4B98A

The structure of the omega aminotransferase from pseudomonas aeruginosa
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
441
structure length
441
Chain Sequence
APPVSSELNLRAHWMPFSANRNFQKDPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGTLDYSPGFQYGHPLSFQLAEKIAGLLPGELNHVFFTGSGSECADTSIKMARAYWRLKGQPQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRGMAQTGGVELANELLKLIELHDASNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFGRLGTYSGAEYFGVTPDLMNVAKQVTNGAVPMGAVIASSEIYDTFMNQALPEHAVEFSHGYTYSAHPVACAAGLAALDILARDNLVQQSAELAPHFEKGLHGLQGAKNVIDIRNCGLAGAIQIAPRDGDPTVRPFEAGMKLWQQGFYVRFGGDTLQFGPTFNARPEELDRLFDAVGEALNGIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies with Pseudomonas and Chromobacterium [Omega]-Aminotransferases Provide Insights Into Their Differing Substrate Specificity.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Transferase
molecule keywords BETA-ALANINE--PYRUVATE TRANSAMINASE
total genus 152
structure length 441
sequence length 441
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.18: Beta-alanine--pyruvate transaminase.
pdb deposition date 2012-09-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4b98A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4b98A01
4JEZA 1SZUA 3P1TA 4WYCA 4WD2A 3E2FA 1XI9A 3ASBA 4WYFA 3AELA 1DJ9A 3NTJA 3A8UX 5EFSA 4A0HA 1W7LA 2BIAA 4DGTA 4WXGA 1D7SA 4F5LA 1ASCA 1I48A 5EIGA 1C9CA 1EQBA 2C0RA 3FSLA 1CL2A 2ZY2A 1M0OA 2FN6A 4EMYA 3QHXA 1RVYA 2D7ZA 1ASNA 1QGNA 3JZLA 3DRDA 2JJHA 3BC8A 4ZDOA 5F8VA 1M0QA 1V72A 1DKAA 1D7VA 4AO9A 3QGUA 4BA5A 1GEXA 2GMUA 3HVYA 1VP4A 1YOOA 3RQ1A 3W1JA 1CJ0A 1KKPA 3GJUA 3RI6A 2HP1A 5DB5A 2WK8A 4MY5A 1ARTA 1SF2A 2CSTA 5G4JA 3BCXA 3BCBA 3MAFB 4OCAA 3FDDA 2DR1A 5FT5A 1AKAA 5G0AA 4NOGA 1W3UA 1KKJA 1AAMA 1BQAA 1U08A 3CQ6A 1GC4A 2W7JA 1OHWA 2W7KA 3EI5A 4K2BA 2DKJA 1E5FA 2CY8A 3H14A 3AENA 4LNMA 3F0HA 5D95A 1TATA 2HORA 2FNUA 3BWOA 3PAAA 3QM2A 3A2BA 8AATA 4FFCA 4MQRA 2FYFA 2Z67A 3JTXA 1W7NA 3DZZA 2BI5A 4WYDA 1TOKA 1MDXA 3CQ4A 1QZ9A 3BWNC 3JWBA 3EIBA 4CXQA 1FG7A 3IHJA 3RCHB 5G09A 3AOVA 3ZZJA 3AEJA 4WB0B 4L0OA 2RFVA 2EH6A 1G4VA 2WKAA 4CBSA 4ZASA 3EZ1A 2VI9A 3WGCA 3PD6B 1AHEA 3F9TA 2BYLA 4EFFA 2VMTA 3NDNA 1DGEA 4GRXA 3AV7A 4UHNA 1IX7A 2QLRA 1WYTB 3DR7A 3GZCA 2DKBA 3QPGA 4OC9A 1WYUB 3TQXA 2VLFA 4IYOA 1V2FA 2BWNA 4R5ZA 2OATA 1SVVA 4RJ0A 3NUIA 4TV7A 1TOJA 2VMZA 4HVKA 1H1CA 3FQAA 4R8DA 2HUUA 1Z3ZA 2AY7A 3FVUA 2E7UA 2CANA 1JG8A 1MAPA 2VGZA 2VI8A 3FCRA 1UKJA 1TOGA 4RITA 4Y0HA 5G4IA 3ATHA 1AJRA 2ORDA 1W23A 3D6KA 2W8JA 4TN4A 4UHMA 4AZJA 4CVQA 3GETA 2ZJGA 5JAYA 2AY9A 4WXFA 1JS6A 3FQ8A 1C7OA 3MBBA 4O6ZA 3ZRPA 5M49A 2BIEA 3BWNA 4F5GA 3FZ6A 3K7YA 1YIYA 3EI7A 2PO3A 2Z9UA 3Q8NA 3HMUA 1LW4A 3BN1A 3G8MA 1AMAA 3KGWA 4GDYA 4A6TA 4W5KA 4KYOA 1RVUA 5DX5A 1IAXA 2QA3A 2PB0A 3DXWA 1C7GA 1C7NA 1VJOA 4KXKA 1O4SA 2AY8A 2HUFA 2VGVA 4F5KA 3BV0A 1WYVA 3DXVA 4UQVA 2E54A 4XQ2A 2GB3A 3B1EA 1Z7DA 3KE3A 1CS1A 1G7XA 2QBTA 2CFBA 3NX3A 4DBCA 1AJSA 1I41A 5E4ZA 1QITA 1UU1A 1ASBA 4LC3A 1GC0A 1FG3A 1IAYA 1IJIA 2Z9VA 3CBFA 3ELEA 3FDBA 3ISLA 4WYAA 1BJOA 5EUNA 2CH1A 2QB3A 2Z9WA 1QISA 1AHGA 3GR9A 3NYSA 4Y0DA 2GQNA 1AMQA 4K2MA 1S0AA 1EJIA 4R2NA 2VMYA 4N0WA 1WSTA 1G4XA 2CINA 2QMAA 4ZM4A 3WKSA 1M0PA 1TARA 2C7TA 2XBNA 3JWAA 1MLYA 4R5FA 1S06A 3A9XA 3AEMA 4HF8A 2VMOA 3EIAA 1TPLA 4IW7A 3LG0A 4XJOA 2CJHA 3VK2A 4ITGA 1AHXA 2F8JA 2D61A 4E3QA 2R5CB 1B5OA 4XK1A 4BHDA 3HL2A 3L44A 4RJYA 2BI1A 4GEBA 3LY1A 4JEVA 3NRAA 2ZC0A 3VOMA 1JF9A 3KKIA 4LW4A 4A0FA 2HOXA 4RM1A 2FQ6A 1SPAA 3B46A 1KMJA 2ZSMA 2VMRA 1O61A 1AHFA 2WK9A 2YKXA 3AOWA 3GSBA 3II0A 3TFTA 3GZDA 1AY5A 1V2DA 3BS8A 1CQ6A 1B5PA 3I16A 1UU2A 1V2EA 4E1OA 2R2NA 2HUIA 2DGLA 4E3RA 1O62A 4CXRA 3PIUA 3UAKA 3E77A 3G7QA 2W7EA 4WP0A 3B8XA 3ELPA 3CQ5A 4B9BA 3DU4A 1QJ5A 2VMWA 1ASGA 3RCHA 4OMAA 2Z9XA 2VMSA 4TMRA 3RBLA 1IBJA 2OKJA 3B1CA 1CZCA 2YKUA 2YCNA 1KL1A 2JGTA 3E2ZB 5C6UA 3I5TA 3LV2A 2QB2A 3PPLA 2JISA 5DJ9A 4AOAA 2EPJA 2W7FA 1LS3A 5HDMA 2CB1A 2VIBA 2X3LA 5FT8A 4F5FA 4ITXA 2CJDA 3W1HA 4A0RA 3MAUA 3MKJA 4RLGA 1N8PA 3NYUA 4M2JA 3MC6C 4WB0A 3N0LA 1DGDA 1MLZA 2AEVA 2FM1A 3GWPA 3RBFA 5G2PA 1UU0A 3WLXA 2AATA 3FTBA 2GSAA 2X8UA 1AKCA 1ASFA 1RV4A 3LVMA 4MKKA 1GBNA 1SFFA 3HLMA 2YKVA 4IXZA 3HT4A 4OBUA 4AO4A 4B98A 2CTZA 2AEUA 4M2MA 1N2TA 1LC8A 1X0MA 2VGWA 2E7JA 2EO5A 4ZSWA 2VGSA 4A00A 2JG2A 1AIAA 1O69A 1SZSA 3AEOA 3MC6A 4ZWVA 2VMNA 5EQCA 3VAXA 1D2FA 3LVLB 5DJ1A 1AMSA 4WLJA 4ZDPA 1E5EA 1CL1A 2R5EA 2YKYA 1YAAA 2NMPA 3E9KA 2JJGA 5FT6A 1X29A 2VMVA 2ZUKA 2D64A 2BIGA 4RAEA 1D7UA 1ARIA 3IF2A 4WYGA 2O0RA 2VIAA 4GE9A 4ADDA 5EUEA 1S08A 1Y4IA 4ATPA 4PFFA 4XJLA 4WXBA 2HZPA 2AY1A 2HOZA 4ZLVA 1IUGA 2ZP7A 1BJWA 2X5DA 3RUYA 4GSAA 2W7DA 2AY2A 2VMXA 2JJFA 3OKSA 4Q76A 3HDOA 4UHOA 3DYDA 5F9SA 3DR4A 1QJ3A 7AATA 1YJSA 1GEWA 2C81A 3VK4A 2AY4A 5EAVA 5HXXA 1X28A 3PDBA 1GC2A 4IXSA 4JEYA 4A6RA 3P6KA 2ZY4A 1PMMA 2W7HA 1LKCA 1M4NA 2BWOA 1C4KA 1SZKA 5EAAA 1GD9A 1BJ4A 3ACZA 2Z61A 2BWPA 2W8WA 3H7FA 2W8TA 2D63A 2OQXA 4WBTA 3T32A 4AH3A 2V0YA 1M6SA 3G0TA 3HQTA 4IYOB 3AEPA 3DC1A 5M46A 2PB2A 4UOYA 3VP6A 2D65A 4BMKA 1IVRA 1DJEA 1YJZA 1OXPA 1ARGA 2W8UA 2YOBA 1PFFA 3FZ7A 3FVXA 1IX8A 4RKCA 1LC5A 2AY5A 3ZZKA 2YHKA 2O1BA 3EI9A 4W1WA 1ORDA 5LH9A 1JS3A 3GBXA 4E77A 1T3IA 4BQ0A 3LWSA 2BI2A 1ECXA 4JEWA 4M2KA 4ZAHA 2EZ1A 3UWCA 1ZOBA 4PFNA 5E5IA 1RV3A 1WKGA 2VLHA 5EIGB 1VEFA 3BCAA 1DTYA 3COGA 3R4TA 2YRIA 4MSOA 5FT4A 1PG8A 3N5MA 1LK9A 1ZC9A 1AMRA 1B9HA 4RKDA 3QN6A 3OP7A 3I4JA 1BJNA 2VMUA 3NYTA 5EUDA 2G6WA 3DODA 4U1TA 2R5CA 3QBOA 2XH1A 5AX8A 4WYEA 1WKHA 5K8BA 3NUBA 1BW0A 1DJUA 1ASMA 1YJYA 5D5SA 1S09A 4XEWA 1AICA 2YCTA 1AHYA 2Z1YA 3GZDC 2VYCA 3ZRRA 2D7YA 1AKBA 3FZ8A 1LC7A 1QIRA 3WKRA 4F5JA 