 A;  3UE8 A;  1LC8 A;  2Z9U A;  1OHW A;  3JTX A;  1W3U A;  4LNJ A;  1PMO A;  4UHN A;  2DKJ A;  4GDY A;  1TAS A;  2JJF A;  4R5Z A;  4O6Z A;  3HQT A;  1ZOB A;  2YKY A;  1ART A;  2CJG A;  4F5H A;  3WGC A;  1N31 A;  1AIC A;  3NUB A;  4ADE A;  3COG A;  2EO5 A;  3IHJ A;  1QJ3 A;  4RIZ A;  4OBU A;  4UHM A;  2CST A;  2GMS A;  3H7F A;  2DGL A;  3JU7 A;  4WLH A;  4F5L A;  1TOE A;  3WX9 A;  3G0T A;  5G0A A;  2Z9X A;  3CAI A;  3DR7 A;  1QGN A;  4M2K A;  3FFR A;  1D7V A;  3WKR A;  1M4N A;  1VEF A;  8AAT A;  3BB8 A;  3A2B A;  3NUI A;  2YRI A;  4RM1 A;  1BQA A;  2JIS A;  4W5K A;  1ASG A;  2JJG A;  1UU2 A;  3KGW A;  1SZU A;  3DC1 A;  4U2H A;  1C7N A;  3DXV A;  3AEO A;  1ARG A;  1GEX A;  4W1W A;  1MLZ A;  3USF A;  3E2Z B;  3FZ7 A;  3WY7 A;  2JJE A;  2VMX A;  4BQ0 A;  1Y4I A; 
#chains in the Genus database with same CATH topology
 3BWO A;  1S09 A;  1D7R A;  4N0W A;  5G09 A;  3QN6 A;  3AAT A;  3RBL A;  3DRD A;  3HLM A;  1WYT B;  1X29 A;  3LY1 A;  1TAR A;  3LG0 A;  3NDN A;  1RVY A;  1CJ0 A;  3NU7 A;  2VYC A;  3EI8 A;  3MKJ A;  1B9I A;  2R0T A;  1ARH A;  1C7G A;  1Z7D A;  1W7N A;  4ZLV A;  3EIA A;  1S07 A;  2ZSM A;  4IXS A;  4W1X A;  2DOU A;  4ZSY A;  2W7K A;  1QZ9 A;  3RCH A;  1AMS A;  4J5U A;  2OKJ A;  2HUF A;  3BN1 A;  3ASA A;  4HF8 A;  1ARS A;  3RI6 A;  3GJU A;  1KL2 A;  4A0G A;  1WYU A;  4AZJ A;  3ZRQ A;  1BT4 A;  3HT4 A;  1PG8 A;  1BJN A;  3LWS A;  2YCP A;  4IW7 A;  2W8J A;  1AMA A;  2D7Y A;  2YKX A;  4JE5 D;  4K05 A;  5FT6 A;  4J8L A;  4AO9 A;  3NYU A;  4BA5 A;  3GET A;  3M5U A;  4W91 A;  4MQR A;  1B9H A;  2BWO A;  3AOV A;  3F0H A;  3RQ1 A;  4GRX A;  1MDX A;  1GBN A;  1JS6 A;  4E77 A;  1FG7 A;  2CY8 A;  2KFP A;  5D5S A;  4WD2 A;  9AAT A;  3PPL A;  4RKD A;  4CXR A;  2QMA A;  2JGT A;  4Q31 A;  2OGA A;  4WB0 A;  1ECX A;  2GSA A;  1RV4 A;  4MSO A;  4RIT A;  1SZS A;  2E7I A;  2VMQ A;  3WCN A;  3FZ8 A;  1W23 A;  3PGY A;  1G4V A;  1YOO A;  1ELQ A;  2V0Y A;  1OXP A;  3B8X A;  3D6K A;  2V1P A;  1AHG A;  3JWA A;  4DBC A;  3I16 A;  2FQ6 A;  5IWQ A;  2D64 A;  3H14 A;  5M4B A;  5G2P A;  2BKW A;  2VI9 A;  3RCH B;  2D5Y A;  4PFF A;  4AOA A;  2C44 A;  3DR4 A;  2YKV A;  4WXF A;  3PDB B;  1OXO A;  5LH9 A;  4JEZ A;  3MBB A;  4GE7 A;  3JW9 A;  4A72 A;  1KMK A;  2YOB A;  4ADC A;  1ASM A;  1AY8 A;  1DJE A;  3NNK A;  2BYL A;  1AAW A;  2CIN A;  3FTB A;  1ASB A;  2CAN A;  1LKC A;  2X5D A;  4QGR A;  1TOI A;  2VLH A;  4Y0D