5DJ9A

Crystal structure of the ornithine aminotransferase from toxoplasma gondii me49 in a complex with gabaculine
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
421
structure length
421
Chain Sequence
b'KTNIEAYRDGLKLKTEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRAFGNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIARKWAYEVKEIPPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFGPFTPGFELIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLCRTGRLLAADHDEVHPDILLLGKSLSAGVVPISAVMGRADVMDVLKPGTHGSTFGGNPLACAVAVEALTVLKDEKLADRAERLGAQFRDCLRRELYGKVPWIKEIRGRGLLNAVEVDSDAIDPNDVVMKLKENGILSKPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAVEEER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ornithine aminotransferase, mitochondrial
publication title Crystal structure of the ornithine aminotransferase from Toxoplasma gondii ME49 in a complex with gabaculine
rcsb
source organism Toxoplasma gondii me49
molecule tags Transferase
total genus 146
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature ec 2.6.1.13: Ornithine aminotransferase.
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 5dj9A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 5dj9A01
1CL2A 3TQXA 3QPGA 2O1BA 2VMOA 1GC3A 3AOVA 1BKGA 1D7VA 2ZP7A 1IJIA 1RVUA 4EFFA 3FTBA 1X29A 2R2NA 4A0FA 1B4XA 1CJ0A 1M0QA 1MAPA 4ZDPA 2JG2A 1V2FA 3TFTA 2YCTA 3KKIA 3D6KA 3NYTA 2YRRA 5HXXA 4JE5A 3GBXA 4LNMA 4CXRA 3LVMA 2DGMA 4WYAA 4LC3A 3F6TA 3TFUA 2D63A 4W1WA 4MY5A 1AAMA 1CQ7A 3FZ7A 4ZWMA 4BHDA 1S08A 4WP0A 1B5OA 3N0LA 4ZWVA 1T3IA 3WLXA 1VJOA 7AATA 4WD2A 3P1TA 1YJZA 4JEWA 4A00A 4ITXA 1GC0A 4ITGA 3N5MA 1V2EA 4WLJA 4XEWA 5J8QA 4F5HA 3DRDA 1QISA 3B1DA 2FNIA 3GZDA 2VMYA 1AX4A 2VMTA 4WYCA 1W7MA 2FN6A 3PDBB 5G2QA 4LNLA 4IYOB 1TARA 1O4SA 3LG0A 1YJYA 1PFFA 2HOZA 3HVYA 2F8JA 4XJPA 4CBSA 1YJSA 4OMAA 3UE8A 4ZAHA 3JZLA 4ZASA 4BQ0A 4MQQA 3EZSA 1IBJA 3H14A 2VLHA 2BI9A 3UAKA 1SZUA 2JGTA 3FZ8A 1W7NA 4Y0HA 3L44A 2O0RA 3QI6A 3N75A 2HUUA 2PB0A 4XAUA 3ASAA 2AY7A 3EIBA 2GB3A 3PGYA 5C6UA 2HUFA 3FFHA 1LS3A 1GBNA 1ORDA 2EZ1A 1AJSB 3FZ6A 2PB2A 1Z7DA 2V1PA 4GRXA 5EIGA 1AY4A 2DKBA 2C7TA 4ZSWA 1ARGA 2QMAA 3JTXA 4BA4A 4N0BA 1IAYA 5DX5A 3EI7A 1RV4A 3E2ZB 4LW2A 3LV2A 3K40A 3VOMA 3WZFA 3WX9A 1AHFA 3A9XA 5G4JA 3G7QA 1X0MA 4WLHA 3DR4A 3DXWA 3E6GA 3LVKA 3WKSA 5IWQA 2ZY4A 1LKCA 1BJ4A 1N8PA 1YIYA 2VMXA 3CAIA 3K7YA 1DJUA 3WGCA 3HQTA 1MDOA 4UHNA 4LW4A 2V0YA 4A0HA 4E3RA 1Z3ZA 1LC7A 4ZDOA 2W8TA 4W5KA 2WKAA 1TOIA 2VGTA 5FT4A 2BIEA 3NRAA 4GE4A 4F5FA 1BS0A 2W8UA 3A8UX 1I43A 5EFSA 4A6TA 4ZSYA 3KE3A 2W7FA 1V2DA 1ASEA 3A9YA 1LW4A 1C7GA 3ZRPA 1XEYA 1IUGA 1M0PA 3AV7A 1FG3A 1ARTA 4F5JA 4ADDA 3II0A 1M32A 2FM1A 4R5FA 1W23A 2OKJA 3AEJA 4H51A 1H0CA 3WCOA 1LC8A 3W1HA 1XI9A 1ZC9A 4WXGA 1M6SA 1CQ8A 3UWCA 4ZM3A 3I4JA 3NYSA 3BS8A 3RQ1A 1G4XA 4Q6RA 3VK3A 5EAAA 2CFBA 5G09A 2BHXA 9AATA 1YOOA 2Z9WA 3LWSA 3NUIA 3HL2A 1AJRA 1DFOA 4O6ZA 5DJ9A 2ZSMA 1UKJA 1VP4A 3BV0A 5M4DA 2VGSA 4XJOA 5EIGB 4FL0A 1AIAA 2W7JA 5E4ZA 1EJIA 1TOGA 2W8WA 3NYUA 4GSAA 4U2HA 5G0AA 2ZY3A 3G8MA 2C44A 2AY5A 1DGEA 1TASA 1IX8A 4AH3A 4EMYA 2JJEA 3CBFA 3NDNA 3MC6A 4F5LA 3AATA 3JW9A 1G4VA 2R5EA 2YRIA 4IXOA 4JE5D 3FVXA 3COGA 4B98A 3MBBA 3VP6A 1D2FA 2EPJA 3FFRA 8AATA 2E7UA 4ADCA 4UQVA 3ZRQA 1AMQA 2HUIA 3FVUA 4IW7A 1ASMA 4EB5A 4WXFA 4RIZA 3ELPA 5I92A 1GD9A 1S0AA 1LK9A 1OHYA 5EUDA 2D7YA 3EI6A 4P7YA 3Q8NA 1WYUA 3DXVA 4N0WA 1GEWA 1MDXA 2NMPA 2VMPA 3BB8A 5HHYA 4ZLVA 2ZY5A 5FT6A 3NTJA 3BWNC 3HT4A 1PG8A 4F5IA 3AEMC 3EUCA 1O69A 1LC5A 3DC1A 4IY7A 4R8DA 3PJ0A 1GEYA 2VGUA 2FYFA 3JWBA 4DGTA 3ISLA 1MDZA 3FSLA 4BMKA 2GMSA 1BJWA 2OQXA 3R4TA 2QB2A 5TF5A 4Q31A 2Z20A 1AKAA 2YCNA 4WB0A 4WYGA 3HMUA 4Q76A 2D61A 5M4BA 2VMNA 1YIZA 2ZC0A 2JJFA 4AO4A 4K2MA 3NUBA 3T32A 1ZOBA 4XJMA 4HVKA 1V72A 2VGZA 1SVVA 4ZDLA 1ARHA 1CZCA 1GC4A 2Z67A 4Y0DA 4CBRA 1IX7A 2BIGA 3KGXA 4GE7A 3LVLB 2Z61A 3NU8A 4EU1A 2CJDA 1FG7A 1G7WA 4GDYA 1AKBA 4AZJA 2XH1A 3BCAA 4WYEA 2XBNA 1FC4A 2TPLA 3RBLA 2HZPA 3MAUA 1ELUA 1BJOA 1RV3A 1ASNA 2CSTA 4F5GA 3TCMA 5LH9A 1WYTA 2VMUA 2VMQA 1IAXA 4JEZA 4TMRA 2X3LA 1SZKA 4PVFA 3WCNA 5E5IA 3VAXA 2YOBA 2HORA 3AOWA 1SZSA 2AY3A 1DTYA 1ASCA 3QHXA 4M2KA 2W7IA 3JWAA 1O61A 4OYTA 3MAFA 2EZ2A 3RCHA 1SFFA 2JJHA 2Q7WA 1WYUB 3DR7A 5DB5A 1C9CA 4RJ0A 3FKDA 1BT4A 1P3WA 3GR9A 4K2IA 1QJ5A 1U08A 2E7JA 2W8JA 1M0OA 4OBVA 4E3QA 1JF9A 2Z9VA 3IHJA 5EAVA 4CVQA 1ZODA 3FQ8A 1RVYA 5E3KA 5EUEA 2VI8A 1E5FA 1TOEA 3F9TA 2VIAA 3PDXA 1AMSA 3WKRA 5FT5A 3MADA 3ASBA 1O62A 1D7SA 2R0TA 3QN6A 4GE9A 4XJLA 5F8VA 3W1JA 2BKWA 1BQDA 2OATA 1E5EA 3AENA 4K2BA 3CQ6A 2VGVA 2YHKA 1GCKA 4Y0IA 1JS3A 1UU1A 2X8UA 2CANA 2OKKA 1B9IA 1B8GA 1OHVA 3GZDC 1AHYA 2G6WA 4FFCA 1AY5A 2DR1A 1BJOB 3GZCA 4P3MA 4PIWA 3E77A 1WYTB 4PFNA 2JISA 2D65A 2VLFA 2W7DA 2ZYJA 1AHGA 2FQ6A 2HOYA 1QZ9A 3DYDA 5G2PA 1ARSA 2E54A 1N31A 3NU7A 1DJ9A 2BI5A 1CS1A 3GSBA 1ASFA 5EUNA 3P6KA 4MSOA 2AY2A 4EB7A 2AEUA 1AY8A 3I5TA 4J8LA 1ASAA 3L8AA 3FD0A 3FDDA 1YNUA 3MAFB 4M2JA 4ADBA 1BJNA 4ADEA 4RJYA 3RCHB 4B9BA 2ZY2A 4NOGA 2AY8A 5BJ3A 4WYFA 2VMWA 1PMOA 4IXZA 3HLMA 3WGBA 4UHOA 5DJ1A 2W7KA 2ZSLA 2WK8A 2YCPA 4Q75A 3VK4A 1WYVA 3E2YA 4GEBA 1J32A 2AY6A 4AOAA 1MGVA 3FQ7A 1I41A 4A0GA 2QBTA 3ACZA 1B5PA 4RITA 1CZEA 4AO9A 2VMVA 3B8XA 1KKPA 1LW5A 2ZUKA 4XK1A 4KXKA 5FT8A 5M46A 4MKKA 1B9HA 3PAAA 3KGWA 1AHXA 3DODA 5D5SA 2Z9XA 1CQ6A 3EI8A 1WKHA 3AENB 1IX6A 2HP2A 3E2FA 2D64A 2EO5A 4A72A 2W7HA 4QGRA 3ZZKA 3E2ZA 4JEXA 1Y4IA 4ATQA 4OC9A 2W7EA 4RLGA 3HDOA 1KMKA 1UU0A 1C7OA 5D95A 4ZM4A 2VMZA 3PA9A 1GDEA 3QGUA 2W7LA 1KL1A 1C0NA 3EI9A 2R5CA 4W1VA 3JU7A 2D5YA 3HBXA 1AIBA 2ORDA 3AEJC 4J5UA 3ZZJA 1ELQA 4I8AA 5M49A 4E1OA 1YAAA 1ASGA 4R2NA 1S07A 3PD6A 1BW0A 1SF2A 1BQAA 4W1XA 4A6RA 2AEVA 1W7LA 1WKGA 1EQBA 1SPAA 4W8IA 2BWOA 2W8VA 3USFA 2ZJGA 1GEXA 2CH1A 3FVSA 2CTZA 1I29A 1PMMA 4BA5A 4E77A 2C0RA 3PIUA 4RAEA 2BWNA 4IX8A 2HOXA 1D7RA 3M5UA 2YKYA 4KAMA 1EG5A 2HP1A 3EZ1A 2CINA 1N2TA 1G7XA 4RKCA 2BWPA 1QJ3A 4TV7A 1AKCA 4UHMA 2AY4A 1TATA 1TPLA 1WYVB 2YKVA 