4OYTA 4IX8A 3MEBA 2BI9A 5I92A 3TATA 2W8VA 1MGVA 4CBRA 4BA4A 3PDXA 4XJMA 3A9ZA 1FC4A 2TPLA 1AIBA 2VGTA 5BJ4A 1G7WA 1J04A 2ZSLA 1DFOA 4ZWMA 3TFUA 3W1IA 4W91A 1ASDA 3WZFA 4ZM3A 5LHAA 1AJSB 4ISYA 1KMKA 3MADA 1LW5A 4Q6RA 1CQ7A 2BKWA 4JF1A 5E3KA 1BS0A 3K40A 3L8AA 2D5YA 4JE5D 5M4BA 4I8AA 1C0NA 3AENB 2BYJA 3FFRA 1AY8A 4ADCA 1BQDA 3FFHA 3JU7A 3JW9A 3MAFA 3USFA 1YNUA 3N75A 1GDEA 1H0CA 1P3WA 1GC3A 2DGMA 3PD6A 4QGRA 2FNIA 2JJEA 2O7CA 9AATA 1ASEA 4MQQA 1IX6A 5BJ3A 4EU1A 4FL0A 4GE7A 2VMPA 4XAUA 1W7MA 4MKJA 1J32A 1ELUA 4DQ6A 1ARHA 1CQ8A 3NNKA 1B4XA 4MGRA 2W7MA 1BKGA 2ZY3A 1XEYA 2ZYJA 2BHXA 2R0TA 4ZSYA 2CH2A 1AAWA 4ADBA 4ATQA 2OKKA 1I43A 2HOYA 2DGKA 4JE5A 2EZ2A 2W7IA 3E2YA 1OXOA 3K28A 1BJOB 2CJGA 4A72A 2DOUA 2YRRA 4GE4A 4PVFA 1TOIA 1B8GA 4PIWA 4A6UA 3KGXA 2ZY5A 1AY4A 2W7GA 3ASAA 1N31A 4AZKA 1B9IA 3AEJC 4JF0A 4Y0IA 4H51A 4MQPA 2HP2A 2VMQA 3NU8A 3QI6A 2Q7WA 5HHYA 1WYUA 1X2AA 1ZODA 4EB7A 4F5IA 4LNLA 3HBXA 3B1DA 4J5UA 1ASLA 2Z1ZA 4N0BA 1OATA 3FD0A 3WCNA 1D7RA 4RIZA 5J8QA 4F5HA 3EZSA 2C44A 4A0GA 4EB5A 1MDZA 4W1VA 3ECDA 1S07A 2WK7A 3WCOA 3F6TA 4KAMA 1I29A 3A9YA 2W7LA 5IWQA 4XJPA 2D66A 3WY7A 3AEMC 3ZRQA 1AX4A 1GCKA 1OHYA 2YCPA 3NU7A 4F4EA 3PDBB 3FQ7A 3PJ0A 3TCMA 1EG5A 4IXOA 1YIZA 2X5FA 2AY6A 1MAQA 4J8LA 4Q31A 2GMSA 2OGEA 3UE8A 1M0NA 4LNJA 4W1XA 3VK3A 1M32A 4ADEA 4W8IA 4OTLA 2EGYA 5M4DA 4IY7A 4LW2A 1PMOA 1KL2A 2E7IA 1BT4A 3CAIA 1MDOA 3LVJA 3E6GA 4OBVA 1TOEA 3M5UA 3BB8A 5TF5A 3FRKA 4JEXA 2AY3A 1ELQA 1CZEA 3PGYA 2VGUA 2Z20A 3EI6A 3EUCA 3PA9A 4P3MA 4OT8A 3WX9A 1WYVB 1OHVA 4K2IA 3EI8A 3AATA 4ZDLA 4F5MA 1ARSA 2OGAA 1ASAA 3LVKA 3R9AA 4P7YA 3FKDA 1TASA 1WYTA 3E2ZA 2V1PA 4Q75A 5G2QA 2BI3A 4WLHA 1GEYA 4U2HA 1M7YA 3FVSA 3WGBA
chains in the Genus database with same CATH superfamily
4JEZA 1SZUA 3P1TA 4WYCA 2QSRA 4WD2A 3E2FA 1XI9A 3ASBA 4WYFA 3AELA 1DJ9A 3NTJA 3A8UX 5EFSA 4A0HA 1W7LA 2BIAA 4DGTA 4WXGA 1D7SA 4F5LA 1ASCA 1I48A 5EIGA 1C9CA 1EQBA 2C0RA 3FSLA 1CL2A 2ZY2A 1M0OA 2FN6A 4EMYA 3QHXA 1RVYA 2EYQA 2D7ZA 1ASNA 1QGNA 3JZLA 3DRDA 2JJHA 3BC8A 4ZDOA 5F8VA 1M0QA 1V72A 1DKAA 1D7VA 4AO9A 3QGUA 4BA5A 1GEXA 2GMUA 3HVYA 1VP4A 1YOOA 3RQ1A 3W1JA 1CJ0A 1KKPA 3GJUA 3RI6A 2HP1A 5DB5A 2WK8A 4MY5A 1ARTA 1SF2A 2CSTA 5G4JA 3BCXA 3BCBA 3MAFB 4OCAA 3FDDA 2DR1A 5FT5A 1AKAA 5G0AA 4NOGA 1W3UA 1KKJA 1AAMA 1BQAA 1U08A 3CQ6A 1GC4A 2W7JA 1OHWA 2W7KA 3EI5A 4K2BA 2DKJA 1E5FA 2CY8A 3H14A 3AENA 4LNMA 3F0HA 5D95A 1TATA 2HORA 2FNUA 3BWOA 3PAAA 3QM2A 3A2BA 8AATA 4FFCA 4MQRA 2FYFA 2Z67A 3JTXA 1W7NA 3DZZA 2BI5A 4WYDA 1TOKA 1MDXA 3CQ4A 1QZ9A 3BWNC 3JWBA 3EIBA 4CXQA 1FG7A 3IHJA 3RCHB 5G09A 3AOVA 3ZZJA 3N4XA 3AEJA 4WB0B 4L0OA 2RFVA 2EH6A 1G4VA 2WKAA 4CBSA 4ZASA 3EZ1A 2VI9A 3WGCA 3PD6B 1AHEA 3F9TA 2BYLA 4EFFA 2VMTA 3NDNA 1DGEA 4GRXA 3AV7A 4UHNA 1IX7A 2QLRA 1WYTB 3DR7A 3GZCA 2DKBA 3QPGA 4OC9A 1WYUB 3TQXA 2VLFA 4IYOA 1V2FA 2BWNA 4R5ZA 2OATA 1SVVA 4RJ0A 3NUIA 4TV7A 1TOJA 2VMZA 4HVKA 1H1CA 3FQAA 4R8DA 2HUUA 1Z3ZA 2AY7A 3FVUA 2E7UA 2CANA 1JG8A 1MAPA 2VGZA 2VI8A 3FCRA 1UKJA 1TOGA 4RITA 4Y0HA 5G4IA 3ATHA 1AJRA 2ORDA 1W23A 3D6KA 2W8JA 4TN4A 4UHMA 4AZJA 4CVQA 3GETA 2ZJGA 5JAYA 2AY9A 4WXFA 1JS6A 3FQ8A 1C7OA 3MBBA 4O6ZA 3ZRPA 5M49A 2BIEA 3BWNA 4F5GA 3FZ6A 3K7YA 1YIYA 3EI7A 2PO3A 2Z9UA 3Q8NA 3HMUA 1LW4A 3BN1A 3G8MA 1AMAA 3KGWA 4GDYA 4A6TA 4W5KA 4KYOA 1RVUA 5DX5A 1IAXA 2QA3A 2PB0A 3DXWA 1C7GA 1C7NA 1VJOA 4KXKA 3H9XA 1O4SA 2AY8A 2HUFA 2VGVA 4F5KA 3BV0A 1WYVA 3DXVA 4UQVA 2E54A 4XQ2A 2GB3A 3B1EA 1Z7DA 3KE3A 1CS1A 1G7XA 2QBTA 2CFBA 3NX3A 4DBCA 1AJSA 1I41A 5E4ZA 1QITA 1UU1A 1ASBA 4LC3A 1GC0A 1FG3A 1IAYA 1IJIA 2Z9VA 3CBFA 3ELEA 3FDBA 3ISLA 4WYAA 1BJOA 5EUNA 2CH1A 2QB3A 2Z9WA 1QISA 1AHGA 3GR9A 3NYSA 4Y0DA 2GQNA 1AMQA 4K2MA 1S0AA 1EJIA 4R2NA 2VMYA 4N0WA 1WSTA 1G4XA 2CINA 2QMAA 4ZM4A 3WKSA 1M0PA 1TARA 2C7TA 2XBNA 3JWAA 1MLYA 4R5FA 1S06A 3A9XA 3AEMA 4HF8A 2VMOA 3EIAA 1TPLA 4IW7A 3LG0A 4XJOA 2CJHA 3VK2A 4ITGA 1AHXA 2F8JA 2D61A 4E3QA 2R5CB 1B5OA 4XK1A 4BHDA 3HL2A 3L44A 4RJYA 2BI1A 4GEBA 3LY1A 4JEVA 3NRAA 2ZC0A 3VOMA 1JF9A 3KKIA 4LW4A 4A0FA 1KAFA 2HOXA 4RM1A 2FQ6A 1SPAA 3B46A 1KMJA 2ZSMA 2KFPA 2VMRA 1O61A 1AHFA 2WK9A 2YKXA 3AOWA 3GSBA 3II0A 3TFTA 3GZDA 1AY5A 1V2DA 3BS8A 1CQ6A 1B5PA 3I16A 1UU2A 1V2EA 4E1OA 2R2NA 2HUIA 2DGLA 4E3RA 1O62A 4CXRA 3PIUA 3UAKA 3E77A 3G7QA 2W7EA 4WP0A 3B8XA 3ELPA 3CQ5A 4B9BA 3DU4A 1QJ5A 2VMWA 2G7JA 1ASGA 3RCHA 4OMAA 2Z9XA 2VMSA 4TMRA 3RBLA 1IBJA 2OKJA 3B1CA 1CZCA 2YKUA 2YCNA 1KL1A 2JGTA 3E2ZB 5C6UA 3I5TA 3LV2A 2QB2A 3PPLA 2JISA 5DJ9A 4AOAA 2EPJA 2W7FA 4K05A 1LS3A 5HDMA 2CB1A 2VIBA 2X3LA 5FT8A 4F5FA 4ITXA 2CJDA 3W1HA 4A0RA 3MAUA 3MKJA 4RLGA 1N8PA 3NYUA 4M2JA 3MC6C 4WB0A 3N0LA 1DGDA 1MLZA 2AEVA 2FM1A 3GWPA 3RBFA 5G2PA 1UU0A 3WLXA 2AATA 3FTBA 2GSAA 2X8UA 1AKCA 1ASFA 1RV4A 3LVMA 4MKKA 1GBNA 1SFFA 3HLMA 2YKVA 4IXZA 3HT4A 4OBUA 4AO4A 4B98A 2CTZA 2AEUA 4M2MA 1N2TA 1LC8A 1X0MA 2VGWA 2E7JA 2EO5A 4ZSWA 2VGSA 4A00A 2JG2A 3N4RA 1AIAA 1O69A 1SZSA 3AEOA 3MC6A 4ZWVA 2VMNA 5EQCA 3VAXA 1D2FA 3LVLB 5DJ1A 1AMSA 4WLJA 4ZDPA 1E5EA 1CL1A 2R5EA 2YKYA 1YAAA 2NMPA 3E9KA 2JJGA 5FT6A 1X29A 2VMVA 2ZUKA 2D64A 2BIGA 4RAEA 1D7UA 1ARIA 3IF2A 4WYGA 2O0RA 2VIAA 4GE9A 4ADDA 5EUEA 1S08A 1Y4IA 4ATPA 4PFFA 4XJLA 4WXBA 2HZPA 2AY1A 2HOZA 4ZLVA 1IUGA 2ZP7A 1BJWA 2X5DA 3RUYA 4GSAA 2W7DA 2AY2A 2VMXA 2JJFA 3OKSA 4Q76A 3HDOA 4UHOA 3DYDA 5F9SA 3DR4A 1QJ3A 7AATA 1YJSA 1GEWA 2C81A 3VK4A 2AY4A 5EAVA 5HXXA 1X28A 3PDBA 1GC2A 4IXSA 4JEYA 4A6RA 3P6KA 2ZY4A 1PMMA 2W7HA 1LKCA 1M4NA 2BWOA 2WB6A 1C4KA 1SZKA 5EAAA 1GD9A 1BJ4A 3ACZA 2Z61A 2BWPA 2W8WA 3H7FA 2W8TA 2D63A 2OQXA 4WBTA 3T32A 4AH3A 2V0YA 1M6SA 3G0TA 3HQTA 4IYOB 3AEPA 3DC1A 5M46A 2PB2A 4UOYA 3VP6A 2D65A 4BMKA 1IVRA 1DJEA 1YJZA 1OXPA 1ARGA 2W8UA 2YOBA 1PFFA 3FZ7A 3FVXA 