A;  5FT8 A;  1RV3 A;  1MGV A;  1E5E A;  4ADD A;  4EU1 A;  5M49 A;  4WYF A;  1TOG A;  3FFH A;  4LC3 A;  4OC9 A;  5EIG B;  2A1V A;  4N0B A;  3E2Y A;  2BIE A;  2VMS A;  5K8B A;  4K2M A;  2HUI A;  4IY7 A;  2AY2 A;  3MAF A;  4KXK A;  4M2J A;  5EQC A;  4AZK A;  5C6U A;  3ZRR A;  5E4Z A;  1V2E A;  2EH6 A;  2W8W A;  4JEX A;  4MQP A;  1PFF A;  7AAT A;  2O1B A;  2W7J A;  4Q75 A;  2QA3 A;  4A0F A;  1LW5 A;  4CVQ A;  1IBJ A;  1DFO A;  2VGW A;  2Z9W A;  3P1T A;  4GSA A;  1ARI A;  2D66 A;  5HHY A;  1JF9 A;  3VK4 A;  4UHO A;  4WXG A;  3NYS A;  4ZWM A;  3HL2 A;  2W7D A;  3DZZ A;  2HUU A;  4TV7 A;  2Z9V A;  3BCB A;  1C7O A;  2OKK A;  2AY7 A;  1C0N A;  1UU1 A;  5G4I A;  3W1J A;  2AY9 A;  1S08 A;  4F5F A;  4HVK A;  2OGE A;  4OYT A;  2WB6 A;  4OTL A;  1KKP A;  1OHY A;  2FM1 A;  1B4X A;  1PMM A;  3B46 A;  3FRK A;  1MAP A;  4M2M A;  3KGX A;  2BI1 A;  1ASN A;  2O0R A;  2C81 A;  1FG3 A;  4A0R A;  2VMW A;  5F9S A;  1YAA A;  4LW2 A;  2C0R A;  1AX4 A;  4E3R A;  1ASA A;  3PIU A;  3IF2 A;  1ZOD A;  1ASF A;  4PVF A;  4CXQ A;  2FN6 A;  3W1H A;  5G2Q A;  3F6T A;  3AEN A;  4F5I A;  2ZP7 A;  3BCA A;  4B98 A;  2D61 A;  3G7Q A;  3QM2 A;  3HMU A;  5DJ1 A;  3TCM A;  5FT5 A;  4OMA A;  3AEL A;  2VMN A;  1SFF A;  1N2T A;  4ZWV A;  4L0O A;  4IXO A;  1M32 A;  1WYV A;  4WYC A;  1D2F A;  2HOX A;  1TOK A;  3BCX A;  1C4K A;  5HXX A;  5FT4 A;  3A8U X;  3ECD A;  3LVK A;  4IYO B;  3WKS A;  3LVL B;  3FCR A;  2BWN A;  3PDB A;  4FL0 A;  3B1E A;  3AEN B;  1BJO A;  3OKS A;  4DQ6 A;  2W7L A;  1IUG A;  4FFC A;  2Z1Z A;  1IX7 A;  4WXB A;  5E5I A;  3EZ1 A;  5HDM A;  3H9X A;  4UOY A;  5BJ4 A;  4MY5 A;  3TQX A;  3VAX A;  3E2F A;  3K7Y A;  2HZP A;  4RJY A;  1ASC A;  3ZRP A;  5AX8 A;  1WKH A;  1YJS A;  4WBT A;  3JWB A;  4XQ2 A;  3DXW A;  4E3Q A;  3RUY A;  3N4S A;  5EFS A;  2WK8 A;  2QBT A;  3EI6 A;  1IX8 A;  2W7H A;  1DKA A;  1AMQ A;  1ASL A;  1YJZ A;  2ZJG A;  1ORD A;  3QGU A;  1BS0 A;  1QIR A;  4EB7 A;  1DGE A;  3LVJ A;  3QPG A;  2VMP A;  1LS3 A;  3N0L A;  4RKC A;  2BIA A;  2VGV A;  3NYT A;  1WYT A;  5I92 A;  4A6T A;  3Q8N A;  2AY8 A;  3I5T A;  4K2B A;  2YKU A;  2AY1 A;  3HBX A;  2D63 A;  4B9B A;  3WCO A;  4CBR A;  4JEY A;  1I48 A;  4JE5 A;  1YNU A;  4JEW A;  3BC8 A;  3GBX A;  1ASD A;  1B8G A;  1AIB A;  4P3M A;  4BHD A;  3GR9 A;  4R8D A;  5EAV A;  1TPL A;  3MAD A;  4Q76 A;  2GQN A;  1AHE A;  1XI9 A;  1DJU A;  4ZM3 A;  4WYE A;  4KAM A;  2BI3 