3FRKA 3MC6C 3RBFA 3CQ5A 3QM2A 2VGWA 2CB1A 4JF1A 2DGLA 3OKSA 2C81A 1M4NA 3GETA 2E7IA 2D7ZA 4W91A 2GSAA 3FQAA 3OP7A 3RI6A 4U1TA 4OCAA 1H1CA 1I48A 1KKJA 5LHAA 1C7NA 3MKJA 4JEVA 4WYDA 4XQ2A 2BI3A 2D66A 1QGNA 3WY7A 3CQ4A 3K28A 4F4EA 2RFVA 3BCBA 2QB3A 1C4KA 1X28A 2DKJA 3B1CA 1OXPA 3B46A 1MLZA 2AATA 2VI9A 3A2BA 5HDMA 5K8BA 2QLRA 4WB0B 4R5ZA 1QITA 3B1EA 2WK7A 1ASLA 4F5KA 4PFFA 1MLYA 2OGAA 3ECDA 3IF2A 3NX3A 1M0NA 2VMSA 2X5FA 1J04A 3ELEA 4DBCA 4DQ6A 5BJ4A 2BI2A 3I16A 4F5MA 1VEFA 5AX8A 1DGDA 2GQNA 3ZRRA 2BI1A 2BIAA 2R5CB 2X5DA 3ATHA 1ASBA 3RUYA 4IXSA 1S06A 3BN1A 1TOJA 1KMJA 1AICA 3BC8A 1GC2A 4WXBA 3LVJA 2EGYA 3BWNA 2VMRA 1AMRA 2EH6A 3AEMA 1DJEA 3PD6B 1IVRA 5JAYA 3H7FA 3NNKA 3FDBA 4A6UA 4A0RA 1DKAA 3GJUA 2CJGA 1CL1A 3G0TA 4WBTA 2Z9UA 2FNUA 5G4IA 4CXQA 4RM1A 2YKUA 4MQPA 4KYOA 3EI5A 3DZZA 2DGKA 3A9ZA 1OHWA 4AZKA 1WSTA 4LNJA 3DU4A 2JJGA 1MAQA 3E9KA 4MGRA 2CH2A 3LY1A 1OXOA 4JEYA 2YKXA 3MEBA 3R9AA 3VK2A 1KL2A 2PO3A 1JG8A 1AMAA 4RKDA 2BYLA 2DOUA 2WK9A 1X2AA 3QBOA 2W7MA 2GMUA 3BCXA 1JS6A 4UOYA 2BYJA 2VYCA 4OTLA 2Z1YA 4ATPA 3PDBA 1AAWA 2OGEA 3AELA 2CJHA 2W7GA 3F0HA 1TOKA 4IYOA 3TATA 2CY8A 1UU2A 3FCRA 2VIBA 1M7YA 1OATA 3EIAA 5F9SA 2QA3A 4MKJA 1D7UA 4L0OA 4OBUA 1QIRA 4TN4A 4M2MA 2AY1A 4HF8A 3AEPA 1ARIA 3BWOA 2AY9A 1ASDA 5EQCA 4JF0A 1S09A 1AHEA 1ECXA 4ISYA 4MQRA 4OT8A 2Z1ZA 3AEOA 2O7CA 3W1IA 3PPLA 1W3UA 3GWPA 1AJSA
chains in the Genus database with same CATH superfamily
1CL2A 3TQXA 3QPGA 2O1BA 2VMOA 1GC3A 3AOVA 1BKGA 1D7VA 2ZP7A 1IJIA 1RVUA 4EFFA 3FTBA 1X29A 2R2NA 4A0FA 1B4XA 1CJ0A 1M0QA 1MAPA 4ZDPA 2JG2A 1V2FA 3TFTA 2YCTA 3KKIA 3D6KA 3NYTA 2YRRA 5HXXA 4JE5A 3GBXA 4LNMA 4CXRA 3LVMA 2DGMA 4WYAA 4LC3A 3F6TA 3TFUA 2D63A 4W1WA 4MY5A 1AAMA 1CQ7A 3FZ7A 4ZWMA 4BHDA 3N4SA 1S08A 4WP0A 1B5OA 3N0LA 4ZWVA 1T3IA 3WLXA 1VJOA 7AATA 4WD2A 3P1TA 1YJZA 4JEWA 4A00A 4ITXA 2KFPA 1GC0A 4ITGA 3N5MA 1V2EA 4WLJA 4XEWA 5J8QA 4F5HA 3DRDA 1QISA 3B1DA 2FNIA 3GZDA 2VMYA 1AX4A 2VMTA 4WYCA 1W7MA 2FN6A 3PDBB 5G2QA 4LNLA 4IYOB 1TARA 1O4SA 3LG0A 1YJYA 1PFFA 2HOZA 3HVYA 2F8JA 4XJPA 4CBSA 1YJSA 4OMAA 3UE8A 4ZAHA 3JZLA 4ZASA 4BQ0A 4MQQA 3EZSA 1IBJA 3H14A 2VLHA 2BI9A 3UAKA 1SZUA 2JGTA 3FZ8A 1W7NA 4Y0HA 3L44A 2O0RA 3QI6A 3N75A 2HUUA 2PB0A 4XAUA 3ASAA 2AY7A 3EIBA 2GB3A 3PGYA 5C6UA 2HUFA 3FFHA 1LS3A 1GBNA 1ORDA 2EZ1A 1AJSB 3FZ6A 2PB2A 1Z7DA 2V1PA 4GRXA 5EIGA 1AY4A 2DKBA 2C7TA 4ZSWA 1ARGA 2QMAA 3JTXA 4BA4A 4N0BA 1IAYA 5DX5A 3EI7A 1RV4A 3E2ZB 4LW2A 3LV2A 3K40A 3VOMA 3WZFA 3WX9A 1AHFA 3A9XA 5G4JA 3G7QA 1X0MA 4WLHA 3DR4A 3DXWA 3E6GA 3LVKA 3WKSA 5IWQA 2QSRA 2ZY4A 1LKCA 1BJ4A 1N8PA 1YIYA 2VMXA 3CAIA 3K7YA 1DJUA 3WGCA 2G7JA 3HQTA 1MDOA 4UHNA 4LW4A 2V0YA 4A0HA 4E3RA 1Z3ZA 1LC7A 4ZDOA 2W8TA 4W5KA 2WKAA 1TOIA 2VGTA 5FT4A 2BIEA 3NRAA 4GE4A 4F5FA 1BS0A 2W8UA 3A8UX 1I43A 5EFSA 4A6TA 4ZSYA 3KE3A 2W7FA 1V2DA 1ASEA 3A9YA 1LW4A 1C7GA 3ZRPA 1XEYA 1IUGA 1M0PA 3AV7A 1FG3A 1ARTA 4F5JA 3N4RA 4ADDA 3II0A 1M32A 2FM1A 4R5FA 1W23A 2OKJA 3AEJA 4H51A 1H0CA 3WCOA 1LC8A 3W1HA 1XI9A 1ZC9A 4WXGA 1M6SA 3N7NA 1CQ8A 3UWCA 4ZM3A 3I4JA 3NYSA 3BS8A 3RQ1A 1G4XA 4Q6RA 3VK3A 5EAAA 2CFBA 5G09A 2BHXA 9AATA 1YOOA 2Z9WA 3LWSA 3NUIA 3HL2A 1AJRA 1DFOA 4O6ZA 5DJ9A 2ZSMA 1UKJA 1VP4A 3BV0A 5M4DA 2VGSA 4XJOA 5EIGB 4FL0A 1AIAA 2W7JA 5E4ZA 1EJIA 1TOGA 2W8WA 3NYUA 4GSAA 4U2HA 5G0AA 2ZY3A 3G8MA 2C44A 2AY5A 1DGEA 1TASA 1IX8A 4AH3A 4EMYA 2JJEA 3CBFA 3NDNA 3MC6A 4F5LA 3AATA 3JW9A 1G4VA 2R5EA 2YRIA 4IXOA 4JE5D 3FVXA 3COGA 4B98A 3MBBA 3VP6A 1D2FA 2EPJA 3FFRA 8AATA 2E7UA 4ADCA 4UQVA 3ZRQA 1AMQA 2HUIA 3FVUA 4IW7A 1ASMA 4EB5A 4WXFA 4RIZA 3ELPA 5I92A 1GD9A 1S0AA 1LK9A 1OHYA 5EUDA 2D7YA 3EI6A 4P7YA 3Q8NA 1WYUA 3DXVA 4N0WA 1GEWA 1MDXA 2NMPA 2VMPA 3BB8A 1KAFA 5HHYA 4ZLVA 2ZY5A 5FT6A 3NTJA 3BWNC 3HT4A 1PG8A 4F5IA 3AEMC 3EUCA 1O69A 1LC5A 3DC1A 4IY7A 4R8DA 3PJ0A 1GEYA 2VGUA 2FYFA 3JWBA 4DGTA 3ISLA 1MDZA 3FSLA 4BMKA 2GMSA 1BJWA 2OQXA 3R4TA 2QB2A 5TF5A 4Q31A 2Z20A 1AKAA 2YCNA 4WB0A 4WYGA 3HMUA 4Q76A 2D61A 5M4BA 2VMNA 1YIZA 2ZC0A 2JJFA 4AO4A 4K2MA 3NUBA 3T32A 1ZOBA 4XJMA 4HVKA 1V72A 2VGZA 1SVVA 4ZDLA 1ARHA 1CZCA 1GC4A 2Z67A 4Y0DA 4CBRA 1IX7A 2BIGA 3KGXA 4GE7A 3LVLB 2Z61A 3NU8A 4EU1A 2CJDA 1FG7A 1G7WA 4GDYA 1AKBA 4AZJA 2XH1A 3BCAA 4WYEA 2XBNA 1FC4A 2TPLA 3RBLA 2HZPA 3MAUA 1ELUA 1BJOA 1RV3A 1ASNA 2CSTA 4F5GA 3TCMA 5LH9A 1WYTA 2VMUA 2VMQA 1IAXA 4JEZA 4TMRA 2X3LA 1SZKA 4PVFA 3WCNA 5E5IA 3VAXA 2YOBA 2HORA 3AOWA 1SZSA 2AY3A 1DTYA 1ASCA 3QHXA 4M2KA 2W7IA 3JWAA 1O61A 4OYTA 3MAFA 2EZ2A 3RCHA 1SFFA 2JJHA 2Q7WA 1WYUB 3DR7A 5DB5A 1C9CA 4RJ0A 3FKDA 1BT4A 1P3WA 3GR9A 4K2IA 1QJ5A 1U08A 2E7JA 2W8JA 1M0OA 4OBVA 4E3QA 1JF9A 2Z9VA 3IHJA 5EAVA 4CVQA 1ZODA 3FQ8A 1RVYA 5E3KA 5EUEA 2A1VA 2VI8A 1E5FA 1TOEA 3F9TA 2VIAA 3PDXA 1AMSA 3WKRA 5FT5A 3MADA 3ASBA 1O62A 1D7SA 2R0TA 3QN6A 4GE9A 4XJLA 5F8VA 3W1JA 2BKWA 1BQDA 2OATA 1E5EA 3AENA 4K2BA 3CQ6A 2VGVA 2YHKA 1GCKA 4Y0IA 1JS3A 1UU1A 2X8UA 2CANA 2OKKA 1B9IA 1B8GA 1OHVA 3GZDC 1AHYA 2EYQA 2G6WA 4FFCA 1AY5A 2DR1A 1BJOB 3GZCA 4P3MA 4K05A 4PIWA 3E77A 1WYTB 4PFNA 2JISA 2D65A 2VLFA 2W7DA 2ZYJA 1AHGA 2FQ6A 2HOYA 1QZ9A 3DYDA 5G2PA 1ARSA 2E54A 1N31A 3NU7A 1DJ9A 2BI5A 1CS1A 3GSBA 1ASFA 5EUNA 3P6KA 4MSOA 2AY2A 4EB7A 2AEUA 1AY8A 3I5TA 4J8LA 1ASAA 3L8AA 3FD0A 3FDDA 1YNUA 3MAFB 4M2JA 4ADBA 1BJNA 4ADEA 4RJYA 3RCHB 4B9BA 2ZY2A 4NOGA 2AY8A 5BJ3A 4WYFA 2VMWA 1PMOA 4IXZA 3HLMA 3WGBA 4UHOA 5DJ1A 2W7KA 2ZSLA 2WK8A 2YCPA 4Q75A 3VK4A 1WYVA 3E2YA 4GEBA 1J32A 2AY6A 4AOAA 1MGVA 3FQ7A 1I41A 4A0GA 2QBTA 3ACZA 1B5PA 4RITA 1CZEA 4AO9A 2VMVA 3B8XA 1KKPA 2WB6A 1LW5A 2ZUKA 4XK1A 4KXKA 5FT8A 5M46A 4MKKA 1B9HA 3PAAA 3KGWA 1AHXA 3DODA 5D5SA 2Z9XA 1CQ6A 3EI8A 1WKHA 3AENB 1IX6A 2HP2A 3E2FA 2D64A 2EO5A 4A72A 2W7HA 4QGRA 3ZZKA 3E2ZA 4JEXA 1Y4IA 4ATQA 4OC9A 2W7EA 4RLGA 3HDOA 1KMKA 1UU0A 1C7OA 5D95A 4ZM4A 2VMZA 3PA9A 1GDEA 3QGUA 2W7LA 1KL1A 1C0NA 3EI9A 2R5CA 4W1VA 3JU7A 2D5YA 3HBXA 1AIBA 2ORDA 3AEJC 4J5UA 3ZZJA 1ELQA 4I8AA 5M49A 4E1OA 1YAAA 1ASGA 4R2NA 1S07A 3PD6A 1BW0A 1SF2A 1BQAA 4W1XA 4A6RA 2AEVA 1W7LA 1WKGA 1EQBA 1SPAA 4W8IA 