1IX8A 4RKCA 1LC5A 2AY5A 3ZZKA 2YHKA 2O1BA 3EI9A 4W1WA 1ORDA 5LH9A 1JS3A 3GBXA 4E77A 1T3IA 4BQ0A 3LWSA 2BI2A 1ECXA 4JEWA 4M2KA 4ZAHA 2EZ1A 3UWCA 1ZOBA 4PFNA 5E5IA 1RV3A 1WKGA 2VLHA 5EIGB 1VEFA 3BCAA 1DTYA 3COGA 3R4TA 2YRIA 4MSOA 5FT4A 1PG8A 3N5MA 1LK9A 1ZC9A 1AMRA 1B9HA 4RKDA 3QN6A 3OP7A 3I4JA 1BJNA 2VMUA 3NYTA 5EUDA 2G6WA 3DODA 4U1TA 2R5CA 3QBOA 2XH1A 5AX8A 4WYEA 1WKHA 5K8BA 3NUBA 1BW0A 1DJUA 1ASMA 1YJYA 5D5SA 1S09A 4XEWA 1AICA 2YCTA 1AHYA 2Z1YA 3GZDC 2VYCA 3ZRRA 2D7YA 1AKBA 3FZ8A 1LC7A 1QIRA 3WKRA 4F5JA 4OYTA 4IX8A 3MEBA 2BI9A 5I92A 3TATA 2W8VA 1MGVA 4CBRA 4BA4A 3PDXA 4XJMA 3A9ZA 1FC4A 2TPLA 1AIBA 2VGTA 5KTBA 5BJ4A 1G7WA 1J04A 2ZSLA 1DFOA 4ZWMA 3TFUA 3W1IA 4W91A 1ASDA 3WZFA 4ZM3A 5LHAA 1AJSB 4ISYA 1KMKA 3MADA 1LW5A 4Q6RA 1CQ7A 2BKWA 4JF1A 5E3KA 1BS0A 3K40A 3L8AA 2D5YA 4JE5D 5M4BA 4I8AA 1C0NA 3AENB 2BYJA 3FFRA 1AY8A 4ADCA 1BQDA 3FFHA 3JU7A 3JW9A 3MAFA 3USFA 1YNUA 3N75A 1GDEA 1H0CA 1P3WA 1GC3A 2DGMA 3PD6A 4QGRA 2FNIA 2JJEA 2O7CA 9AATA 1ASEA 4MQQA 1IX6A 5BJ3A 4EU1A 2A1VA 4FL0A 4GE7A 2VMPA 4XAUA 1W7MA 4MKJA 1J32A 1ELUA 4DQ6A 1ARHA 1CQ8A 3NNKA 1B4XA 4MGRA 2W7MA 1BKGA 2ZY3A 1XEYA 2ZYJA 2BHXA 2R0TA 4ZSYA 2CH2A 1AAWA 4ADBA 4ATQA 2OKKA 1I43A 2HOYA 2DGKA 4JE5A 2EZ2A 2W7IA 3N4SA 3E2YA 1OXOA 3K28A 1BJOB 2CJGA 4A72A 2DOUA 2YRRA 4GE4A 4PVFA 1TOIA 1B8GA 4PIWA 4A6UA 3KGXA 2ZY5A 1AY4A 2W7GA 3ASAA 1N31A 4AZKA 1B9IA 3AEJC 4JF0A 4Y0IA 4H51A 4MQPA 2HP2A 2VMQA 3NU8A 3QI6A 2Q7WA 5HHYA 1WYUA 1X2AA 1ZODA 4EB7A 4F5IA 4LNLA 3HBXA 3B1DA 4J5UA 1ASLA 2Z1ZA 4N0BA 1OATA 3FD0A 3WCNA 1D7RA 4RIZA 5J8QA 4F5HA 3EZSA 2C44A 4A0GA 4EB5A 1MDZA 4W1VA 3ECDA 1S07A 2WK7A 3WCOA 3F6TA 4KAMA 1I29A 3A9YA 2W7LA 5IWQA 4XJPA 2D66A 3WY7A 3AEMC 3ZRQA 1AX4A 1GCKA 1OHYA 2YCPA 3NU7A 4F4EA 3PDBB 3FQ7A 3PJ0A 3TCMA 1EG5A 4IXOA 1YIZA 2X5FA 2AY6A 1MAQA 4J8LA 4Q31A 2GMSA 2OGEA 3UE8A 1M0NA 4LNJA 4H63Q 4W1XA 3VK3A 1M32A 4ADEA 4W8IA 4OTLA 2EGYA 5M4DA 4IY7A 2FKIA 4LW2A 1PMOA 1KL2A 2E7IA 1BT4A 3CAIA 1MDOA 3LVJA 3E6GA 4OBVA 1TOEA 3M5UA 3BB8A 5TF5A 3FRKA 4JEXA 2AY3A 1ELQA 1CZEA 3PGYA 2VGUA 2Z20A 3EI6A 3EUCA 3PA9A 4P3MA 4OT8A 3N7NA 3WX9A 1WYVB 1OHVA 4K2IA 3EI8A 3AATA 4ZDLA 4F5MA 1ARSA 2OGAA 1ASAA 3LVKA 3R9AA 4P7YA 3FKDA 1TASA 1WYTA 3E2ZA 2V1PA 4Q75A 5G2QA 2BI3A 4WLHA 1GEYA 4U2HA 1M7YA 3FVSA 3WGBA
chains in the Genus database with same CATH topology
4JEZA 1SZUA 3P1TA 4WYCA 2QSRA 4WD2A 3E2FA 1XI9A 3ASBA 4WYFA 3AELA 1DJ9A 3NTJA 3A8UX 5EFSA 4A0HA 1W7LA 2BIAA 4DGTA 4WXGA 1D7SA 4F5LA 1ASCA 1I48A 5EIGA 1C9CA 1EQBA 2C0RA 3FSLA 1CL2A 2ZY2A 1M0OA 2FN6A 4EMYA 3QHXA 1RVYA 2EYQA 2D7ZA 1ASNA 1QGNA 3JZLA 3DRDA 2JJHA 3BC8A 4ZDOA 5F8VA 1M0QA 1V72A 1DKAA 1D7VA 4AO9A 3QGUA 4BA5A 1GEXA 2GMUA 3HVYA 1VP4A 1YOOA 3RQ1A 3W1JA 1CJ0A 1KKPA 3GJUA 3RI6A 2HP1A 5DB5A 2WK8A 4MY5A 1ARTA 1SF2A 2CSTA 5G4JA 3BCXA 3BCBA 3MAFB 4OCAA 3FDDA 2DR1A 5FT5A 1AKAA 5G0AA 4NOGA 1W3UA 1KKJA 1AAMA 1BQAA 1U08A 3CQ6A 1GC4A 2W7JA 1OHWA 2W7KA 3EI5A 4K2BA 2DKJA 1E5FA 2CY8A 3H14A 3AENA 4LNMA 3F0HA 5D95A 1TATA 2HORA 2FNUA 3BWOA 3PAAA 3QM2A 3A2BA 8AATA 4FFCA 4MQRA 2FYFA 2Z67A 3JTXA 1W7NA 3DZZA 2BI5A 4WYDA 1TOKA 1MDXA 3CQ4A 1QZ9A 3BWNC 3JWBA 3EIBA 4CXQA 1FG7A 3IHJA 3RCHB 5G09A 3AOVA 3ZZJA 3N4XA 3AEJA 4WB0B 4L0OA 2RFVA 2EH6A 1G4VA 2WKAA 4CBSA 4ZASA 3EZ1A 2VI9A 3WGCA 3PD6B 1AHEA 3F9TA 2BYLA 4EFFA 2VMTA 3NDNA 1DGEA 4GRXA 3AV7A 4UHNA 1IX7A 2QLRA 1WYTB 3DR7A 3GZCA 2DKBA 3QPGA 4OC9A 1WYUB 3TQXA 2VLFA 4IYOA 1V2FA 2BWNA 4R5ZA 2OATA 1SVVA 4RJ0A 3NUIA 4TV7A 1TOJA 2VMZA 4HVKA 1H1CA 3FQAA 4R8DA 2HUUA 1Z3ZA 2AY7A 3FVUA 2E7UA 2CANA 1JG8A 1MAPA 2VGZA 2VI8A 3FCRA 1UKJA 1TOGA 4RITA 4Y0HA 5G4IA 3ATHA 1AJRA 2ORDA 1W23A 3D6KA 2W8JA 4TN4A 4UHMA 4AZJA 4CVQA 3GETA 2ZJGA 5JAYA 2AY9A 4WXFA 1JS6A 3FQ8A 1C7OA 3MBBA 4O6ZA 3ZRPA 5M49A 2BIEA 3BWNA 4F5GA 3FZ6A 3K7YA 1YIYA 3EI7A 2PO3A 2Z9UA 3Q8NA 3HMUA 1LW4A 3BN1A 3G8MA 1AMAA 3KGWA 4GDYA 4A6TA 4W5KA 4KYOA 1RVUA 5DX5A 1IAXA 2QA3A 2PB0A 3DXWA 1C7GA 1C7NA 1VJOA 4KXKA 3H9XA 1O4SA 2AY8A 2HUFA 2VGVA 4F5KA 3BV0A 1WYVA 3DXVA 4UQVA 2E54A 4XQ2A 2GB3A 3B1EA 1Z7DA 3KE3A 1CS1A 1G7XA 2QBTA 2CFBA 3NX3A 4DBCA 1AJSA 1I41A 5E4ZA 1QITA 1UU1A 1ASBA 4LC3A 1GC0A 1FG3A 1IAYA 1IJIA 2Z9VA 3CBFA 3ELEA 3FDBA 3ISLA 4WYAA 1BJOA 5EUNA 2CH1A 2QB3A 2Z9WA 1QISA 1AHGA 3GR9A 3NYSA 4Y0DA 2GQNA 1AMQA 4K2MA 1S0AA 1EJIA 4R2NA 2VMYA 4N0WA 1WSTA 1G4XA 2CINA 2QMAA 4ZM4A 3WKSA 1M0PA 1TARA 2C7TA 2XBNA 3JWAA 1MLYA 4R5FA 1S06A 3A9XA 3AEMA 4HF8A 2VMOA 3EIAA 1TPLA 4IW7A 3LG0A 4XJOA 2CJHA 3VK2A 4ITGA 1AHXA 2F8JA 2D61A 4E3QA 2R5CB 1B5OA 4XK1A 4BHDA 3HL2A 3L44A 4RJYA 2BI1A 4GEBA 3LY1A 4JEVA 3NRAA 2ZC0A 3VOMA 1JF9A 3KKIA 4LW4A 4A0FA 2HOXA 4RM1A 2FQ6A 1SPAA 3B46A 1KMJA 2ZSMA 2KFPA 2VMRA 1O61A 1AHFA 2WK9A 2YKXA 3AOWA 3GSBA 3II0A 3TFTA 3GZDA 1AY5A 1V2DA 3BS8A 1CQ6A 1B5PA 3I16A 1UU2A 1V2EA 4E1OA 2R2NA 2HUIA 2DGLA 4E3RA 1O62A 4CXRA 3PIUA 3UAKA 3E77A 3G7QA 2W7EA 4WP0A 3B8XA 3ELPA 3CQ5A 4B9BA 3DU4A 1QJ5A 2VMWA 2G7JA 1ASGA 3RCHA 4OMAA 2Z9XA 2VMSA 4TMRA 3RBLA 1IBJA 2OKJA 3B1CA 1CZCA 2YKUA 2YCNA 1KL1A 2JGTA 3E2ZB 5C6UA 3I5TA 3LV2A 2QB2A 3PPLA 2JISA 5DJ9A 4AOAA 2EPJA 2W7FA 4K05A 1LS3A 5HDMA 2CB1A 2VIBA 2X3LA 5FT8A 4F5FA 4ITXA 2CJDA 3W1HA 4A0RA 3MAUA 3MKJA 4RLGA 1N8PA 3NYUA 4M2JA 3MC6C 4WB0A 3N0LA 1DGDA 1MLZA 2AEVA 2FM1A 3GWPA 3RBFA 5G2PA 1UU0A 3WLXA 2AATA 3FTBA 2GSAA 2X8UA 1AKCA 1ASFA 1RV4A 3LVMA 4MKKA 1GBNA 1SFFA 3HLMA 2YKVA 4IXZA 3HT4A 4OBUA 4AO4A 4B98A 2CTZA 2AEUA 4M2MA 1N2TA 1LC8A 1X0MA 2VGWA 2E7JA 2EO5A 4ZSWA 2VGSA 4A00A 2JG2A 3N4RA 1AIAA 1O69A 1SZSA 3AEOA 3MC6A 4ZWVA 2VMNA 5EQCA 3VAXA 1D2FA 3LVLB 5DJ1A 1AMSA 4WLJA 4ZDPA 1E5EA 1CL1A 2R5EA 2YKYA 1YAAA 2NMPA 3E9KA 2JJGA 5FT6A 1X29A 2VMVA 2ZUKA 2D64A 2BIGA 4RAEA 1D7UA 1ARIA 3IF2A 4WYGA 2O0RA 2VIAA 4GE9A 4ADDA 