A;  1M6S A;  1JG8 A;  3EI7 A;  4ITX A;  1AJS B;  1O69 A;  3PJ0 A;  1CQ8 A;  4MQQ A;  1AAM A;  1CS1 A;  4ATQ A;  3AOW A;  4Y0H A;  2VMV A;  2FKI A;  1MDO A;  1AKA A;  4R2N A;  1AHF A;  4EFF A;  4F5K A;  3BWN C;  2DR1 A;  3AEP A;  4XAU A;  3TFU A;  3AEJ C;  3EI5 A;  4ZAH A;  3K40 A;  2QSR A;  3A9X A;  3AEM A;  1QJ5 A;  2QB2 A;  3GSB A;  3NU8 A;  1BJ4 A;  4TMR A;  3B1D A;  1TAT A;  2W7E A;  3GZD A;  3L8A A;  2VMZ A;  2AY3 A;  3A9Y A;  4XJM A;  3N4R A;  2AAT A;  1MAQ A;  2ZYJ A;  4IX8 A;  3HDO A;  5TF5 A;  3CQ4 A;  2AY4 A;  4IXZ A;  2CJD A;  2HP1 A;  2JJH A;  2HOY A;  4XEW A;  2HOR A;  1AHY A;  1YIY A;  3MAF B;  4EMY A;  1G4X A;  1I29 A;  4R5F A;  1S0A A;  1J04 A;  1IVR A;  2CH1 A;  2GMU A;  4KYO A;  4PIW A;  2VMO A;  3PA9 A;  4A6U A;  4GE9 A;  1CQ6 A;  2DGM A;  2D7Z A;  1YIZ A;  2C7T A;  2OQX A;  1GC3 A;  1H1C A;  1G7X A;  1SZK A;  1WKG A;  3CQ5 A;  3FVX A;  3JZL A;  1QIT A;  3FQ8 A;  3MC6 C;  2AEU A;  3R4T A;  3L44 A;  1EJI A;  4JF0 A;  4MKJ A;  5D95 A;  2VMU A;  3RBF A;  1CL2 A;  3MAU A;  4E1O A;  4NOG A;  4OT8 A;  1GEY A;  3FVU A;  5M4D A;  4Y0I A;  3FVS A;  1P3W A;  4Q6R A;  2X3L A;  1D7U A;  3DOD A;  5EUD A;  2ZY4 A;  1GCK A;  2XH1 A;  2BI5 A;  2BI2 A;  3QBO A;  1BJW A;  3NX3 A;  3T32 A;  2G7J A;  2WK9 A;  1V2D A;  1WST A;  1GC4 A;  4XJO A;  3GZC A;  1ELU A;  1GD9 A;  2W8T A;  3KE3 A;  1IAY A;  2CH2 A;  3NRA A;  2AEV A;  3QHX A;  4AH3 A;  4ZDL A;  1V72 A;  5DJ9 A;  2ZUK A;  2R2N A;  5BJ3 A;  1MDZ A;  1CZC A;  1O62 A;  3LVM A;  3UAK A;  2ZY5 A;  2XBN A;  3WLX A;  1S06 A;  1LW4 A;  4WB0 B;  2ZC0 A;  3VP6 A;  4XJP A;  3KKI A;  3FSL A;  2ZSL A;  3VOM A;  5EUE A;  1BKG A;  2Z61 A;  2Z20 A;  4A00 A;  4F5J A;  1UKJ A;  4WLJ A;  5EUN A;  4DGT A;  2Q7W A;  1DJ9 A;  1X28 A;  3BS8 A;  2VMR A;  1C9C A;  3CQ6 A;  1TOJ A;  2WK7 A;  2BHX A;  1GEW A;  3GWP A;  4F5G A;  2W7I A;  1DTY A;  3FZ6 A;  1M0O A;  1EG5 A;  2CTZ A;  3B1C A;  1AY5 A;  2VGU A;  4WYG A;  5F8V A;  3FD0 A;  1E5F A;  4K2I A;  3ACZ A;  2YHK A;  4BMK A;  3AEM C;  1M0N A;  2DKB A;  1KKJ A;  2E7J A;  3AEJ A;  2OAT A;  3EIB A;  1Z3Z A;  2YCN A;  2VGT A;  3BWN A;  3GZD C;  1X2A A;  2D65 A;  2PO3 A;  4ZDO A;  4W1V A;  1KAF A;  1G7W A;  2AY5 A;  2O7C A;  2RFV A;  3PD6 A;  3W1I A;  2W7G A;  2AY6 A;  1B5P A;  4OCA A;  4ATP A;  2X8U A;  3PDX A;  1CL1 A;  2QB3 A;  1LK9 A;  1AKB A;  3G8M A;  3K28 A;  4BA4 A;  5KTB A;  2VMT A;  3FKD A;  1ZC9 