2BWOA 2W8VA 3USFA 2ZJGA 1GEXA 2CH1A 3FVSA 2CTZA 1I29A 1PMMA 4BA5A 4E77A 2C0RA 3PIUA 4RAEA 2BWNA 4IX8A 2HOXA 1D7RA 3M5UA 2YKYA 4KAMA 1EG5A 2HP1A 3EZ1A 2CINA 1N2TA 1G7XA 4RKCA 2BWPA 1QJ3A 4TV7A 1AKCA 4UHMA 2AY4A 1TATA 3H9XA 1TPLA 1WYVB 2YKVA 3FRKA 3MC6C 3RBFA 3CQ5A 3QM2A 2VGWA 2CB1A 4JF1A 2DGLA 3OKSA 2C81A 3N4XA 1M4NA 3GETA 2E7IA 2D7ZA 4W91A 2GSAA 2FKIA 3FQAA 3OP7A 3RI6A 4U1TA 4OCAA 1H1CA 1I48A 1KKJA 5LHAA 1C7NA 3MKJA 4JEVA 4WYDA 4XQ2A 2BI3A 2D66A 1QGNA 3WY7A 3CQ4A 3K28A 4F4EA 2RFVA 3BCBA 2QB3A 1C4KA 1X28A 2DKJA 3B1CA 1OXPA 3B46A 1MLZA 2AATA 2VI9A 3A2BA 5HDMA 5K8BA 5KTBA 2QLRA 4WB0B 4R5ZA 1QITA 3B1EA 2WK7A 1ASLA 4F5KA 4PFFA 1MLYA 2OGAA 3ECDA 3IF2A 3NX3A 1M0NA 2VMSA 2X5FA 1J04A 3ELEA 4DBCA 4DQ6A 5BJ4A 2BI2A 3I16A 4F5MA 1VEFA 5AX8A 1DGDA 2GQNA 3ZRRA 2BI1A 2BIAA 2R5CB 2X5DA 3ATHA 1ASBA 3RUYA 4IXSA 1S06A 3BN1A 1TOJA 1KMJA 1AICA 3BC8A 1GC2A 4WXBA 3LVJA 2EGYA 3BWNA 2VMRA 1AMRA 2EH6A 3AEMA 1DJEA 3PD6B 4H63Q 1IVRA 5JAYA 3H7FA 3NNKA 3FDBA 4A6UA 4A0RA 1DKAA 3GJUA 2CJGA 1CL1A 3G0TA 4WBTA 2Z9UA 2FNUA 5G4IA 4CXQA 4RM1A 2YKUA 4MQPA 4KYOA 3EI5A 3DZZA 2DGKA 3A9ZA 1OHWA 4AZKA 1WSTA 4LNJA 3DU4A 2JJGA 1MAQA 3E9KA 4MGRA 2CH2A 3LY1A 1OXOA 4JEYA 2YKXA 3MEBA 3R9AA 3VK2A 1KL2A 2PO3A 1JG8A 1AMAA 4RKDA 2BYLA 2DOUA 2WK9A 1X2AA 3QBOA 2W7MA 2GMUA 3BCXA 1JS6A 4UOYA 2BYJA 2VYCA 4OTLA 2Z1YA 4ATPA 3PDBA 1AAWA 2OGEA 3AELA 2CJHA 2W7GA 3F0HA 1TOKA 4IYOA 3TATA 2CY8A 1UU2A 3FCRA 2VIBA 1M7YA 1OATA 3EIAA 5F9SA 2QA3A 4MKJA 1D7UA 4L0OA 4OBUA 1QIRA 4TN4A 4M2MA 2AY1A 4HF8A 3AEPA 1ARIA 3BWOA 2AY9A 1ASDA 5EQCA 4JF0A 1S09A 1AHEA 1ECXA 4ISYA 4MQRA 4OT8A 2Z1ZA 3AEOA 2O7CA 3W1IA 3PPLA 1W3UA 3GWPA 1AJSA
chains in the Genus database with same CATH topology
1CL2A 3TQXA 3QPGA 2O1BA 2VMOA 1GC3A 3AOVA 1BKGA 1D7VA 2ZP7A 1IJIA 1RVUA 4EFFA 3FTBA 1X29A 2R2NA 4A0FA 1B4XA 1CJ0A 1M0QA 1MAPA 4ZDPA 2JG2A 1V2FA 3TFTA 2YCTA 3KKIA 3D6KA 3NYTA 2YRRA 5HXXA 4JE5A 3GBXA 4LNMA 4CXRA 3LVMA 2DGMA 4WYAA 4LC3A 3F6TA 3TFUA 2D63A 4W1WA 4MY5A 1AAMA 1CQ7A 3FZ7A 4ZWMA 4BHDA 3N4SA 1S08A 4WP0A 1B5OA 3N0LA 4ZWVA 1T3IA 3WLXA 1VJOA 7AATA 4WD2A 3P1TA 1YJZA 4JEWA 4A00A 4ITXA 2KFPA 1GC0A 4ITGA 3N5MA 1V2EA 4WLJA 4XEWA 5J8QA 4F5HA 3DRDA 1QISA 3B1DA 2FNIA 3GZDA 2VMYA 1AX4A 2VMTA 4WYCA 1W7MA 2FN6A 3PDBB 5G2QA 4LNLA 4IYOB 1TARA 1O4SA 3LG0A 1YJYA 1PFFA 2HOZA 3HVYA 2F8JA 4XJPA 4CBSA 1YJSA 4OMAA 3UE8A 4ZAHA 3JZLA 4ZASA 4BQ0A 4MQQA 3EZSA 1IBJA 3H14A 2VLHA 2BI9A 3UAKA 1SZUA 2JGTA 3FZ8A 1W7NA 4Y0HA 3L44A 2O0RA 3QI6A 3N75A 2HUUA 2PB0A 4XAUA 3ASAA 2AY7A 3EIBA 2GB3A 3PGYA 5C6UA 2HUFA 3FFHA 1LS3A 1GBNA 1ORDA 2EZ1A 1AJSB 3FZ6A 2PB2A 1Z7DA 2V1PA 4GRXA 5EIGA 1AY4A 2DKBA 2C7TA 4ZSWA 1ARGA 2QMAA 3JTXA 4BA4A 4N0BA 1IAYA 5DX5A 3EI7A 1RV4A 3E2ZB 4LW2A 3LV2A 3K40A 3VOMA 3WZFA 3WX9A 1AHFA 3A9XA 5G4JA 3G7QA 1X0MA 4WLHA 3DR4A 3DXWA 3E6GA 3LVKA 3WKSA 5IWQA 2QSRA 2ZY4A 1LKCA 1BJ4A 1N8PA 1YIYA 2VMXA 3CAIA 3K7YA 1DJUA 3WGCA 2G7JA 3HQTA 1MDOA 4UHNA 4LW4A 2V0YA 4A0HA 4E3RA 1Z3ZA 1LC7A 4ZDOA 2W8TA 4W5KA 2WKAA 1TOIA 2VGTA 5FT4A 2BIEA 3NRAA 4GE4A 4F5FA 1BS0A 2W8UA 3A8UX 1I43A 5EFSA 4A6TA 4ZSYA 3KE3A 2W7FA 1V2DA 1ASEA 3A9YA 1LW4A 1C7GA 3ZRPA 1XEYA 1IUGA 1M0PA 3AV7A 1FG3A 1ARTA 4F5JA 3N4RA 4ADDA 3II0A 1M32A 2FM1A 4R5FA 1W23A 2OKJA 3AEJA 4H51A 1H0CA 3WCOA 1LC8A 3W1HA 1XI9A 1ZC9A 4WXGA 1M6SA 3N7NA 1CQ8A 3UWCA 4ZM3A 3I4JA 3NYSA 3BS8A 3RQ1A 1G4XA 4Q6RA 3VK3A 5EAAA 2CFBA 5G09A 2BHXA 9AATA 1YOOA 2Z9WA 3LWSA 3NUIA 3HL2A 1AJRA 1DFOA 4O6ZA 5DJ9A 2ZSMA 1UKJA 1VP4A 3BV0A 5M4DA 2VGSA 4XJOA 5EIGB 4FL0A 1AIAA 2W7JA 5E4ZA 1EJIA 1TOGA 2W8WA 3NYUA 4GSAA 4U2HA 5G0AA 2ZY3A 3G8MA 2C44A 2AY5A 1DGEA 1TASA 1IX8A 4AH3A 4EMYA 2JJEA 3CBFA 3NDNA 3MC6A 4F5LA 3AATA 3JW9A 1G4VA 2R5EA 2YRIA 4IXOA 4JE5D 3FVXA 3COGA 4B98A 3MBBA 3VP6A 1D2FA 2EPJA 3FFRA 8AATA 2E7UA 4ADCA 4UQVA 3ZRQA 1AMQA 2HUIA 3FVUA 4IW7A 1ASMA 4EB5A 4WXFA 4RIZA 3ELPA 5I92A 1GD9A 1S0AA 1LK9A 1OHYA 5EUDA 2D7YA 3EI6A 4P7YA 3Q8NA 1WYUA 3DXVA 4N0WA 1GEWA 1MDXA 2NMPA 2VMPA 3BB8A 5HHYA 4ZLVA 2ZY5A 5FT6A 3NTJA 3BWNC 3HT4A 1PG8A 4F5IA 3AEMC 3EUCA 1O69A 1LC5A 3DC1A 4IY7A 4R8DA 3PJ0A 1GEYA 2VGUA 2FYFA 3JWBA 4DGTA 3ISLA 1MDZA 3FSLA 4BMKA 2GMSA 1BJWA 2OQXA 3R4TA 2QB2A 5TF5A 4Q31A 2Z20A 1AKAA 2YCNA 4WB0A 4WYGA 3HMUA 4Q76A 2D61A 5M4BA 2VMNA 1YIZA 2ZC0A 2JJFA 4AO4A 4K2MA 3NUBA 3T32A 1ZOBA 4XJMA 4HVKA 1V72A 2VGZA 1SVVA 4ZDLA 1ARHA 1CZCA 1GC4A 2Z67A 4Y0DA 4CBRA 1IX7A 2BIGA 3KGXA 4GE7A 3LVLB 2Z61A 3NU8A 4EU1A 2CJDA 1FG7A 1G7WA 4GDYA 1AKBA 4AZJA 2XH1A 3BCAA 4WYEA 2XBNA 1FC4A 2TPLA 3RBLA 2HZPA 3MAUA 1ELUA 1BJOA 1RV3A 1ASNA 2CSTA 4F5GA 3TCMA 5LH9A 1WYTA 2VMUA 2VMQA 1IAXA 4JEZA 4TMRA 2X3LA 1SZKA 4PVFA 3WCNA 5E5IA 3VAXA 2YOBA 2HORA 3AOWA 1SZSA 2AY3A 1DTYA 1ASCA 3QHXA 4M2KA 2W7IA 3JWAA 1O61A 4OYTA 3MAFA 2EZ2A 3RCHA 1SFFA 2JJHA 2Q7WA 1WYUB 3DR7A 5DB5A 1C9CA 4RJ0A 3FKDA 1BT4A 1P3WA 3GR9A 4K2IA 1QJ5A 1U08A 2E7JA 2W8JA 1M0OA 4OBVA 4E3QA 1JF9A 2Z9VA 3IHJA 5EAVA 4CVQA 1ZODA 3FQ8A 1RVYA 5E3KA 5EUEA 2A1VA 2VI8A 1E5FA 1TOEA 3F9TA 2VIAA 3PDXA 1AMSA 3WKRA 5FT5A 3MADA 3ASBA 1O62A 1D7SA 2R0TA 3QN6A 4GE9A 4XJLA 5F8VA 3W1JA 2BKWA 1BQDA 2OATA 1E5EA 3AENA 4K2BA 3CQ6A 2VGVA 2YHKA 1GCKA 4Y0IA 1JS3A 1UU1A 2X8UA 2CANA 2OKKA 1B9IA 1B8GA 1OHVA 3GZDC 1AHYA 2EYQA 2G6WA 4FFCA 1AY5A 2DR1A 1BJOB 3GZCA 4P3MA 4K05A 4PIWA 3E77A 1WYTB 4PFNA 2JISA 2D65A 2VLFA 2W7DA 2ZYJA 1AHGA 2FQ6A 2HOYA 1QZ9A 3DYDA 5G2PA 1ARSA 2E54A 1N31A 3NU7A 1DJ9A 2BI5A 1CS1A 3GSBA 1ASFA 5EUNA 3P6KA 4MSOA 2AY2A 4EB7A 2AEUA 1AY8A 3I5TA 4J8LA 1ASAA 3L8AA 3FD0A 3FDDA 1YNUA 3MAFB 4M2JA 4ADBA 1BJNA 4ADEA 4RJYA 3RCHB 4B9BA 2ZY2A 4NOGA 2AY8A 5BJ3A 4WYFA 2VMWA 1PMOA 4IXZA 3HLMA 3WGBA 4UHOA 5DJ1A 2W7KA 2ZSLA 2WK8A 2YCPA 4Q75A 3VK4A 1WYVA 3E2YA 4GEBA 1J32A 2AY6A 4AOAA 1MGVA 3FQ7A 1I41A 4A0GA 2QBTA 3ACZA 1B5PA 4RITA 1CZEA 4AO9A 2VMVA 3B8XA 1KKPA 2WB6A 1LW5A 2ZUKA 4XK1A 4KXKA 5FT8A 5M46A 4MKKA 1B9HA 3PAAA 3KGWA 1AHXA 3DODA 5D5SA 2Z9XA 1CQ6A 3EI8A 1WKHA 3AENB 1IX6A 2HP2A 3E2FA 2D64A 2EO5A 4A72A 2W7HA 4QGRA 3ZZKA 3E2ZA 4JEXA 1Y4IA 4ATQA 4OC9A 2W7EA 4RLGA 3HDOA 