5EUEA 1S08A 1Y4IA 4ATPA 4PFFA 4XJLA 4WXBA 2HZPA 2AY1A 2HOZA 4ZLVA 1IUGA 2ZP7A 1BJWA 2X5DA 3RUYA 4GSAA 2W7DA 2AY2A 2VMXA 2JJFA 3OKSA 4Q76A 3HDOA 4UHOA 3DYDA 5F9SA 3DR4A 1QJ3A 7AATA 1YJSA 1GEWA 2C81A 3VK4A 2AY4A 5EAVA 5HXXA 1X28A 3PDBA 1GC2A 4IXSA 4JEYA 4A6RA 3P6KA 2ZY4A 1PMMA 2W7HA 1LKCA 1M4NA 2BWOA 2WB6A 1C4KA 1SZKA 5EAAA 1GD9A 1BJ4A 3ACZA 2Z61A 2BWPA 2W8WA 3H7FA 2W8TA 2D63A 2OQXA 4WBTA 3T32A 4AH3A 2V0YA 1M6SA 3G0TA 3HQTA 4IYOB 3AEPA 3DC1A 5M46A 2PB2A 4UOYA 3VP6A 2D65A 4BMKA 1IVRA 1DJEA 1YJZA 1OXPA 1ARGA 2W8UA 2YOBA 1PFFA 3FZ7A 3FVXA 1IX8A 4RKCA 1LC5A 2AY5A 3ZZKA 2YHKA 2O1BA 3EI9A 4W1WA 1ORDA 5LH9A 1JS3A 3GBXA 4E77A 1T3IA 4BQ0A 3LWSA 2BI2A 1ECXA 4JEWA 4M2KA 4ZAHA 2EZ1A 3UWCA 1ZOBA 4PFNA 5E5IA 1RV3A 1WKGA 2VLHA 5EIGB 1VEFA 3BCAA 1DTYA 3COGA 3R4TA 2YRIA 4MSOA 5FT4A 1PG8A 3N5MA 1LK9A 1ZC9A 1AMRA 1B9HA 4RKDA 3QN6A 3OP7A 3I4JA 1BJNA 2VMUA 3NYTA 5EUDA 2G6WA 3DODA 4U1TA 2R5CA 3QBOA 2XH1A 5AX8A 4WYEA 1WKHA 5K8BA 3NUBA 1BW0A 1DJUA 1ASMA 1YJYA 5D5SA 1S09A 4XEWA 1AICA 2YCTA 1AHYA 2Z1YA 3GZDC 2VYCA 3ZRRA 2D7YA 1AKBA 3FZ8A 1LC7A 1QIRA 3WKRA 4F5JA 4OYTA 4IX8A 3MEBA 2BI9A 5I92A 3TATA 2W8VA 1MGVA 4CBRA 4BA4A 3PDXA 4XJMA 3A9ZA 1FC4A 2TPLA 1AIBA 2VGTA 5KTBA 5BJ4A 1G7WA 1J04A 2ZSLA 1DFOA 4ZWMA 3TFUA 3W1IA 4W91A 1ASDA 3WZFA 4ZM3A 5LHAA 1AJSB 4ISYA 1KMKA 3MADA 1LW5A 4Q6RA 1CQ7A 2BKWA 4JF1A 5E3KA 1BS0A 3K40A 3L8AA 2D5YA 4JE5D 5M4BA 4I8AA 1C0NA 3AENB 2BYJA 3FFRA 1AY8A 4ADCA 1BQDA 3FFHA 3JU7A 3JW9A 3MAFA 3USFA 1YNUA 3N75A 1GDEA 1H0CA 1P3WA 1GC3A 2DGMA 3PD6A 4QGRA 2FNIA 2JJEA 2O7CA 9AATA 1ASEA 4MQQA 1IX6A 5BJ3A 4EU1A 2A1VA 4FL0A 4GE7A 2VMPA 4XAUA 1W7MA 4MKJA 1J32A 1ELUA 4DQ6A 1ARHA 1CQ8A 3NNKA 1B4XA 4MGRA 2W7MA 1BKGA 2ZY3A 1XEYA 2ZYJA 2BHXA 2R0TA 4ZSYA 2CH2A 1AAWA 4ADBA 4ATQA 2OKKA 1I43A 2HOYA 2DGKA 4JE5A 2EZ2A 2W7IA 3N4SA 3E2YA 1OXOA 3K28A 1BJOB 2CJGA 4A72A 2DOUA 2YRRA 4GE4A 4PVFA 1TOIA 1B8GA 4PIWA 4A6UA 3KGXA 2ZY5A 1AY4A 2W7GA 3ASAA 1N31A 4AZKA 1B9IA 3AEJC 4JF0A 4Y0IA 4H51A 4MQPA 2HP2A 2VMQA 3NU8A 3QI6A 2Q7WA 5HHYA 1WYUA 1X2AA 1ZODA 4EB7A 4F5IA 4LNLA 3HBXA 3B1DA 4J5UA 1ASLA 2Z1ZA 4N0BA 1OATA 3FD0A 3WCNA 1D7RA 4RIZA 5J8QA 4F5HA 3EZSA 2C44A 4A0GA 4EB5A 1MDZA 4W1VA 3ECDA 1S07A 2WK7A 3WCOA 3F6TA 4KAMA 1I29A 3A9YA 2W7LA 5IWQA 4XJPA 2D66A 3WY7A 3AEMC 3ZRQA 1AX4A 1GCKA 1OHYA 2YCPA 3NU7A 4F4EA 3PDBB 3FQ7A 3PJ0A 3TCMA 1EG5A 4IXOA 1YIZA 2X5FA 2AY6A 1MAQA 4J8LA 4Q31A 2GMSA 2OGEA 3UE8A 1M0NA 4LNJA 4H63Q 4W1XA 3VK3A 1M32A 4ADEA 4W8IA 4OTLA 2EGYA 5M4DA 4IY7A 2FKIA 4LW2A 1PMOA 1KL2A 2E7IA 1BT4A 3CAIA 1MDOA 3LVJA 3E6GA 4OBVA 1TOEA 3M5UA 3BB8A 5TF5A 3FRKA 4JEXA 2AY3A 1ELQA 1CZEA 3PGYA 2VGUA 2Z20A 3EI6A 3EUCA 3PA9A 4P3MA 4OT8A 3N7NA 3WX9A 1WYVB 1OHVA 4K2IA 3EI8A 3AATA 4ZDLA 4F5MA 1ARSA 2OGAA 1ASAA 3LVKA 3R9AA 4P7YA 3FKDA 1TASA 1WYTA 3E2ZA 2V1PA 4Q75A 5G2QA 2BI3A 4WLHA 1GEYA 4U2HA 1M7YA 3FVSA 3WGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEZ A;  1SZU A;  3P1T A;  4WYC A;  4WD2 A;  3E2F A;  1XI9 A;  3ASB A;  4WYF A;  3AEL A;  1DJ9 A;  3NTJ A;  3A8U X;  5EFS A;  4A0H A;  1W7L A;  2BIA A;  4DGT A;  4WXG A;  1D7S A;  4F5L A;  1ASC A;  1I48 A;  5EIG A;  1C9C A;  1EQB A;  2C0R A;  3FSL A;  1CL2 A;  2ZY2 A;  1M0O A;  2FN6 A;  4EMY A;  3QHX A;  1RVY A;  2D7Z A;  1ASN A;  1QGN A;  3JZL A;  3DRD A;  2JJH A;  3BC8 A;  4ZDO A;  5F8V A;  1M0Q A;  1V72 A;  1DKA A;  1D7V A;  4AO9 A;  3QGU A;  4BA5 A;  1GEX A;  2GMU A;  3HVY A;  1VP4 A;  1YOO A;  3RQ1 A;  3W1J A;  1CJ0 A;  1KKP A;  3GJU A;  3RI6 A;  2HP1 A;  5DB5 A;  2WK8 A;  4MY5 A;  1ART A;  1SF2 A;  2CST A;  5G4J A;  3BCX A;  3BCB A;  3MAF B;  4OCA A;  3FDD A;  2DR1 A;  5FT5 A;  1AKA A;  5G0A A;  4NOG A;  1W3U A;  1KKJ A;  1AAM A;  1BQA A;  1U08 A;  3CQ6 A;  1GC4 A;  2W7J A;  1OHW A;  2W7K A;  3EI5 A;  4K2B A;  2DKJ A;  1E5F A;  2CY8 A;  3H14 A;  3AEN A;  4LNM A;  3F0H A;  5D95 A;  1TAT A;  2HOR A;  2FNU A;  3BWO A;  3PAA A;  3QM2 A;  3A2B A;  8AAT A;  4FFC A;  4MQR A;  2FYF A;  2Z67 A;  3JTX A;  1W7N A;  3DZZ A;  2BI5 A;  4WYD A;  1TOK A;  1MDX A;  3CQ4 A;  1QZ9 A;  3BWN C;  3JWB A;  3EIB A;  4CXQ A;  1FG7 A;  3IHJ A;  3RCH B;  5G09 A;  3AOV A;  3ZZJ A;  3AEJ A;  4WB0 B;  4L0O A;  2RFV A;  2EH6 A;  1G4V A;  2WKA A;  4CBS A;  4ZAS A;  3EZ1 A;  2VI9 A;  3WGC A;  3PD6 B;  1AHE A;  3F9T A;  2BYL A;  4EFF A;  2VMT A;  3NDN A;  1DGE A;  4GRX A;  3AV7 A;  4UHN A;  1IX7 A;  2QLR A;  1WYT B;  3DR7 A;  3GZC A;  2DKB A;  3QPG A;  4OC9 A;  1WYU B;  3TQX A;  2VLF A;  4IYO A;  1V2F A;  2BWN A;  4R5Z A;  2OAT A;  1SVV A;  4RJ0 A;  3NUI A;  4TV7 A;  1TOJ A;  2VMZ A;  4HVK A;  1H1C A;  3FQA A;  4R8D A;  2HUU A;  1Z3Z A;  2AY7 A;  3FVU A;  2E7U A;  2CAN A;  1JG8 A;  1MAP A;  2VGZ A;  2VI8 A;  3FCR A;  1UKJ A;  1TOG A;  4RIT A;  4Y0H A;  5G4I A;  3ATH A;  1AJR A;  2ORD A;  1W23 A;  3D6K A;  2W8J A;  4TN4 A;  4UHM A;  4AZJ A;  4CVQ A;  3GET A;  2ZJG A;  5JAY A;  2AY9 A;  4WXF A;  1JS6 A;  3FQ8 A;  1C7O A;  3MBB A;  4O6Z A;  3ZRP A;  5M49 A;  2BIE A;  3BWN A;  4F5G A;  3FZ6 A;  3K7Y A;  1YIY A;  3EI7 A;  2PO3 A;  2Z9U A;  3Q8N A;  3HMU A;  1LW4 A;  3BN1 A;  3G8M A;  1AMA A;  3KGW A;  4GDY A;  4A6T A;  4W5K A;  4KYO A;  1RVU A;  5DX5 A;  1IAX A;  2QA3 A;  2PB0 A;  3DXW A;  1C7G A;  1C7N A;  1VJO A;  4KXK A;  1O4S A;  2AY8 A;  2HUF A;  2VGV A;  4F5K A;  3BV0 A;  1WYV A;  3DXV A;  4UQV A;  2E54 A;  4XQ2 A;  2GB3 A;  3B1E A;  1Z7D A;  3KE3 A;  1CS1 A;  1G7X A;  2QBT A;  2CFB A;  3NX3 A;  4DBC A;  1AJS A;  1I41 A;  5E4Z A;  1QIT A;  1UU1 A;  1ASB A;  4LC3 A;  1GC0 A;  1FG3 A;  1IAY A;  1IJI A;  2Z9V A;  3CBF A;  3ELE A;  3FDB A;  3ISL A;  4WYA A;  1BJO A;  5EUN A;  2CH1 A;  2QB3 A;  2Z9W A;  1QIS A;  1AHG A;  3GR9 A;  3NYS A;  4Y0D A;  2GQN A;  1AMQ A;  4K2M A;  1S0A A;  1EJI A;  4R2N A;  2VMY A;  4N0W A;  1WST A;  1G4X A;  2CIN A;  2QMA A;  4ZM4 A;  3WKS A;  1M0P A;  1TAR A;  2C7T A;  2XBN A;  3JWA A;  1MLY A;  4R5F A;  1S06 A;  3A9X A;  3AEM A;  4HF8 A;  2VMO A;  3EIA A;  1TPL A;  4IW7 A;  3LG0 A;  4XJO A;  2CJH A;  3VK2 A;  4ITG A;  1AHX A;  2F8J A;  2D61 A;  4E3Q A;  2R5C B;  1B5O A;  4XK1 A;  4BHD A;  3HL2 A;  3L44 A;  4RJY A;  2BI1 A;  4GEB A;  3LY1 A;  4JEV A;  3NRA A;  2ZC0 A;  3VOM A;  1JF9 A;  3KKI A;  4LW4 A;  4A0F A;  2HOX A;  4RM1 A;  2FQ6 A;  1SPA A;  3B46 A;  1KMJ A;  2ZSM A;  2VMR A;  1O61 A;  1AHF A;  2WK9 A;  2YKX A;  3AOW A;  3GSB A;  3II0 A;  3TFT A;  3GZD A;  1AY5 A;  1V2D A;  3BS8 A;  1CQ6 A;  1B5P A;  3I16 A;  1UU2 A;  1V2E A;  4E1O A;  2R2N A;  2HUI A;  2DGL A;  4E3R A;  1O62 A;  4CXR A;  3PIU A;  3UAK A;  3E77 A;  3G7Q A;  2W7E A;  4WP0 A;  3B8X A;  3ELP A;  3CQ5 A;  4B9B A;  3DU4 A;  1QJ5 A;  2VMW A;  1ASG A;  3RCH A;  4OMA A;  2Z9X A;  2VMS A;  4TMR A;  3RBL A;  1IBJ A;  2OKJ A;  3B1C A;  1CZC A;  2YKU A;  2YCN A;  1KL1 A;  2JGT A;  3E2Z B;  5C6U A;  3I5T A;  3LV2 A;  2QB2 A;  3PPL A;  2JIS A;  5DJ9 A;  4AOA A;  2EPJ A;  2W7F A;  1LS3 A;  5HDM A;  2CB1 A;  2VIB A;  2X3L A;  5FT8 A;  4F5F A;  4ITX A;  2CJD A;  3W1H A;  4A0R A;  3MAU A;  3MKJ A;  4RLG A;  1N8P A;  3NYU A;  4M2J A;  3MC6 C;  4WB0 A;  3N0L A;  1DGD A;  1MLZ A;  2AEV A;  2FM1 A;  3GWP A;  3RBF A;  5G2P A;  1UU0 A;  3WLX A;  2AAT A;  3FTB A;  2GSA A;  2X8U A;  1AKC A;  1ASF A;  1RV4 A;  3LVM A;  4MKK A;  1GBN A;  1SFF A;  3HLM A;  2YKV A;  4IXZ A;  3HT4 A;  4OBU A;  4AO4 A;  4B98 A;  2CTZ A;  2AEU A;  4M2M A;  1N2T A;  1LC8 A;  1X0M A;  2VGW A;  2E7J A;  2EO5 A;  4ZSW A;  2VGS A;  4A00 A;  2JG2 A;  1AIA A;  1O69 A;  1SZS A;  3AEO A;  3MC6 A;  4ZWV A;  2VMN A;  5EQC A;  3VAX A;  1D2F A;  3LVL B;  5DJ1 A;  1AMS A;  4WLJ A;  4ZDP A;  1E5E A;  1CL1 A;  2R5E A;  2YKY A;  1YAA A;  2NMP A;  3E9K A;  2JJG A;  5FT6 A;  1X29 A;  2VMV A;  2ZUK A;  2D64 A;  2BIG A;  4RAE A;  1D7U A;  1ARI A;  3IF2 A;  4WYG A;  2O0R A;  2VIA A;  4GE9 A;  4ADD A;  5EUE A;  1S08 A;  1Y4I A;  4ATP A;  4PFF A;  4XJL A;  4WXB A;  2HZP A;  2AY1 A;  2HOZ A;  4ZLV A;  1IUG A;  2ZP7 A;  1BJW A;  2X5D A;  3RUY A;  4GSA A;  2W7D A;  2AY2 A;  2VMX A;  2JJF A;  3OKS A;  4Q76 A;  3HDO A;  4UHO A;  3DYD A;  5F9S A;  3DR4 A;  1QJ3 A;  7AAT A;  1YJS A;  1GEW A;  2C81 A;  3VK4 A;  2AY4 A;  5EAV A;  5HXX A;  1X28 A;  3PDB A;  1GC2 A;  4IXS A;  4JEY A;  4A6R A;  3P6K A;  2ZY4 A;  1PMM A;  2W7H A;  1LKC A;  1M4N A;  2BWO A;  1C4K A;  1SZK A;  5EAA A;  1GD9 A;  1BJ4 A;  3ACZ A;  2Z61 A;  2BWP A;  2W8W A;  3H7F A;  2W8T A;  2D63 A;  2OQX A;  4WBT A;  3T32 A;  4AH3 A;  2V0Y A;  1M6S A;  3G0T A;  3HQT A;  4IYO B;  3AEP A;  3DC1 A;  5M46 A;  2PB2 A;  4UOY A;  3VP6 A;  2D65 A;  4BMK A;  1IVR A;  1DJE A;  1YJZ A;  1OXP A;  1ARG A;  2W8U A;  2YOB A;  1PFF A;  3FZ7 A;  3FVX A;  1IX8 A;  4RKC A;  1LC5 A;  2AY5 A;  3ZZK A;  2YHK A;  2O1B A;  3EI9 A;  4W1W A;  1ORD A;  5LH9 A;  1JS3 A;  3GBX A;  4E77 A;  1T3I A;  4BQ0 A;  3LWS A;  2BI2 A;  1ECX A;  4JEW A;  4M2K A;  4ZAH A;  2EZ1 A;  3UWC A;  1ZOB A;  4PFN A;  5E5I A;  1RV3 A;  1WKG A;  2VLH A;  5EIG B;  1VEF A;  3BCA A;  1DTY A;  3COG A;  3R4T A;  2YRI A;  4MSO A;  5FT4 A;  1PG8 A;  3N5M A;  1LK9 A;  1ZC9 A;  1AMR A;  1B9H A;  4RKD A;  3QN6 A;  3OP7 A;  3I4J A;  1BJN A;  2VMU A;  3NYT A;  5EUD A;  2G6W A;  3DOD A;  4U1T A;  2R5C A;  3QBO A;  2XH1 A;  5AX8 A;  4WYE A;  1WKH A;  5K8B A;  3NUB A;  1BW0 A;  1DJU A;  1ASM A;  1YJY A;  5D5S A;  1S09 A;  4XEW A;  1AIC A;  2YCT A;  1AHY A;  2Z1Y A;  3GZD C;  2VYC A;  3ZRR A;  2D7Y A;  1AKB A;  3FZ8 A;  1LC7 A;  1QIR A;  3WKR A;  4F5J A;  4OYT A;  4IX8 A;  3MEB A;  2BI9 A;  5I92 A;  3TAT A;  2W8V A;  1MGV A;  4CBR A;  4BA4 A;  3PDX A;  4XJM A;  3A9Z A;  1FC4 A;  2TPL A;  1AIB A;  2VGT A;  5BJ4 A;  1G7W A;  1J04 A;  2ZSL A;  1DFO A;  4ZWM A;  3TFU A;  3W1I A;  4W91 A;  1ASD A;  3WZF A;  4ZM3 A;  5LHA A;  1AJS B;  4ISY A;  1KMK A;  3MAD A;  1LW5 A;  4Q6R A;  1CQ7 A;  2BKW A;  4JF1 A;  5E3K A;  1BS0 A;  3K40 A;  3L8A A;  2D5Y A;  4JE5 D;  5M4B A;  4I8A A;  1C0N A;  3AEN B;  2BYJ A;  3FFR A;  1AY8 A;  4ADC A;  1BQD A;  3FFH A;  3JU7 A;  3JW9 A;  3MAF A;  3USF A;  1YNU A;  3N75 A;  1GDE A;  1H0C A;  1P3W A;  1GC3 A;  2DGM A;  3PD6 A;  4QGR A;  2FNI A;  2JJE A;  2O7C A;  9AAT A;  1ASE A;  4MQQ A;  1IX6 A;  5BJ3 A;  4EU1 A;  4FL0 A;  4GE7 A;  2VMP A;  4XAU A;  1W7M A;  4MKJ A;  1J32 A;  1ELU A;  4DQ6 A;  1ARH A;  1CQ8 A;  3NNK A;  1B4X A;  4MGR A;  2W7M A;  1BKG A;  2ZY3 A;  1XEY A;  2ZYJ A;  2BHX A;  2R0T A;  4ZSY A;  2CH2 A;  1AAW A;  4ADB A;  4ATQ A;  2OKK A;  1I43 A;  2HOY A;  2DGK A;  4JE5 A;  2EZ2 A;  2W7I A;  3E2Y A;  1OXO A;  3K28 A;  1BJO B;  2CJG A;  4A72 A;  2DOU A;  2YRR A;  4GE4 A;  4PVF A;  1TOI A;  1B8G A;  4PIW A;  4A6U A;  3KGX A;  2ZY5 A;  1AY4 A;  2W7G A;  3ASA A;  1N31 A;  4AZK A;  1B9I A;  3AEJ C;  4JF0 A;  4Y0I A;  4H51 A;  4MQP A;  2HP2 A;  2VMQ A;  3NU8 A;  3QI6 A;  2Q7W A;  5HHY A;  1WYU A;  1X2A A;  1ZOD A;  4EB7 A;  4F5I A;  4LNL A;  3HBX A;  3B1D A;  4J5U A;  1ASL A;  2Z1Z A;  4N0B A;  1OAT A;  3FD0 A;  3WCN A;  1D7R A;  4RIZ A;  5J8Q A;  4F5H A;  3EZS A;  2C44 A;  4A0G A;  4EB5 A;  1MDZ A;  4W1V A;  3ECD A;  1S07 A;  2WK7 A;  3WCO A;  3F6T A;  4KAM A;  1I29 A;  3A9Y A;  2W7L A;  5IWQ A;  4XJP A;  2D66 A;  3WY7 A;  3AEM C;  3ZRQ A;  1AX4 A;  1GCK A;  1OHY A;  2YCP A;  3NU7 A;  4F4E A;  3PDB B;  3FQ7 A;  3PJ0 A;  3TCM A;  1EG5 A;  4IXO A;  1YIZ A;  2X5F A;  2AY6 A;  1MAQ A;  4J8L A;  4Q31 A;  2GMS A;  2OGE A;  3UE8 A;  1M0N A;  4LNJ A;  4W1X A;  3VK3 A;  1M32 A;  4ADE A;  4W8I A;  4OTL A;  2EGY A;  5M4D A;  4IY7 A;  4LW2 A;  1PMO A;  1KL2 A;  2E7I A;  1BT4 A;  3CAI A;  1MDO A;  3LVJ A;  3E6G A;  4OBV A;  1TOE A;  3M5U A;  3BB8 A;  5TF5 A;  3FRK A;  4JEX A;  2AY3 A;  1ELQ A;  1CZE A;  3PGY A;  2VGU A;  2Z20 A;  3EI6 A;  3EUC A;  3PA9 A;  4P3M A;  4OT8 A;  3WX9 A;  1WYV B;  1OHV A;  4K2I A;  3EI8 A;  3AAT A;  4ZDL A;  4F5M A;  1ARS A;  2OGA A;  1ASA A;  3LVK A;  3R9A A;  4P7Y A;  3FKD A;  1TAS A;  1WYT A;  3E2Z A;  2V1P A;  4Q75 A;  5G2Q A;  2BI3 A;  4WLH A;  1GEY A;  4U2H A;  1M7Y A;  3FVS A;  3WGB A; 