A;  1AIA A;  3VK2 A;  2TPL A;  1OHV A;  1RVU A;  2R5E A;  1IX6 A;  4ZM4 A;  3EZS A;  3PAA A;  4PFN A;  1ASE A;  1U08 A;  5M46 A;  4WYA A;  2QLR A;  3AV7 A;  3UWC A;  3E2Z A;  3WGB A;  4ZDP A;  3FQA A;  3E77 A;  1JS3 A;  2E7U A;  3EUC A;  1GDE A;  4LW4 A;  5G4J A;  2CFB A;  2WKA A;  1UU0 A;  4JEV A;  5LHA A;  1LC5 A;  4UQV A;  2EZ1 A;  2CJH A;  3E6G A;  2PB0 A;  1O61 A;  2R5C B;  3BV0 A;  2Z67 A;  3II0 A;  1GC0 A;  4MGR A;  2VGZ A;  1M7Y A;  4AO4 A;  1N8P A;  1OAT A;  1BQD A;  1V2F A;  1D7S A;  4RAE A;  2W7M A;  5EIG A;  4WP0 A;  1CQ7 A;  1SPA A;  5E3K A;  4EB5 A;  3ELP A;  4MKK A;  1YJY A;  3F9T A;  3CBF A;  3ELE A;  1KMJ A;  1O4S A;  1VJO A;  2GB3 A;  1QIS A;  1GC2 A;  1BJO B;  3FDD A;  4ADB A;  2VLF A;  3TFT A;  4ZSW A;  4P7Y A;  4W8I A;  5JAY A;  4RJ0 A;  4U1T A;  1XEY A;  3A9Z A;  2F8J A;  1VP4 A;  2VGS A;  1I41 A;  3P6K A;  4CBS A;  3FDB A;  4WYD A;  3TAT A;  2ZY2 A;  2VIA A;  1AKC A;  1AHX A;  3PD6 B;  4H51 A;  2CB1 A;  2E54 A;  1WYU B;  1W7L A;  1H0C A;  2X5F A;  1T3I A;  3N5M A;  1BW0 A;  4RLG A;  5DX5 A;  4LNL A;  3ZZJ A;  2EZ2 A;  3R9A A;  2VMY A;  4A0H A;  4JF1 A;  1B5O A;  1LC7 A;  1FC4 A;  3ZZK A;  1M0Q A;  2FYF A;  2NMP A;  2Z1Y A;  3FQ7 A;  1SVV A;  3WZF A;  1DGD A;  3ISL A;  2BI9 A;  1AJR A;  1EQB A;  2FNI A;  2G6W A;  3DU4 A;  3N75 A;  4A6R A;  1CZE A;  2JG2 A;  2ZY3 A;  4XJL A;  3HVY A;  1I43 A;  4I8A A;  4F4E A;  4GE4 A;  5DB5 A;  4F5M A;  1WYV B;  2VIB A;  2W8U A;  3OP7 A;  1J32 A;  1W7M A;  3DYD A;  2DGK A;  4IYO A;  2PB2 A;  3MEB A;  2W7F A;  2W8V A;  3LV2 A;  1AMR A;  5EAA A;  4OBV A;  1MLY A;  3VK3 A;  3ATH A;  3ASB A;  4ZAS A;  1IJI A;  2ORD A;  5J8Q A;  2EPJ A;  2BWP A;  1AY4 A;  1SF2 A;  1X0M A;  2HOZ A;  2FNU A;  1AJS A;  3EI9 A;  2BIG A;  2EGY A;  4LNM A;  1M0P A;  3QI6 A;  4ISY A;  4XK1 A;  2YCT A;  1KL1 A;  2YRR A;  3NTJ A;  4GEB A;  3E9K A;  1IAX A;  2HP2 A;  2VI8 A;  2BYJ A;  2R5C A;  3N4X A;  4H63 Q;  4ITG A;  3MC6 A;  3I4J A;  4TN4 A;  3UE8 A;  1LC8 A;  2Z9U A;  1OHW A;  3JTX A;  1W3U A;  4LNJ A;  1PMO A;  4UHN A;  2DKJ A;  4GDY A;  1TAS A;  2JJF A;  4R5Z A;  4O6Z A;  3HQT A;  1ZOB A;  2YKY A;  1ART A;  2CJG A;  4F5H A;  3WGC A;  1N31 A;  1AIC A;  3NUB A;  3N7N A;  4ADE A;  3COG A;  2EO5 A;  3IHJ A;  1QJ3 A;  4RIZ A;  4OBU A;  4UHM A;  2CST A;  2GMS A;  3H7F A;  2DGL A;  3JU7 A;  4WLH A;  2EYQ A;  4F5L A;  1TOE A;  3WX9 A;  3G0T A;  5G0A A;  2Z9X