1KMKA 1UU0A 1C7OA 5D95A 4ZM4A 2VMZA 3PA9A 1GDEA 3QGUA 2W7LA 1KL1A 1C0NA 3EI9A 2R5CA 4W1VA 3JU7A 2D5YA 3HBXA 1AIBA 2ORDA 3AEJC 4J5UA 3ZZJA 1ELQA 4I8AA 5M49A 4E1OA 1YAAA 1ASGA 4R2NA 1S07A 3PD6A 1BW0A 1SF2A 1BQAA 4W1XA 4A6RA 2AEVA 1W7LA 1WKGA 1EQBA 1SPAA 4W8IA 2BWOA 2W8VA 3USFA 2ZJGA 1GEXA 2CH1A 3FVSA 2CTZA 1I29A 1PMMA 4BA5A 4E77A 2C0RA 3PIUA 4RAEA 2BWNA 4IX8A 2HOXA 1D7RA 3M5UA 2YKYA 4KAMA 1EG5A 2HP1A 3EZ1A 2CINA 1N2TA 1G7XA 4RKCA 2BWPA 1QJ3A 4TV7A 1AKCA 4UHMA 2AY4A 1TATA 3H9XA 1TPLA 1WYVB 2YKVA 3FRKA 3MC6C 3RBFA 3CQ5A 3QM2A 2VGWA 2CB1A 4JF1A 2DGLA 3OKSA 2C81A 3N4XA 1M4NA 3GETA 2E7IA 2D7ZA 4W91A 2GSAA 2FKIA 3FQAA 3OP7A 3RI6A 4U1TA 4OCAA 1H1CA 1I48A 1KKJA 5LHAA 1C7NA 3MKJA 4JEVA 4WYDA 4XQ2A 2BI3A 2D66A 1QGNA 3WY7A 3CQ4A 3K28A 4F4EA 2RFVA 3BCBA 2QB3A 1C4KA 1X28A 2DKJA 3B1CA 1OXPA 3B46A 1MLZA 2AATA 2VI9A 3A2BA 5HDMA 5K8BA 5KTBA 2QLRA 4WB0B 4R5ZA 1QITA 3B1EA 2WK7A 1ASLA 4F5KA 4PFFA 1MLYA 2OGAA 3ECDA 3IF2A 3NX3A 1M0NA 2VMSA 2X5FA 1J04A 3ELEA 4DBCA 4DQ6A 5BJ4A 2BI2A 3I16A 4F5MA 1VEFA 5AX8A 1DGDA 2GQNA 3ZRRA 2BI1A 2BIAA 2R5CB 2X5DA 3ATHA 1ASBA 3RUYA 4IXSA 1S06A 3BN1A 1TOJA 1KMJA 1AICA 3BC8A 1GC2A 4WXBA 3LVJA 2EGYA 3BWNA 2VMRA 1AMRA 2EH6A 3AEMA 1DJEA 3PD6B 4H63Q 1IVRA 5JAYA 3H7FA 3NNKA 3FDBA 4A6UA 4A0RA 1DKAA 3GJUA 2CJGA 1CL1A 3G0TA 4WBTA 2Z9UA 2FNUA 5G4IA 4CXQA 4RM1A 2YKUA 4MQPA 4KYOA 3EI5A 3DZZA 2DGKA 3A9ZA 1OHWA 4AZKA 1WSTA 4LNJA 3DU4A 2JJGA 1MAQA 3E9KA 4MGRA 2CH2A 3LY1A 1OXOA 4JEYA 2YKXA 3MEBA 3R9AA 3VK2A 1KL2A 2PO3A 1JG8A 1AMAA 4RKDA 2BYLA 2DOUA 2WK9A 1X2AA 3QBOA 2W7MA 2GMUA 3BCXA 1JS6A 4UOYA 2BYJA 2VYCA 4OTLA 2Z1YA 4ATPA 3PDBA 1AAWA 2OGEA 3AELA 2CJHA 2W7GA 3F0HA 1TOKA 4IYOA 3TATA 2CY8A 1UU2A 3FCRA 2VIBA 1M7YA 1OATA 3EIAA 5F9SA 2QA3A 4MKJA 1D7UA 4L0OA 4OBUA 1QIRA 4TN4A 4M2MA 2AY1A 4HF8A 3AEPA 1ARIA 3BWOA 2AY9A 1ASDA 5EQCA 4JF0A 1S09A 1AHEA 1ECXA 4ISYA 4MQRA 4OT8A 2Z1ZA 3AEOA 2O7CA 3W1IA 3PPLA 1W3UA 3GWPA 1AJSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CL2 A;  3TQX A;  3QPG A;  2O1B A;  2VMO A;  1GC3 A;  3AOV A;  1BKG A;  1D7V A;  2ZP7 A;  1IJI A;  1RVU A;  4EFF A;  3FTB A;  1X29 A;  2R2N A;  4A0F A;  1B4X A;  1CJ0 A;  1M0Q A;  1MAP A;  4ZDP A;  2JG2 A;  1V2F A;  3TFT A;  2YCT A;  3KKI A;  3D6K A;  3NYT A;  2YRR A;  5HXX A;  4JE5 A;  3GBX A;  4LNM A;  4CXR A;  3LVM A;  2DGM A;  4WYA A;  4LC3 A;  3F6T A;  3TFU A;  2D63 A;  4W1W A;  4MY5 A;  1AAM A;  1CQ7 A;  3FZ7 A;  4ZWM A;  4BHD A;  1S08 A;  4WP0 A;  1B5O A;  3N0L A;  4ZWV A;  1T3I A;  3WLX A;  1VJO A;  7AAT A;  4WD2 A;  3P1T A;  1YJZ A;  4JEW A;  4A00 A;  4ITX A;  1GC0 A;  4ITG A;  3N5M A;  1V2E A;  4WLJ A;  4XEW A;  5J8Q A;  4F5H A;  3DRD A;  1QIS A;  3B1D A;  2FNI A;  3GZD A;  2VMY A;  1AX4 A;  2VMT A;  4WYC A;  1W7M A;  2FN6 A;  3PDB B;  5G2Q A;  4LNL A;  4IYO B;  1TAR A;  1O4S A;  3LG0 A;  1YJY A;  1PFF A;  2HOZ A;  3HVY A;  2F8J A;  4XJP A;  4CBS A;  1YJS A;  4OMA A;  3UE8 A;  4ZAH A;  3JZL A;  4ZAS A;  4BQ0 A;  4MQQ A;  3EZS A;  1IBJ A;  3H14 A;  2VLH A;  2BI9 A;  3UAK A;  1SZU A;  2JGT A;  3FZ8 A;  1W7N A;  4Y0H A;  3L44 A;  2O0R A;  3QI6 A;  3N75 A;  2HUU A;  2PB0 A;  4XAU A;  3ASA A;  2AY7 A;  3EIB A;  2GB3 A;  3PGY A;  5C6U A;  2HUF A;  3FFH A;  1LS3 A;  1GBN A;  1ORD A;  2EZ1 A;  1AJS B;  3FZ6 A;  2PB2 A;  1Z7D A;  2V1P A;  4GRX A;  5EIG A;  1AY4 A;  2DKB A;  2C7T A;  4ZSW A;  1ARG A;  2QMA A;  3JTX A;  4BA4 A;  4N0B A;  1IAY A;  5DX5 A;  3EI7 A;  1RV4 A;  3E2Z B;  4LW2 A;  3LV2 A;  3K40 A;  3VOM A;  3WZF A;  3WX9 A;  1AHF A;  3A9X A;  5G4J A;  3G7Q A;  1X0M A;  4WLH A;  3DR4 A;  3DXW A;  3E6G A;  3LVK A;  3WKS A;  5IWQ A;  2ZY4 A;  1LKC A;  1BJ4 A;  1N8P A;  1YIY A;  2VMX A;  3CAI A;  3K7Y A;  1DJU A;  3WGC A;  3HQT A;  1MDO A;  4UHN A;  4LW4 A;  2V0Y A;  4A0H A;  4E3R A;  1Z3Z A;  1LC7 A;  4ZDO A;  2W8T A;  4W5K A;  2WKA A;  1TOI A;  2VGT A;  5FT4 A;  2BIE A;  3NRA A;  4GE4 A;  4F5F A;  1BS0 A;  2W8U A;  3A8U X;  1I43 A;  5EFS A;  4A6T A;  4ZSY A;  3KE3 A;  2W7F A;  1V2D A;  1ASE A;  3A9Y A;  1LW4 A;  1C7G A;  3ZRP A;  1XEY A;  1IUG A;  1M0P A;  3AV7 A;  1FG3 A;  1ART A;  4F5J A;  4ADD A;  3II0 A;  1M32 A;  2FM1 A;  4R5F A;  1W23 A;  2OKJ A;  3AEJ A;  4H51 A;  1H0C A;  3WCO A;  1LC8 A;  3W1H A;  1XI9 A;  1ZC9 A;  4WXG A;  1M6S A;  1CQ8 A;  3UWC A;  4ZM3 A;  3I4J A;  3NYS A;  3BS8 A;  3RQ1 A;  1G4X A;  4Q6R A;  3VK3 A;  5EAA A;  2CFB A;  5G09 A;  2BHX A;  9AAT A;  1YOO A;  2Z9W A;  3LWS A;  3NUI A;  3HL2 A;  1AJR A;  1DFO A;  4O6Z A;  5DJ9 A;  2ZSM A;  1UKJ A;  1VP4 A;  3BV0 A;  5M4D A;  2VGS A;  4XJO A;  5EIG B;  4FL0 A;  1AIA A;  2W7J A;  5E4Z A;  1EJI A;  1TOG A;  2W8W A;  3NYU A;  4GSA A;  4U2H A;  5G0A A;  2ZY3 A;  3G8M A;  2C44 A;  2AY5 A;  1DGE A;  1TAS A;  1IX8 A;  4AH3 A;  4EMY A;  2JJE A;  3CBF A;  3NDN A;  3MC6 A;  4F5L A;  3AAT A;  3JW9 A;  1G4V A;  2R5E A;  2YRI A;  4IXO A;  4JE5 D;  3FVX A;  3COG A;  4B98 A;  3MBB A;  3VP6 A;  1D2F A;  2EPJ A;  3FFR A;  8AAT A;  2E7U A;  4ADC A;  4UQV A;  3ZRQ A;  1AMQ A;  2HUI A;  3FVU A;  4IW7 A;  1ASM A;  4EB5 A;  4WXF A;  4RIZ A;  3ELP A;  5I92 A;  1GD9 A;  1S0A A;  1LK9 A;  1OHY A;  5EUD A;  2D7Y A;  3EI6 A;  4P7Y A;  3Q8N A;  1WYU A;  3DXV A;  4N0W A;  1GEW A;  1MDX A;  2NMP A;  2VMP A;  3BB8 A;  5HHY A;  4ZLV A;  2ZY5 A;  5FT6 A;  3NTJ A;  3BWN C;  3HT4 A;  1PG8 A;  4F5I A;  3AEM C;  3EUC A;  1O69 A;  1LC5 A;  3DC1 A;  4IY7 A;  4R8D A;  3PJ0 A;  1GEY A;  2VGU A;  2FYF A;  3JWB A;  4DGT A;  3ISL A;  1MDZ A;  3FSL A;  4BMK A;  2GMS A;  1BJW A;  2OQX A;  3R4T A;  2QB2 A;  5TF5 A;  4Q31 A;  2Z20 A;  1AKA A;  2YCN A;  4WB0 A;  4WYG A;  3HMU A;  4Q76 A;  2D61 A;  5M4B A;  2VMN A;  1YIZ A;  2ZC0 A;  2JJF A;  4AO4 A;  4K2M A;  3NUB A;  3T32 A;  1ZOB A;  4XJM A;  4HVK A;  1V72 A;  2VGZ A;  1SVV A;  4ZDL A;  1ARH A;  1CZC A;  1GC4 A;  2Z67 A;  4Y0D A;  4CBR A;  1IX7 A;  2BIG A;  3KGX A;  4GE7 A;  3LVL B;  2Z61 A;  3NU8 A;  4EU1 A;  2CJD A;  1FG7 A;  1G7W A;  