#chains in the Genus database with same CATH topology
 4JEZ A;  1SZU A;  3P1T A;  4WYC A;  2QSR A;  4WD2 A;  3E2F A;  1XI9 A;  3ASB A;  4WYF A;  3AEL A;  1DJ9 A;  3NTJ A;  3A8U X;  5EFS A;  4A0H A;  1W7L A;  2BIA A;  4DGT A;  4WXG A;  1D7S A;  4F5L A;  1ASC A;  1I48 A;  5EIG A;  1C9C A;  1EQB A;  2C0R A;  3FSL A;  1CL2 A;  2ZY2 A;  1M0O A;  2FN6 A;  4EMY A;  3QHX A;  1RVY A;  2EYQ A;  2D7Z A;  1ASN A;  1QGN A;  3JZL A;  3DRD A;  2JJH A;  3BC8 A;  4ZDO A;  5F8V A;  1M0Q A;  1V72 A;  1DKA A;  1D7V A;  4AO9 A;  3QGU A;  4BA5 A;  1GEX A;  2GMU A;  3HVY A;  1VP4 A;  1YOO A;  3RQ1 A;  3W1J A;  1CJ0 A;  1KKP A;  3GJU A;  3RI6 A;  2HP1 A;  5DB5 A;  2WK8 A;  4MY5 A;  1ART A;  1SF2 A;  2CST A;  5G4J A;  3BCX A;  3BCB A;  3MAF B;  4OCA A;  3FDD A;  2DR1 A;  5FT5 A;  1AKA A;  5G0A A;  4NOG A;  1W3U A;  1KKJ A;  1AAM A;  1BQA A;  1U08 A;  3CQ6 A;  1GC4 A;  2W7J A;  1OHW A;  2W7K A;  3EI5 A;  4K2B A;  2DKJ A;  1E5F A;  2CY8 A;  3H14 A;  3AEN A;  4LNM A;  3F0H A;  5D95 A;  1TAT A;  2HOR A;  2FNU A;  3BWO A;  3PAA A;  3QM2 A;  3A2B A;  8AAT A;  4FFC A;  4MQR A;  2FYF A;  2Z67 A;  3JTX A;  1W7N A;  3DZZ A;  2BI5 A;  4WYD A;  1TOK A;  1MDX A;  3CQ4 A;  1QZ9 A;  3BWN C;  3JWB A;  3EIB A;  4CXQ A;  1FG7 A;  3IHJ A;  3RCH B;  5G09 A;  3AOV A;  3ZZJ A;  3N4X A;  3AEJ A;  4WB0 B;  4L0O A;  2RFV A;  2EH6 A;  1G4V A;  2WKA A;  4CBS A;  4ZAS A;  3EZ1 A;  2VI9 A;  3WGC A;  3PD6 B;  1AHE A;  3F9T A;  2BYL A;  4EFF A;  2VMT A;  3NDN A;  1DGE A;  4GRX A;  3AV7 A;  4UHN A;  1IX7 A;  2QLR A;  1WYT B;  3DR7 A;  3GZC A;  2DKB A;  3QPG A;  4OC9 A;  1WYU B;  3TQX A;  2VLF A;  4IYO A;  1V2F A;  2BWN A;  4R5Z A;  2OAT A;  1SVV A;  4RJ0 A;  3NUI A;  4TV7 A;  1TOJ A;  2VMZ A;  4HVK A;  1H1C A;  3FQA A;  4R8D A;  2HUU A;  1Z3Z A;  2AY7 A;  3FVU A;  2E7U A;  2CAN A;  1JG8 A;  1MAP A;  2VGZ A;  2VI8 A;  3FCR A;  1UKJ A;  1TOG A;  4RIT A;  4Y0H A;  5G4I A;  3ATH A;  1AJR A;  2ORD A;  1W23 A;  3D6K A;  2W8J A;  4TN4 A;  4UHM A;  4AZJ A;  4CVQ A;  3GET A;  2ZJG A;  5JAY A;  2AY9 A;  4WXF A;  1JS6 A;  3FQ8 A;  1C7O A;  3MBB A;  4O6Z A;  3ZRP A;  5M49 A;  2BIE A;  3BWN A;  4F5G A;  3FZ6 A;  3K7Y A;  1YIY A;  3EI7 A;  2PO3 A;  2Z9U A;  3Q8N A;  3HMU A;  1LW4 A;  3BN1 A;  3G8M A;  1AMA A;  3KGW A;  4GDY A;  4A6T A;  4W5K A;  4KYO A;  1RVU A;  5DX5 A;  1IAX A;  2QA3 A;  2PB0 A;  3DXW A;  1C7G A;  1C7N A;  1VJO A;  4KXK A;  3H9X A;  1O4S A;  2AY8 A;  2HUF A;  2VGV A;  4F5K A;  3BV0 A;  1WYV A;  3DXV A;  4UQV A;  2E54 A;  4XQ2 A;  2GB3 A;  3B1E A;  1Z7D A;  3KE3 A;  1CS1 A;  1G7X A;  2QBT A;  2CFB A;  3NX3 A;  4DBC A;  1AJS A;  1I41 A;  5E4Z A;  1QIT A;  1UU1 A;  1ASB A;  4LC3 A;  1GC0 A;  1FG3 A;  1IAY A;  1IJI A;  2Z9V A;  3CBF A;  3ELE A;  3FDB A;  3ISL A;  4WYA A;  1BJO A;  5EUN A;  2CH1 A;  2QB3 A;  2Z9W A;  1QIS A;  1AHG A;  3GR9 A;  3NYS A;  4Y0D A;  2GQN A;  1AMQ A;  4K2M A;  1S0A A;  1EJI A;  4R2N A;  2VMY A;  4N0W A;  1WST A;  1G4X A;  2CIN A;  2QMA A;  4ZM4 A;  3WKS A;  1M0P A;  1TAR A;  2C7T A;  2XBN A;  3JWA A;  1MLY A;  4R5F A;  1S06 A;  3A9X A;  3AEM A;  4HF8 A;  2VMO A;  3EIA A;  1TPL A;  4IW7 A;  3LG0 A;  4XJO A;  2CJH A;  3VK2 A;  4ITG A;  1AHX A;  2F8J A;  2D61 A;  4E3Q A;  2R5C B;  1B5O A;  4XK1 A;  4BHD A;  3HL2 A;  3L44 A;  4RJY A;  2BI1 A;  4GEB A;  3LY1 A;  4JEV A;  3NRA A;  2ZC0 A;  3VOM A;  1JF9 A;  3KKI A;  4LW4 A;  4A0F A;  1KAF A;  2HOX A;  4RM1 A;  2FQ6 A;  1SPA A;  3B46 A;  1KMJ A;  2ZSM A;  2KFP A;  2VMR A;  1O61 A;  1AHF A;  2WK9 A;  2YKX A;  3AOW A;  3GSB A;  3II0 A;  3TFT A;  3GZD A;  1AY5 A;  1V2D A;  3BS8 A;  1CQ6 A;  1B5P A;  3I16 A;  1UU2 A;  1V2E A;  4E1O A;  2R2N A;  2HUI A;  2DGL A;  4E3R A;  1O62 A;  4CXR A;  3PIU A;  3UAK A;  3E77 A;  3G7Q A;  2W7E A;  4WP0 A;  3B8X A;  3ELP A;  3CQ5 A;  4B9B A;  3DU4 A;  1QJ5 A;  2VMW A;  2G7J A;  1ASG A;  3RCH A;  4OMA A;  2Z9X A;  2VMS A;  4TMR A;  3RBL A;  1IBJ A;  2OKJ A;  3B1C A;  1CZC A;  2YKU A;  2YCN A;  1KL1 A;  2JGT A;  3E2Z B;  5C6U A;  3I5T A;  3LV2 A;  2QB2 A;  3PPL A;  2JIS A;  5DJ9 A;  4AOA A;  2EPJ A;  2W7F A;  4K05 A;  1LS3 A;  5HDM A;  2CB1 A;  2VIB A;  2X3L A;  5FT8 A;  4F5F A;  4ITX A;  2CJD A;  3W1H A;  4A0R A;  3MAU A;  3MKJ A;  4RLG A;  1N8P A;  3NYU A;  4M2J A;  3MC6 C;  4WB0 A;  3N0L A;  1DGD A;  1MLZ A;  2AEV A;  2FM1 A;  3GWP A;  3RBF A;  5G2P A;  1UU0 A;  3WLX A;  2AAT A;  3FTB A;  2GSA A;  2X8U A;  1AKC A;  1ASF A;  1RV4 A;  3LVM A;  4MKK A;  1GBN A;  1SFF A;  3HLM A;  2YKV A;  4IXZ A;  3HT4 A;  4OBU A;  4AO4 A;  4B98 A;  2CTZ A;  2AEU A;  4M2M A;  1N2T A;  1LC8 A;  1X0M A;  2VGW A;  2E7J A;  2EO5 A;  4ZSW A;  2VGS A;  4A00 A;  2JG2 A;  3N4R A;  1AIA A;  1O69 A;  1SZS A;  3AEO A;  3MC6 A;  4ZWV A;  2VMN A;  5EQC A;  3VAX A;  1D2F A;  3LVL B;  5DJ1 A;  1AMS A;  4WLJ A;  4ZDP A;  1E5E A;  1CL1 A;  2R5E A;  2YKY A;  1YAA A;  2NMP A;  3E9K A;  2JJG A;  5FT6 A;  1X29 A;  2VMV A;  2ZUK A;  2D64 A;  2BIG A;  4RAE