A;  3CAI A;  3DR7 A;  1QGN A;  4M2K A;  3FFR A;  1D7V A;  3WKR A;  1M4N A;  1VEF A;  8AAT A;  3BB8 A;  3A2B A;  3NUI A;  2YRI A;  4RM1 A;  1BQA A;  2JIS A;  4W5K A;  1ASG A;  2JJG A;  1UU2 A;  3KGW A;  1SZU A;  3DC1 A;  4U2H A;  1C7N A;  3DXV A;  3AEO A;  1ARG A;  1GEX A;  4W1W A;  1MLZ A;  3USF A;  3E2Z B;  3FZ7 A;  3WY7 A;  2JJE A;  2VMX A;  4BQ0 A;  1Y4I A; 
#chains in the Genus database with same CATH homology
 3BWO A;  1S09 A;  1D7R A;  4N0W A;  5G09 A;  3QN6 A;  3AAT A;  3RBL A;  3DRD A;  3HLM A;  1WYT B;  1X29 A;  3LY1 A;  1TAR A;  3LG0 A;  3NDN A;  1RVY A;  1CJ0 A;  3NU7 A;  2VYC A;  3EI8 A;  3MKJ A;  1B9I A;  2R0T A;  1ARH A;  1C7G A;  1Z7D A;  1W7N A;  4ZLV A;  3EIA A;  1S07 A;  2ZSM A;  4IXS A;  4W1X A;  2DOU A;  4ZSY A;  2W7K A;  1QZ9 A;  3RCH A;  1AMS A;  4J5U A;  2OKJ A;  2HUF A;  3BN1 A;  3ASA A;  4HF8 A;  1ARS A;  3RI6 A;  3GJU A;  1KL2 A;  4A0G A;  1WYU A;  4AZJ A;  3ZRQ A;  1BT4 A;  3HT4 A;  1PG8 A;  1BJN A;  3LWS A;  2YCP A;  4IW7 A;  2W8J A;  1AMA A;  2D7Y A;  2YKX A;  4JE5 D;  4K05 A;  5FT6 A;  4J8L A;  4AO9 A;  3NYU A;  4BA5 A;  3GET A;  3M5U A;  4W91 A;  4MQR A;  1B9H A;  2BWO A;  3AOV A;  3F0H A;  3RQ1 A;  4GRX A;  1MDX A;  1GBN A;  1JS6 A;  4E77 A;  1FG7 A;  2CY8 A;  2KFP A;  5D5S A;  4WD2 A;  9AAT A;  3PPL A;  4RKD A;  4CXR A;  2QMA A;  2JGT A;  4Q31 A;  2OGA A;  4WB0 A;  1ECX A;  2GSA A;  1RV4 A;  4MSO A;  4RIT A;  1SZS A;  2E7I A;  2VMQ A;  3WCN A;  3FZ8 A;  1W23 A;  3PGY A;  1G4V A;  1YOO A;  1ELQ A;  2V0Y A;  1OXP A;  3B8X A;  3D6K A;  2V1P A;  1AHG A;  3JWA A;  4DBC A;  3I16 A;  2FQ6 A;  5IWQ A;  2D64 A;  3H14 A;  5M4B A;  5G2P A;  2BKW A;  2VI9 A;  3RCH B;  2D5Y A;  4PFF A;  4AOA A;  2C44 A;  3DR4 A;  2YKV A;  4WXF A;  3PDB B;  1OXO A;  5LH9 A;  4JEZ A;  3MBB A;  4GE7 A;  3JW9 A;  4A72 A;  1KMK A;  2YOB A;  4ADC A;  1ASM A;  1AY8 A;  1DJE A;  3NNK A;  2BYL A;  1AAW A;  2CIN A;  3FTB A;  1ASB A;  2CAN A;  1LKC A;  2X5D A;  4QGR A;  1TOI A;  2VLH A;  4Y0D A;  5FT8 A;  1RV3 A;  1MGV A;  1E5E A;  4ADD A;  4EU1 A;  5M49 A;  4WYF A;  1TOG A;  3FFH A;  4LC3 A;  4OC9 A;  5EIG B;  2A1V A;  4N0B A;  3E2Y A;  2BIE A;  2VMS A;  5K8B A;  4K2M A;  2HUI A;  4IY7 A;  2AY2 A;  3MAF A;  4KXK A;  4M2J A;  5EQC A;  4AZK A;  5C6U A;  3ZRR A;  5E4Z A;  1V2E A;  2EH6 A;  2W8W A;  4JEX A;  4MQP A;  1PFF A;  7AAT A;  2O1B A;  2W7J A;  4Q75 A;  2QA3 A;  4A0F A;  1LW5 A;  4CVQ A;  1IBJ A;  1DFO A;  2VGW A;  2Z9W A;  3P1T A;  4GSA A;  1ARI A;  2D66 A;  5HHY A;  1JF9 A;  3VK4 A;  4UHO A;  4WXG A;  3NYS A;  4ZWM A;  3HL2 A;  2W7D A;  3DZZ A;  2HUU A;  4TV7 A;  2Z9V A;  3BCB A;  1C7O A;  2OKK A;  2AY7 A;  1C0N A;  1UU1 A;  5G4I A;  3W1J A;  2AY9 A;  1S08 A;  4F5F A;  4HVK A;  2OGE A;  4OYT A;  2WB6 A;  4OTL A;  1KKP A;  1OHY A;  2FM1 A;  1B4X A;  1PMM A;  3B46 A;  3FRK A;  1MAP A;  4M2M A;  3KGX A;  2BI1 A;  1ASN A;  2O0R A;  2C81 A;  1FG3 A;  4A0R A;  2VMW A;  5F9S A;  1YAA A;  4LW2 A;  2C0R A;  1AX4 A;  4E3R A;  1ASA A;  3PIU A;  3IF2 A;  1ZOD A;  1ASF A;  4PVF A;  4CXQ A;  2FN6 A;  3W1H A;  5G2Q A;  3F6T A;  3AEN A;  4F5I A;  2ZP7 A;  3BCA A;  4B98 A;  2D61 A;  3G7Q A;  3QM2 A;  3HMU A;  5DJ1 A;  3TCM A;  5FT5 A;  4OMA A;  3AEL A;  2VMN A;  1SFF A;  1N2T A;  4ZWV A;  4L0O A;  4IXO A;  1M32 A;  1WYV A;  4WYC A;  1D2F A;  2HOX A;  1TOK A;  3BCX A;  1C4K A;  5HXX A;  5FT4 A;  3A8U X;  3ECD A;  3LVK A;  4IYO B;  3WKS A;  3LVL B;  3FCR A;  2BWN A;  3PDB A;  4FL0 A;  3B1E A;  3AEN B;  1BJO A;  3OKS A;  4DQ6 A;  2W7L A;  1IUG A;  4FFC A;  2Z1Z A;  1IX7 A;  4WXB A;  5E5I A;  3EZ1 A;  5HDM A;  3H9X A;  4UOY A;  5BJ4 A;  4MY5 A;  3TQX A;  3VAX A;  3E2F A;  3K7Y A;  2HZP A;  4RJY A;  1ASC A;  3ZRP A;  5AX8 A;  1WKH A;  1YJS A;  4WBT A;  3JWB A;  4XQ2 A;  3DXW A;  4E3Q A;  3RUY A;  3N4S A;  5EFS A;  2WK8 A;  2QBT A;  3EI6 A;  1IX8 A;  2W7H A;  1DKA A;  1AMQ A;  1ASL A;  1YJZ A;  2ZJG A;  1ORD A;  3QGU A;  1BS0 A;  1QIR A;  4EB7 A;  1DGE A;  3LVJ A;  3QPG A;  2VMP A;  1LS3 A;  3N0L A;  4RKC A;  2BIA A;  2VGV A;  3NYT A;  1WYT A;  5I92 A;  4A6T A;  3Q8N A;  2AY8 A;  3I5T A;  4K2B A;  2YKU A;  2AY1 A;  3HBX A;  2D63 A;  4B9B A;  3WCO A;  4CBR A;  4JEY A;  1I48 A;  4JE5 A;  1YNU A;  4JEW A;  3BC8 A;  3GBX A;  1ASD A;  1B8G A;  1AIB A;  4P3M A;  4BHD A;  3GR9 A;  4R8D A;  5EAV A;  1TPL A;  3MAD A;  4Q76 A;  2GQN A;  1AHE A;  1XI9 A;  1DJU A;  4ZM3 A;  4WYE A;  4KAM A;  2BI3 A;  1M6S A;  1JG8 A;  3EI7 A;  4ITX A;  1AJS B;  1O69 A;  3PJ0 A;  1CQ8 A;  4MQQ A;  1AAM A;  1CS1 A;  4ATQ A;  3AOW A;  4Y0H A;  2VMV A;  2FKI A;  1MDO A;  1AKA A;  4R2N A;  1AHF A;  4EFF A;  4F5K A;  3BWN C;  2DR1 A;  3AEP A;  4XAU A;  3TFU A;  3AEJ C;  3EI5 A;  4ZAH A;  3K40 A;  2QSR A;  3A9X A;  3AEM A;  1QJ5 A;  2QB2 A;  3GSB A;  3NU8 A;  1BJ4 A;  4TMR A;  3B1D A;  1TAT A;  2W7E A;  3GZD A;  3L8A