4GDY A;  1AKB A;  4AZJ A;  2XH1 A;  3BCA A;  4WYE A;  2XBN A;  1FC4 A;  2TPL A;  3RBL A;  2HZP A;  3MAU A;  1ELU A;  1BJO A;  1RV3 A;  1ASN A;  2CST A;  4F5G A;  3TCM A;  5LH9 A;  1WYT A;  2VMU A;  2VMQ A;  1IAX A;  4JEZ A;  4TMR A;  2X3L A;  1SZK A;  4PVF A;  3WCN A;  5E5I A;  3VAX A;  2YOB A;  2HOR A;  3AOW A;  1SZS A;  2AY3 A;  1DTY A;  1ASC A;  3QHX A;  4M2K A;  2W7I A;  3JWA A;  1O61 A;  4OYT A;  3MAF A;  2EZ2 A;  3RCH A;  1SFF A;  2JJH A;  2Q7W A;  1WYU B;  3DR7 A;  5DB5 A;  1C9C A;  4RJ0 A;  3FKD A;  1BT4 A;  1P3W A;  3GR9 A;  4K2I A;  1QJ5 A;  1U08 A;  2E7J A;  2W8J A;  1M0O A;  4OBV A;  4E3Q A;  1JF9 A;  2Z9V A;  3IHJ A;  5EAV A;  4CVQ A;  1ZOD A;  3FQ8 A;  1RVY A;  5E3K A;  5EUE A;  2VI8 A;  1E5F A;  1TOE A;  3F9T A;  2VIA A;  3PDX A;  1AMS A;  3WKR A;  5FT5 A;  3MAD A;  3ASB A;  1O62 A;  1D7S A;  2R0T A;  3QN6 A;  4GE9 A;  4XJL A;  5F8V A;  3W1J A;  2BKW A;  1BQD A;  2OAT A;  1E5E A;  3AEN A;  4K2B A;  3CQ6 A;  2VGV A;  2YHK A;  1GCK A;  4Y0I A;  1JS3 A;  1UU1 A;  2X8U A;  2CAN A;  2OKK A;  1B9I A;  1B8G A;  1OHV A;  3GZD C;  1AHY A;  2G6W A;  4FFC A;  1AY5 A;  2DR1 A;  1BJO B;  3GZC A;  4P3M A;  4PIW A;  3E77 A;  1WYT B;  4PFN A;  2JIS A;  2D65 A;  2VLF A;  2W7D A;  2ZYJ A;  1AHG A;  2FQ6 A;  2HOY A;  1QZ9 A;  3DYD A;  5G2P A;  1ARS A;  2E54 A;  1N31 A;  3NU7 A;  1DJ9 A;  2BI5 A;  1CS1 A;  3GSB A;  1ASF A;  5EUN A;  3P6K A;  4MSO A;  2AY2 A;  4EB7 A;  2AEU A;  1AY8 A;  3I5T A;  4J8L A;  1ASA A;  3L8A A;  3FD0 A;  3FDD A;  1YNU A;  3MAF B;  4M2J A;  4ADB A;  1BJN A;  4ADE A;  4RJY A;  3RCH B;  4B9B A;  2ZY2 A;  4NOG A;  2AY8 A;  5BJ3 A;  4WYF A;  2VMW A;  1PMO A;  4IXZ A;  3HLM A;  3WGB A;  4UHO A;  5DJ1 A;  2W7K A;  2ZSL A;  2WK8 A;  2YCP A;  4Q75 A;  3VK4 A;  1WYV A;  3E2Y A;  4GEB A;  1J32 A;  2AY6 A;  4AOA A;  1MGV A;  3FQ7 A;  1I41 A;  4A0G A;  2QBT A;  3ACZ A;  1B5P A;  4RIT A;  1CZE A;  4AO9 A;  2VMV A;  3B8X A;  1KKP A;  1LW5 A;  2ZUK A;  4XK1 A;  4KXK A;  5FT8 A;  5M46 A;  4MKK A;  1B9H A;  3PAA A;  3KGW A;  1AHX A;  3DOD A;  5D5S A;  2Z9X A;  1CQ6 A;  3EI8 A;  1WKH A;  3AEN B;  1IX6 A;  2HP2 A;  3E2F A;  2D64 A;  2EO5 A;  4A72 A;  2W7H A;  4QGR A;  3ZZK A;  3E2Z A;  4JEX A;  1Y4I A;  4ATQ A;  4OC9 A;  2W7E A;  4RLG A;  3HDO A;  1KMK A;  1UU0 A;  1C7O A;  5D95 A;  4ZM4 A;  2VMZ A;  3PA9 A;  1GDE A;  3QGU A;  2W7L A;  1KL1 A;  1C0N A;  3EI9 A;  2R5C A;  4W1V A;  3JU7 A;  2D5Y A;  3HBX A;  1AIB A;  2ORD A;  3AEJ C;  4J5U A;  3ZZJ A;  1ELQ A;  4I8A A;  5M49 A;  4E1O A;  1YAA A;  1ASG A;  4R2N A;  1S07 A;  3PD6 A;  1BW0 A;  1SF2 A;  1BQA A;  4W1X A;  4A6R A;  2AEV A;  1W7L A;  1WKG A;  1EQB A;  1SPA A;  4W8I A;  2BWO A;  2W8V A;  3USF A;  2ZJG A;  1GEX A;  2CH1 A;  3FVS A;  2CTZ A;  1I29 A;  1PMM A;  4BA5 A;  4E77 A;  2C0R A;  3PIU A;  4RAE A;  2BWN A;  4IX8 A;  2HOX A;  1D7R A;  3M5U A;  2YKY A;  4KAM A;  1EG5 A;  2HP1 A;  3EZ1 A;  2CIN A;  1N2T A;  1G7X A;  4RKC A;  2BWP A;  1QJ3 A;  4TV7 A;  1AKC A;  4UHM A;  2AY4 A;  1TAT A;  1TPL A;  1WYV B;  2YKV A;  3FRK A;  3MC6 C;  3RBF A;  3CQ5 A;  3QM2 A;  2VGW A;  2CB1 A;  4JF1 A;  2DGL A;  3OKS A;  2C81 A;  1M4N A;  3GET A;  2E7I A;  2D7Z A;  4W91 A;  2GSA A;  3FQA A;  3OP7 A;  3RI6 A;  4U1T A;  4OCA A;  1H1C A;  1I48 A;  1KKJ A;  5LHA A;  1C7N A;  3MKJ A;  4JEV A;  4WYD A;  4XQ2 A;  2BI3 A;  2D66 A;  1QGN A;  3WY7 A;  3CQ4 A;  3K28 A;  4F4E A;  2RFV A;  3BCB A;  2QB3 A;  1C4K A;  1X28 A;  2DKJ A;  3B1C A;  1OXP A;  3B46 A;  1MLZ A;  2AAT A;  2VI9 A;  3A2B A;  5HDM A;  5K8B A;  2QLR A;  4WB0 B;  4R5Z A;  1QIT A;  3B1E A;  2WK7 A;  1ASL A;  4F5K A;  4PFF A;  1MLY A;  2OGA A;  3ECD A;  3IF2 A;  3NX3 A;  1M0N A;  2VMS A;  2X5F A;  1J04 A;  3ELE A;  4DBC A;  4DQ6 A;  5BJ4 A;  2BI2 A;  3I16 A;  4F5M A;  1VEF A;  5AX8 A;  1DGD A;  2GQN A;  3ZRR A;  2BI1 A;  2BIA A;  2R5C B;  2X5D A;  3ATH A;  1ASB A;  3RUY A;  4IXS A;  1S06 A;  3BN1 A;  1TOJ A;  1KMJ A;  1AIC A;  3BC8 A;  1GC2 A;  4WXB A;  3LVJ A;  2EGY A;  3BWN A;  2VMR A;  1AMR A;  2EH6 A;  3AEM A;  1DJE A;  3PD6 B;  1IVR A;  5JAY A;  3H7F A;  3NNK A;  3FDB A;  4A6U A;  4A0R A;  1DKA A;  3GJU A;  2CJG A;  1CL1 A;  3G0T A;  4WBT A;  2Z9U A;  2FNU A;  5G4I A;  4CXQ A;  4RM1 A;  2YKU A;  4MQP A;  4KYO A;  3EI5 A;  3DZZ A;  2DGK A;  3A9Z A;  1OHW A;  4AZK A;  1WST A;  4LNJ A;  3DU4 A;  2JJG A;  1MAQ A;  3E9K A;  4MGR A;  2CH2 A;  3LY1 A;  1OXO A;  4JEY A;  2YKX A;  3MEB A;  3R9A A;  3VK2 A;  1KL2 A;  2PO3 A;  1JG8 A;  1AMA A;  4RKD A;  2BYL A;  2DOU A;  2WK9 A;  1X2A A;  3QBO A;  2W7M A;  2GMU A;  3BCX A;  1JS6 A;  4UOY A;  2BYJ A;  2VYC A;  4OTL A;  2Z1Y A;  4ATP A;  3PDB A;  1AAW A;  2OGE A;  3AEL A;  2CJH A;  2W7G A;  3F0H A;  1TOK A;  4IYO A;  3TAT A;  2CY8 A;  1UU2 A;  3FCR A;  2VIB A;  1M7Y A;  1OAT A;  3EIA A;  5F9S A;  2QA3 A;  4MKJ A;  1D7U A;  4L0O A;  4OBU A;  1QIR A;  4TN4 A;  4M2M A;  2AY1 A;  4HF8 A;  3AEP A;  1ARI A;  3BWO A;  2AY9 A;  1ASD A;  5EQC A;  4JF0 A;  1S09 A;  1AHE A;  1ECX A;  4ISY A;  4MQR A;  4OT8 A;  2Z1Z A;  3AEO A;  2O7C A;  3W1I A;  3PPL A;  1W3U A;  3GWP A;  1AJS A; 
#chains in the Genus database with same CATH topology