A;  1D7U A;  1ARI A;  3IF2 A;  4WYG A;  2O0R A;  2VIA A;  4GE9 A;  4ADD A;  5EUE A;  1S08 A;  1Y4I A;  4ATP A;  4PFF A;  4XJL A;  4WXB A;  2HZP A;  2AY1 A;  2HOZ A;  4ZLV A;  1IUG A;  2ZP7 A;  1BJW A;  2X5D A;  3RUY A;  4GSA A;  2W7D A;  2AY2 A;  2VMX A;  2JJF A;  3OKS A;  4Q76 A;  3HDO A;  4UHO A;  3DYD A;  5F9S A;  3DR4 A;  1QJ3 A;  7AAT A;  1YJS A;  1GEW A;  2C81 A;  3VK4 A;  2AY4 A;  5EAV A;  5HXX A;  1X28 A;  3PDB A;  1GC2 A;  4IXS A;  4JEY A;  4A6R A;  3P6K A;  2ZY4 A;  1PMM A;  2W7H A;  1LKC A;  1M4N A;  2BWO A;  2WB6 A;  1C4K A;  1SZK A;  5EAA A;  1GD9 A;  1BJ4 A;  3ACZ A;  2Z61 A;  2BWP A;  2W8W A;  3H7F A;  2W8T A;  2D63 A;  2OQX A;  4WBT A;  3T32 A;  4AH3 A;  2V0Y A;  1M6S A;  3G0T A;  3HQT A;  4IYO B;  3AEP A;  3DC1 A;  5M46 A;  2PB2 A;  4UOY A;  3VP6 A;  2D65 A;  4BMK A;  1IVR A;  1DJE A;  1YJZ A;  1OXP A;  1ARG A;  2W8U A;  2YOB A;  1PFF A;  3FZ7 A;  3FVX A;  1IX8 A;  4RKC A;  1LC5 A;  2AY5 A;  3ZZK A;  2YHK A;  2O1B A;  3EI9 A;  4W1W A;  1ORD A;  5LH9 A;  1JS3 A;  3GBX A;  4E77 A;  1T3I A;  4BQ0 A;  3LWS A;  2BI2 A;  1ECX A;  4JEW A;  4M2K A;  4ZAH A;  2EZ1 A;  3UWC A;  1ZOB A;  4PFN A;  5E5I A;  1RV3 A;  1WKG A;  2VLH A;  5EIG B;  1VEF A;  3BCA A;  1DTY A;  3COG A;  3R4T A;  2YRI A;  4MSO A;  5FT4 A;  1PG8 A;  3N5M A;  1LK9 A;  1ZC9 A;  1AMR A;  1B9H A;  4RKD A;  3QN6 A;  3OP7 A;  3I4J A;  1BJN A;  2VMU A;  3NYT A;  5EUD A;  2G6W A;  3DOD A;  4U1T A;  2R5C A;  3QBO A;  2XH1 A;  5AX8 A;  4WYE A;  1WKH A;  5K8B A;  3NUB A;  1BW0 A;  1DJU A;  1ASM A;  1YJY A;  5D5S A;  1S09 A;  4XEW A;  1AIC A;  2YCT A;  1AHY A;  2Z1Y A;  3GZD C;  2VYC A;  3ZRR A;  2D7Y A;  1AKB A;  3FZ8 A;  1LC7 A;  1QIR A;  3WKR A;  4F5J A;  4OYT A;  4IX8 A;  3MEB A;  2BI9 A;  5I92 A;  3TAT A;  2W8V A;  1MGV A;  4CBR A;  4BA4 A;  3PDX A;  4XJM A;  3A9Z A;  1FC4 A;  2TPL A;  1AIB A;  2VGT A;  5KTB A;  5BJ4 A;  1G7W A;  1J04 A;  2ZSL A;  1DFO A;  4ZWM A;  3TFU A;  3W1I A;  4W91 A;  1ASD A;  3WZF A;  4ZM3 A;  5LHA A;  1AJS B;  4ISY A;  1KMK A;  3MAD A;  1LW5 A;  4Q6R A;  1CQ7 A;  2BKW A;  4JF1 A;  5E3K A;  1BS0 A;  3K40 A;  3L8A A;  2D5Y A;  4JE5 D;  5M4B A;  4I8A A;  1C0N A;  3AEN B;  2BYJ A;  3FFR A;  1AY8 A;  4ADC A;  1BQD A;  3FFH A;  3JU7 A;  3JW9 A;  3MAF A;  3USF A;  1YNU A;  3N75 A;  1GDE A;  1H0C A;  1P3W A;  1GC3 A;  2DGM A;  3PD6 A;  4QGR A;  2FNI A;  2JJE A;  2O7C A;  9AAT A;  1ASE A;  4MQQ A;  1IX6 A;  5BJ3 A;  4EU1 A;  2A1V A;  4FL0 A;  4GE7 A;  2VMP A;  4XAU A;  1W7M A;  4MKJ A;  1J32 A;  1ELU A;  4DQ6 A;  1ARH A;  1CQ8 A;  3NNK A;  1B4X A;  4MGR A;  2W7M A;  1BKG A;  2ZY3 A;  1XEY A;  2ZYJ A;  2BHX A;  2R0T A;  4ZSY A;  2CH2 A;  1AAW A;  4ADB A;  4ATQ A;  2OKK A;  1I43 A;  2HOY A;  2DGK A;  4JE5 A;  2EZ2 A;  2W7I A;  3N4S A;  3E2Y A;  1OXO A;  3K28 A;  1BJO B;  2CJG A;  4A72 A;  2DOU A;  2YRR A;  4GE4 A;  4PVF A;  1TOI A;  1B8G A;  4PIW A;  4A6U A;  3KGX A;  2ZY5 A;  1AY4 A;  2W7G A;  3ASA A;  1N31 A;  4AZK A;  1B9I A;  3AEJ C;  4JF0 A;  4Y0I A;  4H51 A;  4MQP A;  2HP2 A;  2VMQ A;  3NU8 A;  3QI6 A;  2Q7W A;  5HHY A;  1WYU A;  1X2A A;  1ZOD A;  4EB7 A;  4F5I A;  4LNL A;  3HBX A;  3B1D A;  4J5U A;  1ASL A;  2Z1Z A;  4N0B A;  1OAT A;  3FD0 A;  3WCN A;  1D7R A;  4RIZ A;  5J8Q A;  4F5H A;  3EZS A;  2C44 A;  4A0G A;  4EB5 A;  1MDZ A;  4W1V A;  3ECD A;  1S07 A;  2WK7 A;  3WCO A;  3F6T A;  4KAM A;  1I29 A;  3A9Y A;  2W7L A;  5IWQ A;  4XJP A;  2D66 A;  3WY7 A;  3AEM C;  3ZRQ A;  1AX4 A;  1GCK A;  1OHY A;  2YCP A;  3NU7 A;  4F4E A;  3PDB B;  3FQ7 A;  3PJ0 A;  3TCM A;  1EG5 A;  4IXO A;  1YIZ A;  2X5F A;  2AY6 A;  1MAQ A;  4J8L A;  4Q31 A;  2GMS A;  2OGE A;  3UE8 A;  1M0N A;  4LNJ A;  4H63 Q;  4W1X A;  3VK3 A;  1M32 A;  4ADE A;  4W8I A;  4OTL A;  2EGY A;  5M4D A;  4IY7 A;  2FKI A;  4LW2 A;  1PMO A;  1KL2 A;  2E7I A;  1BT4 A;  3CAI A;  1MDO A;  3LVJ A;  3E6G A;  4OBV A;  1TOE A;  3M5U A;  3BB8 A;  5TF5 A;  3FRK A;  4JEX A;  2AY3 A;  1ELQ A;  1CZE A;  3PGY A;  2VGU A;  2Z20 A;  3EI6 A;  3EUC A;  3PA9 A;  4P3M A;  4OT8 A;  3N7N A;  3WX9 A;  1WYV B;  1OHV A;  4K2I A;  3EI8 A;  3AAT A;  4ZDL A;  4F5M A;  1ARS A;  2OGA A;  1ASA A;  3LVK A;  3R9A A;  4P7Y A;  3FKD A;  1TAS A;  1WYT A;  3E2Z A;  2V1P A;  4Q75 A;  5G2Q A;  2BI3 A;  4WLH A;  1GEY A;  4U2H A;  1M7Y A;  3FVS A;  3WGB A; 
#chains in the Genus database with same CATH homology
 4JEZ A;  1SZU A;  3P1T A;  4WYC A;  2QSR A;  4WD2 A;  3E2F A;  1XI9 A;  3ASB A;  4WYF A;  3AEL A;  1DJ9 A;  3NTJ A;  3A8U X;  5EFS A;  4A0H A;  1W7L A;  2BIA A;  4DGT A;  4WXG A;  1D7S A;  4F5L A;  1ASC A;  1I48 A;  5EIG A;  1C9C A;  1EQB A;  2C0R A;  3FSL A;  1CL2 A;  2ZY2 A;  1M0O A;  2FN6 A;  4EMY A;  3QHX A;  1RVY A;  2EYQ A;  2D7Z A;  1ASN A;  1QGN A;  3JZL A;  3DRD A;  2JJH A;  3BC8 A;  4ZDO A;  5F8V A;  1M0Q A;  1V72 A;  1DKA A;  1D7V A;  4AO9 A;  3QGU A;  4BA5 A;  1GEX A;  2GMU A;  3HVY A;  1VP4 A;  1YOO A;  3RQ1 A;  3W1J A;  1CJ0 A;  1KKP A;  3GJU A;  3RI6 A;  2HP1 A;  5DB5 A;  2WK8 A;  4MY5 A;  1ART A;  1SF2 A;  2CST A;  5G4J A;  3BCX A;  3BCB A;  3MAF B;  4OCA A;  3FDD A;  2DR1 A;  5FT5 A;  1AKA A;  5G0A A;  4NOG A;  1W3U A;  1KKJ A;  1AAM A;  1BQA A;  1U08 A;  3CQ6 A;  1GC4 A;  2W7J A;  1OHW A;  2W7K A;  3EI5 A;  4K2B A;  2DKJ A;  1E5F A;  2CY8 A;  3H14 A;  3AEN A;  4LNM A;  3F0H A;  5D95 A;  1TAT A;  2HOR A;  2FNU A;  3BWO A;  3PAA A;  3QM2 A;  3A2B A;  8AAT A;  4FFC A;  4MQR A;  2FYF A;  2Z67 A;  3JTX A;  1W7N A;  3DZZ A;  2BI5 A;  4WYD A;  1TOK A;  1MDX A;  3CQ4 A;  1QZ9 A;  3BWN C;  3JWB A;  3EIB A;  4CXQ A;  1FG7 A;  3IHJ A;  3RCH B;  5G09 A;  3AOV A;  3ZZJ A;  3N4X A;  