A;  2VMZ A;  2AY3 A;  3A9Y A;  4XJM A;  3N4R A;  2AAT A;  1MAQ A;  2ZYJ A;  4IX8 A;  3HDO A;  5TF5 A;  3CQ4 A;  2AY4 A;  4IXZ A;  2CJD A;  2HP1 A;  2JJH A;  2HOY A;  4XEW A;  2HOR A;  1AHY A;  1YIY A;  3MAF B;  4EMY A;  1G4X A;  1I29 A;  4R5F A;  1S0A A;  1J04 A;  1IVR A;  2CH1 A;  2GMU A;  4KYO A;  4PIW A;  2VMO A;  3PA9 A;  4A6U A;  4GE9 A;  1CQ6 A;  2DGM A;  2D7Z A;  1YIZ A;  2C7T A;  2OQX A;  1GC3 A;  1H1C A;  1G7X A;  1SZK A;  1WKG A;  3CQ5 A;  3FVX A;  3JZL A;  1QIT A;  3FQ8 A;  3MC6 C;  2AEU A;  3R4T A;  3L44 A;  1EJI A;  4JF0 A;  4MKJ A;  5D95 A;  2VMU A;  3RBF A;  1CL2 A;  3MAU A;  4E1O A;  4NOG A;  4OT8 A;  1GEY A;  3FVU A;  5M4D A;  4Y0I A;  3FVS A;  1P3W A;  4Q6R A;  2X3L A;  1D7U A;  3DOD A;  5EUD A;  2ZY4 A;  1GCK A;  2XH1 A;  2BI5 A;  2BI2 A;  3QBO A;  1BJW A;  3NX3 A;  3T32 A;  2G7J A;  2WK9 A;  1V2D A;  1WST A;  1GC4 A;  4XJO A;  3GZC A;  1ELU A;  1GD9 A;  2W8T A;  3KE3 A;  1IAY A;  2CH2 A;  3NRA A;  2AEV A;  3QHX A;  4AH3 A;  4ZDL A;  1V72 A;  5DJ9 A;  2ZUK A;  2R2N A;  5BJ3 A;  1MDZ A;  1CZC A;  1O62 A;  3LVM A;  3UAK A;  2ZY5 A;  2XBN A;  3WLX A;  1S06 A;  1LW4 A;  4WB0 B;  2ZC0 A;  3VP6 A;  4XJP A;  3KKI A;  3FSL A;  2ZSL A;  3VOM A;  5EUE A;  1BKG A;  2Z61 A;  2Z20 A;  4A00 A;  4F5J A;  1UKJ A;  4WLJ A;  5EUN A;  4DGT A;  2Q7W A;  1DJ9 A;  1X28 A;  3BS8 A;  2VMR A;  1C9C A;  3CQ6 A;  1TOJ A;  2WK7 A;  2BHX A;  1GEW A;  3GWP A;  4F5G A;  2W7I A;  1DTY A;  3FZ6 A;  1M0O A;  1EG5 A;  2CTZ A;  3B1C A;  1AY5 A;  2VGU A;  4WYG A;  5F8V A;  3FD0 A;  1E5F A;  4K2I A;  3ACZ A;  2YHK A;  4BMK A;  3AEM C;  1M0N A;  2DKB A;  1KKJ A;  2E7J A;  3AEJ A;  2OAT A;  3EIB A;  1Z3Z A;  2YCN A;  2VGT A;  3BWN A;  3GZD C;  1X2A A;  2D65 A;  2PO3 A;  4ZDO A;  4W1V A;  1G7W A;  2AY5 A;  2O7C A;  2RFV A;  3PD6 A;  3W1I A;  2W7G A;  2AY6 A;  1B5P A;  4OCA A;  4ATP A;  2X8U A;  3PDX A;  1CL1 A;  2QB3 A;  1LK9 A;  1AKB A;  3G8M A;  3K28 A;  4BA4 A;  5KTB A;  2VMT A;  3FKD A;  1ZC9 A;  1AIA A;  3VK2 A;  2TPL A;  1OHV A;  1RVU A;  2R5E A;  1IX6 A;  4ZM4 A;  3EZS A;  3PAA A;  4PFN A;  1ASE A;  1U08 A;  5M46 A;  4WYA A;  2QLR A;  3AV7 A;  3UWC A;  3E2Z A;  3WGB A;  4ZDP A;  3FQA A;  3E77 A;  1JS3 A;  2E7U A;  3EUC A;  1GDE A;  4LW4 A;  5G4J A;  2CFB A;  2WKA A;  1UU0 A;  4JEV A;  5LHA A;  1LC5 A;  4UQV A;  2EZ1 A;  2CJH A;  3E6G A;  2PB0 A;  1O61 A;  2R5C B;  3BV0 A;  2Z67 A;  3II0 A;  1GC0 