 1CL2 A;  3TQX A;  3QPG A;  2O1B A;  2VMO A;  1GC3 A;  3AOV A;  1BKG A;  1D7V A;  2ZP7 A;  1IJI A;  1RVU A;  4EFF A;  3FTB A;  1X29 A;  2R2N A;  4A0F A;  1B4X A;  1CJ0 A;  1M0Q A;  1MAP A;  4ZDP A;  2JG2 A;  1V2F A;  3TFT A;  2YCT A;  3KKI A;  3D6K A;  3NYT A;  2YRR A;  5HXX A;  4JE5 A;  3GBX A;  4LNM A;  4CXR A;  3LVM A;  2DGM A;  4WYA A;  4LC3 A;  3F6T A;  3TFU A;  2D63 A;  4W1W A;  4MY5 A;  1AAM A;  1CQ7 A;  3FZ7 A;  4ZWM A;  4BHD A;  3N4S A;  1S08 A;  4WP0 A;  1B5O A;  3N0L A;  4ZWV A;  1T3I A;  3WLX A;  1VJO A;  7AAT A;  4WD2 A;  3P1T A;  1YJZ A;  4JEW A;  4A00 A;  4ITX A;  2KFP A;  1GC0 A;  4ITG A;  3N5M A;  1V2E A;  4WLJ A;  4XEW A;  5J8Q A;  4F5H A;  3DRD A;  1QIS A;  3B1D A;  2FNI A;  3GZD A;  2VMY A;  1AX4 A;  2VMT A;  4WYC A;  1W7M A;  2FN6 A;  3PDB B;  5G2Q A;  4LNL A;  4IYO B;  1TAR A;  1O4S A;  3LG0 A;  1YJY A;  1PFF A;  2HOZ A;  3HVY A;  2F8J A;  4XJP A;  4CBS A;  1YJS A;  4OMA A;  3UE8 A;  4ZAH A;  3JZL A;  4ZAS A;  4BQ0 A;  4MQQ A;  3EZS A;  1IBJ A;  3H14 A;  2VLH A;  2BI9 A;  3UAK A;  1SZU A;  2JGT A;  3FZ8 A;  1W7N A;  4Y0H A;  3L44 A;  2O0R A;  3QI6 A;  3N75 A;  2HUU A;  2PB0 A;  4XAU A;  3ASA A;  2AY7 A;  3EIB A;  2GB3 A;  3PGY A;  5C6U A;  2HUF A;  3FFH A;  1LS3 A;  1GBN A;  1ORD A;  2EZ1 A;  1AJS B;  3FZ6 A;  2PB2 A;  1Z7D A;  2V1P A;  4GRX A;  5EIG A;  1AY4 A;  2DKB A;  2C7T A;  4ZSW A;  1ARG A;  2QMA A;  3JTX A;  4BA4 A;  4N0B A;  1IAY A;  5DX5 A;  3EI7 A;  1RV4 A;  3E2Z B;  4LW2 A;  3LV2 A;  3K40 A;  3VOM A;  3WZF A;  3WX9 A;  1AHF A;  3A9X A;  5G4J A;  3G7Q A;  1X0M A;  4WLH A;  3DR4 A;  3DXW A;  3E6G A;  3LVK A;  3WKS A;  5IWQ A;  2QSR A;  2ZY4 A;  1LKC A;  1BJ4 A;  1N8P A;  1YIY A;  2VMX A;  3CAI A;  3K7Y A;  1DJU A;  3WGC A;  2G7J A;  3HQT A;  1MDO A;  4UHN A;  4LW4 A;  2V0Y A;  4A0H A;  4E3R A;  1Z3Z A;  1LC7 A;  4ZDO A;  2W8T A;  4W5K A;  2WKA A;  1TOI A;  2VGT A;  5FT4 A;  2BIE A;  3NRA A;  4GE4 A;  4F5F A;  1BS0 A;  2W8U A;  3A8U X;  1I43 A;  5EFS A;  4A6T A;  4ZSY A;  3KE3 A;  2W7F A;  1V2D A;  1ASE A;  3A9Y A;  1LW4 A;  1C7G A;  3ZRP A;  1XEY A;  1IUG A;  1M0P A;  3AV7 A;  1FG3 A;  1ART A;  4F5J A;  3N4R A;  4ADD A;  3II0 A;  1M32 A;  2FM1 A;  4R5F A;  1W23 A;  2OKJ A;  3AEJ A;  4H51 A;  1H0C A;  3WCO A;  1LC8 A;  3W1H A;  1XI9 A;  1ZC9 A;  4WXG A;  1M6S A;  3N7N A;  1CQ8 A;  3UWC A;  4ZM3 A;  3I4J A;  3NYS A;  3BS8 A;  3RQ1 A;  1G4X A;  4Q6R A;  3VK3 A;  5EAA A;  2CFB A;  5G09 A;  2BHX A;  9AAT A;  1YOO A;  2Z9W A;  3LWS A;  3NUI A;  3HL2 A;  1AJR A;  1DFO A;  4O6Z A;  5DJ9 A;  2ZSM A;  1UKJ A;  1VP4 A;  3BV0 A;  5M4D A;  2VGS A;  4XJO A;  5EIG B;  4FL0 A;  1AIA A;  2W7J A;  5E4Z A;  1EJI A;  1TOG A;  2W8W A;  3NYU A;  4GSA A;  4U2H A;  5G0A A;  2ZY3 A;  3G8M A;  2C44 A;  2AY5 A;  1DGE A;  1TAS A;  1IX8 A;  4AH3 A;  4EMY A;  2JJE A;  3CBF A;  3NDN A;  3MC6 A;  4F5L A;  3AAT A;  3JW9 A;  1G4V A;  2R5E A;  2YRI A;  4IXO A;  4JE5 D;  3FVX A;  3COG A;  4B98 A;  3MBB A;  3VP6 A;  1D2F A;  2EPJ A;  3FFR A;  8AAT A;  2E7U A;  4ADC A;  4UQV A;  3ZRQ A;  1AMQ A;  2HUI A;  3FVU A;  4IW7 A;  1ASM A;  4EB5 A;  4WXF A;  4RIZ A;  3ELP A;  5I92 A;  1GD9 A;  1S0A A;  1LK9 A;  1OHY A;  5EUD A;  2D7Y A;  3EI6 A;  4P7Y A;  3Q8N A;  1WYU A;  3DXV A;  4N0W A;  1GEW A;  1MDX A;  2NMP A;  2VMP A;  3BB8 A;  1KAF A;  5HHY A;  4ZLV A;  2ZY5 A;  5FT6 A;  3NTJ A;  3BWN C;  3HT4 A;  1PG8 A;  4F5I A;  3AEM C;  3EUC A;  1O69 A;  1LC5 A;  3DC1 A;  4IY7 A;  4R8D A;  3PJ0 A;  1GEY A;  2VGU A;  2FYF A;  3JWB A;  4DGT A;  3ISL A;  1MDZ A;  3FSL A;  4BMK A;  2GMS A;  1BJW A;  2OQX A;  3R4T A;  2QB2 A;  5TF5 A;  4Q31 A;  2Z20 A;  1AKA A;  2YCN A;  4WB0 A;  4WYG A;  3HMU A;  4Q76 A;  2D61 A;  5M4B A;  2VMN A;  1YIZ A;  2ZC0 A;  2JJF A;  4AO4 A;  4K2M A;  3NUB A;  3T32 A;  1ZOB A;  4XJM A;  4HVK A;  1V72 A;  2VGZ A;  1SVV A;  4ZDL A;  1ARH A;  1CZC A;  1GC4 A;  2Z67 A;  4Y0D A;  4CBR A;  1IX7 A;  2BIG A;  3KGX A;  4GE7 A;  3LVL B;  2Z61 A;  3NU8 A;  4EU1 A;  2CJD A;  1FG7 A;  1G7W A;  4GDY A;  1AKB A;  4AZJ A;  2XH1 A;  3BCA A;  4WYE A;  2XBN A;  1FC4 A;  2TPL A;  3RBL A;  2HZP A;  3MAU A;  1ELU A;  1BJO A;  1RV3 A;  1ASN A;  2CST A;  4F5G A;  3TCM A;  5LH9 A;  1WYT A;  2VMU A;  2VMQ A;  1IAX A;  4JEZ A;  4TMR A;  2X3L A;  1SZK A;  4PVF A;  3WCN A;  5E5I A;  3VAX A;  2YOB A;  2HOR A;  3AOW A;  1SZS A;  2AY3 A;  1DTY A;  1ASC A;  3QHX A;  4M2K A;  2W7I A;  3JWA A;  1O61 A;  4OYT A;  3MAF A;  2EZ2 A;  3RCH A;  1SFF A;  2JJH A;  2Q7W A;  1WYU B;  3DR7 A;  5DB5 A;  1C9C A;  4RJ0 A;  3FKD A;  1BT4 A;  1P3W A;  3GR9 A;  4K2I A;  1QJ5 A;  1U08 A;  2E7J A;  2W8J A;  1M0O A;  4OBV A;  4E3Q A;  1JF9 A;  2Z9V A;  3IHJ A;  5EAV A;  4CVQ A;  1ZOD A;  3FQ8 A;  1RVY A;  5E3K A;  5EUE A;  2A1V A;  2VI8 A;  1E5F A;  1TOE A;  3F9T A;  2VIA A;  3PDX A;  1AMS A;  3WKR A;  5FT5 A;  3MAD A;  3ASB A;  1O62 A;  1D7S A;  2R0T A;  3QN6 A;  4GE9 A;  4XJL A;  5F8V A;  3W1J A;  2BKW A;  1BQD A;  2OAT A;  1E5E A;  3AEN A;  4K2B A;  3CQ6 A;  2VGV A;  2YHK A;  1GCK A;  4Y0I A;  1JS3 A;  1UU1 A;  2X8U A;  2CAN A;  2OKK A;  1B9I A;  1B8G A;  1OHV A;  3GZD C;  1AHY A;  2EYQ A;  2G6W A;  4FFC A;  1AY5 A;  2DR1 A;  1BJO B;  3GZC A;  4P3M A;  4K05 A;  4PIW A;  3E77 A;  1WYT B;  4PFN A;  2JIS A;  2D65 A;  2VLF A;  2W7D A;  2ZYJ A;  1AHG A;  2FQ6 A;  2HOY A;  1QZ9 A;  3DYD A;  5G2P A;  1ARS A;  2E54 A;  1N31 A;  3NU7 A;  1DJ9 A;  2BI5 A;  1CS1 A;  3GSB A;  1ASF A;  5EUN A;  3P6K A;  4MSO A;  2AY2 A;  4EB7 A;  2AEU A;  1AY8 A;  3I5T A;  4J8L A;  1ASA A;  3L8A A;  3FD0 A;  3FDD A;  1YNU A;  3MAF B;  4M2J A;  4ADB A;  1BJN A;  4ADE A;  4RJY A;  3RCH B;  4B9B A;  2ZY2 A;  4NOG A;  2AY8 A;  5BJ3 A;  4WYF A;  2VMW A;  1PMO A;  4IXZ A;  3HLM A;  3WGB A;  4UHO A;  5DJ1 A;  2W7K A;  2ZSL A;  2WK8 A;  2YCP A;  4Q75 A;  3VK4 A;  1WYV A;  3E2Y A;  4GEB A;  1J32 A;  2AY6 A;  4AOA A;  1MGV A;  3FQ7 A;  1I41 A;  4A0G A;  2QBT A;  3ACZ A;  1B5P A;  4RIT A;  1CZE A;  4AO9 A;  2VMV A;  3B8X A;  1KKP A;  2WB6 A;  1LW5 A;  2ZUK A;  4XK1 A;  4KXK A;  5FT8 A;  5M46 A;  4MKK A;  1B9H A;  3PAA A;  3KGW A;  1AHX A;  3DOD A;  5D5S A;  2Z9X A;  1CQ6 A;  3EI8 A;  1WKH A;  3AEN B;  1IX6 A;  2HP2 A;  3E2F A;  2D64 A;  2EO5 A;  4A72 A;  2W7H A;  4QGR A;  3ZZK A;  3E2Z A;  4JEX A;  1Y4I A;  4ATQ A;  4OC9 A;  2W7E A;  4RLG A;  3HDO A;  1KMK A;  1UU0 A;  1C7O A;  5D95 A;  4ZM4 A;  2VMZ A;  3PA9 A;  1GDE A;  3QGU A;  2W7L A;  1KL1 A;  1C0N A;  3EI9 A;  2R5C A;  4W1V A;  3JU7 A;  2D5Y A;  3HBX A;  1AIB A;  2ORD A;  3AEJ C;  4J5U A;  3ZZJ A;  1ELQ A;  4I8A A;  5M49 A;  4E1O A;  1YAA A;  1ASG A;  4R2N A;  1S07 A;  3PD6 A;  1BW0 A;  1SF2 A;  1BQA A;  4W1X A;  4A6R A;  2AEV A;  1W7L A;  1WKG A;  1EQB A;  1SPA A;  4W8I A;  2BWO A;  2W8V A;  3USF A;  2ZJG A;  1GEX A;  2CH1 A;  3FVS A;  2CTZ A;  1I29 A;  1PMM A;  4BA5 A;  4E77 A;  2C0R A;  3PIU A;  4RAE A;  2BWN A;  4IX8 A;  2HOX A;  1D7R A;  3M5U A;  2YKY A;  4KAM A;  1EG5 A;  2HP1 A;  3EZ1 A;  2CIN A;  1N2T A;  1G7X A;  4RKC A;  2BWP A;  1QJ3 A;  4TV7 A;  1AKC A;  4UHM A;  2AY4 A;  1TAT A;  3H9X A;  1TPL A;  1WYV B;  2YKV A;  3FRK A;  3MC6 C;  3RBF A;  3CQ5 A;  3QM2 A;  2VGW A;  2CB1 A;  4JF1 A;  2DGL A;  3OKS A;  2C81 A;  3N4X A;  1M4N A;  3GET A;  2E7I A;  2D7Z A;  4W91 A;  2GSA A;  2FKI A;  3FQA A;  3OP7 A;  3RI6 A;  4U1T A;  4OCA A;  1H1C A;  1I48 A;  1KKJ A;  5LHA A;  1C7N A;  3MKJ A;  4JEV A;  4WYD A;  4XQ2 A;  2BI3 A;  2D66 A;  1QGN A;  3WY7 A;  3CQ4 A;  3K28 A;  4F4E A;  2RFV A;  3BCB A;  2QB3 A;  1C4K A;  1X28 A;  2DKJ A;  3B1C A;  1OXP A;  3B46 A;  1MLZ A;  2AAT A;  2VI9 A;  3A2B A;  5HDM A;  5K8B A;  5KTB A;  2QLR A;  4WB0 B;  4R5Z A;  1QIT A;  3B1E A;  2WK7 A;  1ASL A;  4F5K A;  4PFF A;  1MLY A;  2OGA A;  3ECD A;  3IF2 A;  3NX3 A;  1M0N A;  2VMS A;  2X5F A;  1J04 A;  3ELE A;  4DBC A;  4DQ6 A;  5BJ4 A;  2BI2 A;  3I16 A;  4F5M A;  1VEF A;  5AX8 A;  1DGD A;  2GQN A;  3ZRR A;  2BI1 A;  2BIA A;  2R5C B;  2X5D A;  3ATH A;  1ASB A;  3RUY A;  4IXS A;  1S06 A;  3BN1 A;  1TOJ A;  1KMJ A;  1AIC A;  3BC8 A;  1GC2 A;  4WXB A;  3LVJ A;  2EGY A;  3BWN A;  2VMR A;  1AMR A;  2EH6 A;  3AEM A;  1DJE A;  3PD6 B;  4H63 Q;  1IVR A;  5JAY A;  3H7F A;  3NNK A;  3FDB A;  4A6U A;  4A0R A;  1DKA A;  3GJU A;  2CJG A;  1CL1 A;  3G0T A;  4WBT A;  2Z9U A;  2FNU A;  5G4I A;  4CXQ A;  4RM1 A;  2YKU A;  4MQP A;  4KYO A;  3EI5 A;  3DZZ A;  2DGK A;  3A9Z A;  1OHW A;  4AZK A;  1WST A;  4LNJ A;  3DU4 A;  2JJG A;  1MAQ A;  3E9K A;  4MGR A;  2CH2 A;  3LY1 A;  1OXO A;  4JEY A;  2YKX A;  3MEB A;  3R9A A;  3VK2 A;  1KL2 A;  2PO3 A;  1JG8 A;  1AMA A;  4RKD A;  2BYL A;  2DOU A;  2WK9 A;  1X2A A;  3QBO A;  2W7M A;  2GMU A;  3BCX A;  1JS6 A;  4UOY A;  2BYJ A;  2VYC A;  4OTL A;  2Z1Y A;  4ATP A;  3PDB A;  1AAW A;  2OGE A;  3AEL A;  2CJH A;  2W7G A;  3F0H A;  1TOK A;  4IYO A;  3TAT A;  2CY8 A;  1UU2 A;  3FCR A;  2VIB A;  1M7Y A;  1OAT A;  3EIA A;  5F9S A;  2QA3 A;  4MKJ A;  1D7U A;  4L0O A;  4OBU A;  1QIR A;  4TN4 A;  4M2M A;  2AY1 A;  4HF8 A;  3AEP A;  1ARI A;  3BWO A;  2AY9 A;  1ASD A;  5EQC A;  4JF0 A;  1S09 A;  1AHE A;  1ECX A;  4ISY A;  4MQR A;  4OT8 A;  2Z1Z A;  3AEO A;  2O7C A;  3W1I A;  3PPL A;  1W3U A;  3GWP A;  1AJS A; 
#chains in the Genus database with same CATH homology
 1CL2 A;  3TQX A;  3QPG A;  2O1B A;  2VMO A;  1GC3 A;  3AOV A;  1BKG A;  1D7V A;  2ZP7 A;  1IJI A;  1RVU A;  4EFF A;  3FTB A;  1X29 A;  2R2N A;  4A0F A;  1B4X A;  1CJ0 A;  1M0Q A;  1MAP A;  4ZDP A;  2JG2 A;  1V2F A;  3TFT A;  2YCT A;  3KKI A;  3D6K A;  3NYT A;  2YRR A;  5HXX A;  4JE5 A;  3GBX A;  4LNM A;  4CXR A;  3LVM A;  2DGM A;  4WYA A;  4LC3 A;  3F6T A;  3TFU A;  2D63 A;  4W1W A;  4MY5 A;  1AAM A;  1CQ7 A;  3FZ7 A;  4ZWM A;  4BHD A;  3N4S A;  1S08 A;  4WP0 A;  1B5O A;  3N0L A;  4ZWV A;  1T3I A;  3WLX A;  1VJO A;  7AAT A;  4WD2 A;  3P1T A;  1YJZ A;  4JEW A;  4A00 A;  4ITX A;  2KFP A;  1GC0 A;  4ITG A;  3N5M A;  1V2E A;  4WLJ A;  4XEW A;  5J8Q A;  4F5H A;  3DRD A;  1QIS A;  3B1D A;  2FNI A;  3GZD A;  2VMY A;  1AX4 A;  2VMT A;  4WYC A;  1W7M A;  2FN6 A;  3PDB B;  5G2Q A;  4LNL A;  4IYO B;  1TAR A;  1O4S A;  3LG0 A;  1YJY A;  1PFF A;  2HOZ A;  3HVY A;  2F8J A;  4XJP A;  4CBS A;  1YJS A;  4OMA A;  3UE8 A;  4ZAH A;  3JZL A;  4ZAS A;  4BQ0 A;  4MQQ A;  3EZS A;  1IBJ A;  3H14 A;  2VLH A;  2BI9 A;  3UAK A;  1SZU A;  2JGT A;  3FZ8 A;  1W7N A;  4Y0H A;  3L44 A;  2O0R A;  3QI6 A;  3N75 A;  2HUU A;  2PB0 A;  4XAU A;  3ASA A;  2AY7 A;  3EIB A;  2GB3 A;  3PGY A;  5C6U A;  2HUF A;  3FFH A;  1LS3 A;  1GBN A;  1ORD A;  2EZ1 A;  1AJS B;  3FZ6 A;  2PB2 A;  1Z7D A;  2V1P A;  4GRX A;  5EIG A;  1AY4 A;  2DKB A;  2C7T A;  4ZSW A;  1ARG A;  2QMA A;  3JTX A;  4BA4 A;  4N0B A;  1IAY A;  5DX5 A;  3EI7 A;  1RV4 A;  3E2Z B;  4LW2 A;  3LV2 A;  3K40 A;  3VOM A;  3WZF A;  3WX9 A;  1AHF A;  3A9X A;  5G4J A;  3G7Q A;  1X0M A;  4WLH A;  3DR4 A;  3DXW A;  3E6G A;  3LVK A;  3WKS A;  5IWQ A;  2QSR A;  2ZY4 A;  1LKC A;  1BJ4 A;  1N8P A;  1YIY A;  2VMX A;  3CAI A;  3K7Y A;  1DJU A;  3WGC A;  2G7J A;  3HQT A;  1MDO A;  4UHN A;  4LW4 A;  2V0Y A;  4A0H A;  4E3R A;  1Z3Z A;  1LC7 A;  4ZDO A;  2W8T A;  4W5K A;  2WKA A;  1TOI A;  2VGT A;  5FT4 A;  2BIE A;  3NRA A;  4GE4 A;  4F5F A;  1BS0 A;  2W8U A;  3A8U X;  1I43 A;  5EFS A;  4A6T A;  4ZSY A;  3KE3 A;  2W7F A;  1V2D A;  1ASE A;  3A9Y A;  1LW4 A;  1C7G A;  3ZRP A;  1XEY A;  1IUG A;  1M0P A;  3AV7 A;  1FG3 A;  1ART A;  4F5J A;  3N4R A;  4ADD A;  3II0 A;  1M32 A;  2FM1 A;  4R5F A;  1W23 A;  2OKJ A;  3AEJ A;  4H51 A;  1H0C A;  3WCO A;  1LC8 A;  3W1H A;  1XI9 A;  1ZC9 A;  4WXG A;  1M6S A;  3N7N A;  1CQ8 A;  3UWC A;  4ZM3 A;  3I4J A;  3NYS A;  3BS8 A;  3RQ1 A;  1G4X A;  4Q6R A;  3VK3 A;  5EAA A;  2CFB A;  5G09 A;  2BHX A;  9AAT A;  1YOO A;  2Z9W A;  3LWS A;  3NUI A;  3HL2 A;  1AJR A;  1DFO A;  4O6Z A;  5DJ9 A;  2ZSM A;  1UKJ A;  1VP4 A;  3BV0 A;  5M4D A;  2VGS A;  4XJO A;  5EIG B;  4FL0 A;  1AIA A;  2W7J A;  5E4Z A;  1EJI A;  1TOG A;  2W8W A;  3NYU A;  4GSA A;  4U2H A;  5G0A A;  2ZY3 A;  3G8M A;  2C44 A;  2AY5 A;  1DGE A;  1TAS A;  1IX8 A;  4AH3 A;  4EMY A;  2JJE A;  3CBF A;  3NDN A;  3MC6 A;  4F5L A;  3AAT A;  3JW9 A;  1G4V A;  2R5E A;  2YRI A;  4IXO A;  4JE5 D;  3FVX A;  3COG A;  4B98 A;  3MBB A;  3VP6 A;  1D2F A;  2EPJ A;  3FFR A;  8AAT A;  2E7U A;  4ADC A;  4UQV A;  3ZRQ A;  1AMQ A;  2HUI A;  3FVU A;  4IW7 A;  1ASM A;  4EB5 A;  4WXF A;  4RIZ A;  3ELP A;  5I92 A;  1GD9 A;  1S0A A;  1LK9 A;  1OHY A;  5EUD A;  2D7Y A;  3EI6 A;  4P7Y A;  3Q8N A;  1WYU A;  3DXV A;  4N0W A;  1GEW A;  1MDX A;  2NMP A;  2VMP A;  3BB8 A;  5HHY A;  4ZLV A;  