A;  4MGR A;  2VGZ A;  1M7Y A;  4AO4 A;  1N8P A;  1OAT A;  1BQD A;  1V2F A;  1D7S A;  4RAE A;  2W7M A;  5EIG A;  4WP0 A;  1CQ7 A;  1SPA A;  5E3K A;  4EB5 A;  3ELP A;  4MKK A;  1YJY A;  3F9T A;  3CBF A;  3ELE A;  1KMJ A;  1O4S A;  1VJO A;  2GB3 A;  1QIS A;  1GC2 A;  1BJO B;  3FDD A;  4ADB A;  2VLF A;  3TFT A;  4ZSW A;  4P7Y A;  4W8I A;  5JAY A;  4RJ0 A;  4U1T A;  1XEY A;  3A9Z A;  2F8J A;  1VP4 A;  2VGS A;  1I41 A;  3P6K A;  4CBS A;  3FDB A;  4WYD A;  3TAT A;  2ZY2 A;  2VIA A;  1AKC A;  1AHX A;  3PD6 B;  4H51 A;  2CB1 A;  2E54 A;  1WYU B;  1W7L A;  1H0C A;  2X5F A;  1T3I A;  3N5M A;  1BW0 A;  4RLG A;  5DX5 A;  4LNL A;  3ZZJ A;  2EZ2 A;  3R9A A;  2VMY A;  4A0H A;  4JF1 A;  1B5O A;  1LC7 A;  1FC4 A;  3ZZK A;  1M0Q A;  2FYF A;  2NMP A;  2Z1Y A;  3FQ7 A;  1SVV A;  3WZF A;  1DGD A;  3ISL A;  2BI9 A;  1AJR A;  1EQB A;  2FNI A;  2G6W A;  3DU4 A;  3N75 A;  4A6R A;  1CZE A;  2JG2 A;  2ZY3 A;  4XJL A;  3HVY A;  1I43 A;  4I8A A;  4F4E A;  4GE4 A;  5DB5 A;  4F5M A;  1WYV B;  2VIB A;  2W8U A;  3OP7 A;  1J32 A;  1W7M A;  3DYD A;  2DGK A;  4IYO A;  2PB2 A;  3MEB A;  2W7F A;  2W8V A;  3LV2 A;  1AMR A;  5EAA A;  4OBV A;  1MLY A;  3VK3 A;  3ATH A;  3ASB A;  4ZAS A;  1IJI A;  2ORD A;  5J8Q A;  2EPJ A;  2BWP A;  1AY4 A;  1SF2 A;  1X0M A;  2HOZ A;  2FNU A;  1AJS A;  3EI9 A;  2BIG A;  2EGY A;  4LNM A;  1M0P A;  3QI6 A;  4ISY A;  4XK1 A;  2YCT A;  1KL1 A;  2YRR A;  3NTJ A;  4GEB A;  3E9K A;  1IAX A;  2HP2 A;  2VI8 A;  2BYJ A;  2R5C A;  3N4X A;  4H63 Q;  4ITG A;  3MC6 A;  3I4J A;  4TN4 A;  3UE8 A;  1LC8 A;  2Z9U A;  1OHW A;  3JTX A;  1W3U A;  4LNJ A;  1PMO A;  4UHN A;  2DKJ A;  4GDY A;  1TAS A;  2JJF A;  4R5Z A;  4O6Z A;  3HQT A;  1ZOB A;  2YKY A;  1ART A;  2CJG A;  4F5H A;  3WGC A;  1N31 A;  1AIC A;  3NUB A;  3N7N A;  4ADE A;  3COG A;  2EO5 A;  3IHJ A;  1QJ3 A;  4RIZ A;  4OBU A;  4UHM A;  2CST A;  2GMS A;  3H7F A;  2DGL A;  3JU7 A;  4WLH A;  2EYQ A;  4F5L A;  1TOE A;  3WX9 A;  3G0T A;  5G0A A;  2Z9X A;  3CAI A;  3DR7 A;  1QGN A;  4M2K A;  3FFR A;  1D7V A;  3WKR A;  1M4N A;  1VEF A;  8AAT A;  3BB8 A;  3A2B A;  3NUI A;  2YRI A;  4RM1 A;  1BQA A;  2JIS A;  4W5K A;  1ASG A;  2JJG A;  1UU2 A;  3KGW A;  1SZU A;  3DC1 A;  4U2H A;  1C7N A;  3DXV A;  3AEO A;  1ARG A;  1GEX A;  4W1W A;  1MLZ A;  3USF A;  3E2Z B;  3FZ7 A;  3WY7 A;  2JJE A;  2VMX A;  4BQ0 A;  1Y4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...