2ZY5 A;  5FT6 A;  3NTJ A;  3BWN C;  3HT4 A;  1PG8 A;  4F5I A;  3AEM C;  3EUC A;  1O69 A;  1LC5 A;  3DC1 A;  4IY7 A;  4R8D A;  3PJ0 A;  1GEY A;  2VGU A;  2FYF A;  3JWB A;  4DGT A;  3ISL A;  1MDZ A;  3FSL A;  4BMK A;  2GMS A;  1BJW A;  2OQX A;  3R4T A;  2QB2 A;  5TF5 A;  4Q31 A;  2Z20 A;  1AKA A;  2YCN A;  4WB0 A;  4WYG A;  3HMU A;  4Q76 A;  2D61 A;  5M4B A;  2VMN A;  1YIZ A;  2ZC0 A;  2JJF A;  4AO4 A;  4K2M A;  3NUB A;  3T32 A;  1ZOB A;  4XJM A;  4HVK A;  1V72 A;  2VGZ A;  1SVV A;  4ZDL A;  1ARH A;  1CZC A;  1GC4 A;  2Z67 A;  4Y0D A;  4CBR A;  1IX7 A;  2BIG A;  3KGX A;  4GE7 A;  3LVL B;  2Z61 A;  3NU8 A;  4EU1 A;  2CJD A;  1FG7 A;  1G7W A;  4GDY A;  1AKB A;  4AZJ A;  2XH1 A;  3BCA A;  4WYE A;  2XBN A;  1FC4 A;  2TPL A;  3RBL A;  2HZP A;  3MAU A;  1ELU A;  1BJO A;  1RV3 A;  1ASN A;  2CST A;  4F5G A;  3TCM A;  5LH9 A;  1WYT A;  2VMU A;  2VMQ A;  1IAX A;  4JEZ A;  4TMR A;  2X3L A;  1SZK A;  4PVF A;  3WCN A;  5E5I A;  3VAX A;  2YOB A;  2HOR A;  3AOW A;  1SZS A;  2AY3 A;  1DTY A;  1ASC A;  3QHX A;  4M2K A;  2W7I A;  3JWA A;  1O61 A;  4OYT A;  3MAF A;  2EZ2 A;  3RCH A;  1SFF A;  2JJH A;  2Q7W A;  1WYU B;  3DR7 A;  5DB5 A;  1C9C A;  4RJ0 A;  3FKD A;  1BT4 A;  1P3W A;  3GR9 A;  4K2I A;  1QJ5 A;  1U08 A;  2E7J A;  2W8J A;  1M0O A;  4OBV A;  4E3Q A;  1JF9 A;  2Z9V A;  3IHJ A;  5EAV A;  4CVQ A;  1ZOD A;  3FQ8 A;  1RVY A;  5E3K A;  5EUE A;  2A1V A;  2VI8 A;  1E5F A;  1TOE A;  3F9T A;  2VIA A;  3PDX A;  1AMS A;  3WKR A;  5FT5 A;  3MAD A;  3ASB A;  1O62 A;  1D7S A;  2R0T A;  3QN6 A;  4GE9 A;  4XJL A;  5F8V A;  3W1J A;  2BKW A;  1BQD A;  2OAT A;  1E5E A;  3AEN A;  4K2B A;  3CQ6 A;  2VGV A;  2YHK A;  1GCK A;  4Y0I A;  1JS3 A;  1UU1 A;  2X8U A;  2CAN A;  2OKK A;  1B9I A;  1B8G A;  1OHV A;  3GZD C;  1AHY A;  2EYQ A;  2G6W A;  4FFC A;  1AY5 A;  2DR1 A;  1BJO B;  3GZC A;  4P3M A;  4K05 A;  4PIW A;  3E77 A;  1WYT B;  4PFN A;  2JIS A;  2D65 A;  2VLF A;  2W7D A;  2ZYJ A;  1AHG A;  2FQ6 A;  2HOY A;  1QZ9 A;  3DYD A;  5G2P A;  1ARS A;  2E54 A;  1N31 A;  3NU7 A;  1DJ9 A;  2BI5 A;  1CS1 A;  3GSB A;  1ASF A;  5EUN A;  3P6K A;  4MSO A;  2AY2 A;  4EB7 A;  2AEU A;  1AY8 A;  3I5T A;  4J8L A;  1ASA A;  3L8A A;  3FD0 A;  3FDD A;  1YNU A;  3MAF B;  4M2J A;  4ADB A;  1BJN A;  4ADE A;  4RJY A;  3RCH B;  4B9B A;  2ZY2 A;  4NOG A;  2AY8 A;  5BJ3 A;  4WYF A;  2VMW A;  1PMO A;  4IXZ A;  3HLM A;  3WGB A;  4UHO A;  5DJ1 A;  2W7K A;  2ZSL A;  2WK8 A;  2YCP A;  4Q75 A;  3VK4 A;  1WYV A;  3E2Y A;  4GEB A;  1J32 A;  2AY6 A;  4AOA A;  1MGV A;  3FQ7 A;  1I41 A;  4A0G A;  2QBT A;  3ACZ A;  1B5P A;  4RIT A;  1CZE A;  4AO9 A;  2VMV A;  3B8X A;  1KKP A;  2WB6 A;  1LW5 A;  2ZUK A;  4XK1 A;  4KXK A;  5FT8 A;  5M46 A;  4MKK A;  1B9H A;  3PAA A;  3KGW A;  1AHX A;  3DOD A;  5D5S A;  2Z9X A;  1CQ6 A;  3EI8 A;  1WKH A;  3AEN B;  1IX6 A;  2HP2 A;  3E2F A;  2D64 A;  2EO5 A;  4A72 A;  2W7H A;  4QGR A;  3ZZK A;  3E2Z A;  4JEX A;  1Y4I A;  4ATQ A;  4OC9 A;  2W7E A;  4RLG A;  3HDO A;  1KMK A;  1UU0 A;  1C7O A;  5D95 A;  4ZM4 A;  2VMZ A;  3PA9 A;  1GDE A;  3QGU A;  2W7L A;  1KL1 A;  1C0N A;  3EI9 A;  2R5C A;  4W1V A;  3JU7 A;  2D5Y A;  3HBX A;  1AIB A;  2ORD A;  3AEJ C;  4J5U A;  3ZZJ A;  1ELQ A;  4I8A A;  5M49 A;  4E1O A;  1YAA A;  1ASG A;  4R2N A;  1S07 A;  3PD6 A;  1BW0 A;  1SF2 A;  1BQA A;  4W1X A;  4A6R A;  2AEV A;  1W7L A;  1WKG A;  1EQB A;  1SPA A;  4W8I A;  2BWO A;  2W8V A;  3USF A;  2ZJG A;  1GEX A;  2CH1 A;  3FVS A;  2CTZ A;  1I29 A;  1PMM A;  4BA5 A;  4E77 A;  2C0R A;  3PIU A;  4RAE A;  2BWN A;  4IX8 A;  2HOX A;  1D7R A;  3M5U A;  2YKY A;  4KAM A;  1EG5 A;  2HP1 A;  3EZ1 A;  2CIN A;  1N2T A;  1G7X A;  4RKC A;  2BWP A;  1QJ3 A;  4TV7 A;  1AKC A;  4UHM A;  2AY4 A;  1TAT A;  3H9X A;  1TPL A;  1WYV B;  2YKV A;  3FRK A;  3MC6 C;  3RBF A;  3CQ5 A;  3QM2 A;  2VGW A;  2CB1 A;  4JF1 A;  2DGL A;  3OKS A;  2C81 A;  3N4X A;  1M4N A;  3GET A;  2E7I A;  2D7Z A;  4W91 A;  2GSA A;  2FKI A;  3FQA A;  3OP7 A;  3RI6 A;  4U1T A;  4OCA A;  1H1C A;  1I48 A;  1KKJ A;  5LHA A;  1C7N A;  3MKJ A;  4JEV A;  4WYD A;  4XQ2 A;  2BI3 A;  2D66 A;  1QGN A;  3WY7 A;  3CQ4 A;  3K28 A;  4F4E A;  2RFV A;  3BCB A;  2QB3 A;  1C4K A;  1X28 A;  2DKJ A;  3B1C A;  1OXP A;  3B46 A;  1MLZ A;  2AAT A;  2VI9 A;  3A2B A;  5HDM A;  5K8B A;  5KTB A;  2QLR A;  4WB0 B;  4R5Z A;  1QIT A;  3B1E A;  2WK7 A;  1ASL A;  4F5K A;  4PFF A;  1MLY A;  2OGA A;  3ECD A;  3IF2 A;  3NX3 A;  1M0N A;  2VMS A;  2X5F A;  1J04 A;  3ELE A;  4DBC A;  4DQ6 A;  5BJ4 A;  2BI2 A;  3I16 A;  4F5M A;  1VEF A;  5AX8 A;  1DGD A;  2GQN A;  3ZRR A;  2BI1 A;  2BIA A;  2R5C B;  2X5D A;  3ATH A;  1ASB A;  3RUY A;  4IXS A;  1S06 A;  3BN1 A;  1TOJ A;  1KMJ A;  1AIC A;  3BC8 A;  1GC2 A;  4WXB A;  3LVJ A;  2EGY A;  3BWN A;  2VMR A;  1AMR A;  2EH6 A;  3AEM A;  1DJE A;  3PD6 B;  4H63 Q;  1IVR A;  5JAY A;  3H7F A;  3NNK A;  3FDB A;  4A6U A;  4A0R A;  1DKA A;  3GJU A;  2CJG A;  1CL1 A;  3G0T A;  4WBT A;  2Z9U A;  2FNU A;  5G4I A;  4CXQ A;  4RM1 A;  2YKU A;  4MQP A;  4KYO A;  3EI5 A;  3DZZ A;  2DGK A;  3A9Z A;  1OHW A;  4AZK A;  1WST A;  4LNJ A;  3DU4 A;  2JJG A;  1MAQ A;  3E9K A;  4MGR A;  2CH2 A;  3LY1 A;  1OXO A;  4JEY A;  2YKX A;  3MEB A;  3R9A A;  3VK2 A;  1KL2 A;  2PO3 A;  1JG8 A;  1AMA A;  4RKD A;  2BYL A;  2DOU A;  2WK9 A;  1X2A A;  3QBO A;  2W7M A;  2GMU A;  3BCX A;  1JS6 A;  4UOY A;  2BYJ A;  2VYC A;  4OTL A;  2Z1Y A;  4ATP A;  3PDB A;  1AAW A;  2OGE A;  3AEL A;  2CJH A;  2W7G A;  3F0H A;  1TOK A;  4IYO A;  3TAT A;  2CY8 A;  1UU2 A;  3FCR A;  2VIB A;  1M7Y A;  1OAT A;  3EIA A;  5F9S A;  2QA3 A;  4MKJ A;  1D7U A;  4L0O A;  4OBU A;  1QIR A;  4TN4 A;  4M2M A;  2AY1 A;  4HF8 A;  3AEP A;  1ARI A;  3BWO A;  2AY9 A;  1ASD A;  5EQC A;  4JF0 A;  1S09 A;  1AHE A;  1ECX A;  4ISY A;  4MQR A;  4OT8 A;  2Z1Z A;  3AEO A;  2O7C A;  3W1I A;  3PPL A;  1W3U A;  3GWP A;  1AJS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...