3AEJ A;  4WB0 B;  4L0O A;  2RFV A;  2EH6 A;  1G4V A;  2WKA A;  4CBS A;  4ZAS A;  3EZ1 A;  2VI9 A;  3WGC A;  3PD6 B;  1AHE A;  3F9T A;  2BYL A;  4EFF A;  2VMT A;  3NDN A;  1DGE A;  4GRX A;  3AV7 A;  4UHN A;  1IX7 A;  2QLR A;  1WYT B;  3DR7 A;  3GZC A;  2DKB A;  3QPG A;  4OC9 A;  1WYU B;  3TQX A;  2VLF A;  4IYO A;  1V2F A;  2BWN A;  4R5Z A;  2OAT A;  1SVV A;  4RJ0 A;  3NUI A;  4TV7 A;  1TOJ A;  2VMZ A;  4HVK A;  1H1C A;  3FQA A;  4R8D A;  2HUU A;  1Z3Z A;  2AY7 A;  3FVU A;  2E7U A;  2CAN A;  1JG8 A;  1MAP A;  2VGZ A;  2VI8 A;  3FCR A;  1UKJ A;  1TOG A;  4RIT A;  4Y0H A;  5G4I A;  3ATH A;  1AJR A;  2ORD A;  1W23 A;  3D6K A;  2W8J A;  4TN4 A;  4UHM A;  4AZJ A;  4CVQ A;  3GET A;  2ZJG A;  5JAY A;  2AY9 A;  4WXF A;  1JS6 A;  3FQ8 A;  1C7O A;  3MBB A;  4O6Z A;  3ZRP A;  5M49 A;  2BIE A;  3BWN A;  4F5G A;  3FZ6 A;  3K7Y A;  1YIY A;  3EI7 A;  2PO3 A;  2Z9U A;  3Q8N A;  3HMU A;  1LW4 A;  3BN1 A;  3G8M A;  1AMA A;  3KGW A;  4GDY A;  4A6T A;  4W5K A;  4KYO A;  1RVU A;  5DX5 A;  1IAX A;  2QA3 A;  2PB0 A;  3DXW A;  1C7G A;  1C7N A;  1VJO A;  4KXK A;  3H9X A;  1O4S A;  2AY8 A;  2HUF A;  2VGV A;  4F5K A;  3BV0 A;  1WYV A;  3DXV A;  4UQV A;  2E54 A;  4XQ2 A;  2GB3 A;  3B1E A;  1Z7D A;  3KE3 A;  1CS1 A;  1G7X A;  2QBT A;  2CFB A;  3NX3 A;  4DBC A;  1AJS A;  1I41 A;  5E4Z A;  1QIT A;  1UU1 A;  1ASB A;  4LC3 A;  1GC0 A;  1FG3 A;  1IAY A;  1IJI A;  2Z9V A;  3CBF A;  3ELE A;  3FDB A;  3ISL A;  4WYA A;  1BJO A;  5EUN A;  2CH1 A;  2QB3 A;  2Z9W A;  1QIS A;  1AHG A;  3GR9 A;  3NYS A;  4Y0D A;  2GQN A;  1AMQ A;  4K2M A;  1S0A A;  1EJI A;  4R2N A;  2VMY A;  4N0W A;  1WST A;  1G4X A;  2CIN A;  2QMA A;  4ZM4 A;  3WKS A;  1M0P A;  1TAR A;  2C7T A;  2XBN A;  3JWA A;  1MLY A;  4R5F A;  1S06 A;  3A9X A;  3AEM A;  4HF8 A;  2VMO A;  3EIA A;  1TPL A;  4IW7 A;  3LG0 A;  4XJO A;  2CJH A;  3VK2 A;  4ITG A;  1AHX A;  2F8J A;  2D61 A;  4E3Q A;  2R5C B;  1B5O A;  4XK1 A;  4BHD A;  3HL2 A;  3L44 A;  4RJY A;  2BI1 A;  4GEB A;  3LY1 A;  4JEV A;  3NRA A;  2ZC0 A;  3VOM A;  1JF9 A;  3KKI A;  4LW4 A;  4A0F A;  2HOX A;  4RM1 A;  2FQ6 A;  1SPA A;  3B46 A;  1KMJ A;  2ZSM A;  2KFP A;  2VMR A;  1O61 A;  1AHF A;  2WK9 A;  2YKX A;  3AOW A;  3GSB A;  3II0 A;  3TFT A;  3GZD A;  1AY5 A;  1V2D A;  3BS8 A;  1CQ6 A;  1B5P A;  3I16 A;  1UU2 A;  1V2E A;  4E1O A;  2R2N A;  2HUI A;  2DGL A;  4E3R A;  1O62 A;  4CXR A;  3PIU A;  3UAK A;  3E77 A;  3G7Q A;  2W7E A;  4WP0 A;  3B8X A;  3ELP A;  3CQ5 A;  4B9B A;  3DU4 A;  1QJ5 A;  2VMW A;  2G7J A;  1ASG A;  3RCH A;  4OMA A;  2Z9X A;  2VMS A;  4TMR A;  3RBL A;  1IBJ A;  2OKJ A;  3B1C A;  1CZC A;  2YKU A;  2YCN A;  1KL1 A;  2JGT A;  3E2Z B;  5C6U A;  3I5T A;  3LV2 A;  2QB2 A;  3PPL A;  2JIS A;  5DJ9 A;  4AOA A;  2EPJ A;  2W7F A;  4K05 A;  1LS3 A;  5HDM A;  2CB1 A;  2VIB A;  2X3L A;  5FT8 A;  4F5F A;  4ITX A;  2CJD A;  3W1H A;  4A0R A;  3MAU A;  3MKJ A;  4RLG A;  1N8P A;  3NYU A;  4M2J A;  3MC6 C;  4WB0 A;  3N0L A;  1DGD A;  1MLZ A;  2AEV A;  2FM1 A;  3GWP A;  3RBF A;  5G2P A;  1UU0 A;  3WLX A;  2AAT A;  3FTB A;  2GSA A;  2X8U A;  1AKC A;  1ASF A;  1RV4 A;  3LVM A;  4MKK A;  1GBN A;  1SFF A;  3HLM A;  2YKV A;  4IXZ A;  3HT4 A;  4OBU A;  4AO4 A;  4B98 A;  2CTZ A;  2AEU A;  4M2M A;  1N2T A;  1LC8 A;  1X0M A;  2VGW A;  2E7J A;  2EO5 A;  4ZSW A;  2VGS A;  4A00 A;  2JG2 A;  3N4R A;  1AIA A;  1O69 A;  1SZS A;  3AEO A;  3MC6 A;  4ZWV A;  2VMN A;  5EQC A;  3VAX A;  1D2F A;  3LVL B;  5DJ1 A;  1AMS A;  4WLJ A;  4ZDP A;  1E5E A;  1CL1 A;  2R5E A;  2YKY A;  1YAA A;  2NMP A;  3E9K A;  2JJG A;  5FT6 A;  1X29 A;  2VMV A;  2ZUK A;  2D64 A;  2BIG A;  4RAE A;  1D7U A;  1ARI A;  3IF2 A;  4WYG A;  2O0R A;  2VIA A;  4GE9 A;  4ADD A;  5EUE A;  1S08 A;  1Y4I A;  4ATP A;  4PFF A;  4XJL A;  4WXB A;  2HZP A;  2AY1 A;  2HOZ A;  4ZLV A;  1IUG A;  2ZP7 A;  1BJW A;  2X5D A;  3RUY A;  4GSA A;  2W7D A;  2AY2 A;  2VMX A;  2JJF A;  3OKS A;  4Q76 A;  3HDO A;  4UHO A;  3DYD A;  5F9S A;  3DR4 A;  1QJ3 A;  7AAT A;  1YJS A;  1GEW A;  2C81 A;  3VK4 A;  2AY4 A;  5EAV A;  5HXX A;  1X28 A;  3PDB A;  1GC2 A;  4IXS A;  4JEY A;  4A6R A;  3P6K A;  2ZY4 A;  1PMM A;  2W7H A;  1LKC A;  1M4N A;  2BWO A;  2WB6 A;  1C4K A;  1SZK A;  5EAA A;  1GD9 A;  1BJ4 A;  3ACZ A;  2Z61 A;  2BWP A;  2W8W A;  3H7F A;  2W8T A;  2D63 A;  2OQX A;  4WBT A;  3T32 A;  4AH3 A;  2V0Y A;  1M6S A;  3G0T A;  3HQT A;  4IYO B;  3AEP A;  3DC1 A;  5M46 A;  2PB2 A;  4UOY A;  3VP6 A;  2D65 A;  4BMK A;  1IVR A;  1DJE A;  1YJZ A;  1OXP A;  1ARG A;  2W8U A;  2YOB A;  1PFF A;  3FZ7 A;  3FVX A;  1IX8 A;  4RKC A;  1LC5 A;  2AY5 A;  3ZZK A;  2YHK A;  2O1B A;  3EI9 A;  4W1W A;  1ORD A;  5LH9 A;  1JS3 A;  3GBX A;  4E77 A;  1T3I A;  4BQ0 A;  3LWS A;  2BI2 A;  1ECX A;  4JEW A;  4M2K A;  4ZAH A;  2EZ1 A;  3UWC A;  1ZOB A;  4PFN A;  5E5I A;  1RV3 A;  1WKG A;  2VLH A;  5EIG B;  1VEF A;  3BCA A;  1DTY A;  3COG A;  3R4T A;  2YRI A;  4MSO A;  5FT4 A;  1PG8 A;  3N5M A;  1LK9 A;  1ZC9 A;  1AMR A;  1B9H A;  4RKD A;  3QN6 A;  3OP7 A;  3I4J A;  1BJN A;  2VMU A;  3NYT A;  5EUD A;  2G6W A;  3DOD A;  4U1T A;  2R5C A;  3QBO A;  2XH1 A;  5AX8 A;  4WYE A;  1WKH A;  5K8B A;  3NUB A;  1BW0 A;  1DJU A;  1ASM A;  1YJY A;  5D5S A;  1S09 A;  4XEW A;  1AIC A;  2YCT A;  1AHY A;  2Z1Y A;  3GZD C;  2VYC A;  3ZRR A;  2D7Y A;  1AKB A;  3FZ8 A;  1LC7 A;  1QIR A;  3WKR A;  4F5J A;  4OYT A;  4IX8 A;  3MEB A;  2BI9 A;  5I92 A;  3TAT A;  2W8V A;  1MGV A;  4CBR A;  4BA4 A;  3PDX A;  4XJM A;  3A9Z A;  1FC4 A;  2TPL A;  1AIB A;  2VGT A;  5KTB A;  5BJ4 A;  1G7W A;  1J04 A;  2ZSL A;  1DFO A;  4ZWM A;  3TFU A;  3W1I A;  4W91 A;  1ASD A;  3WZF A;  4ZM3 A;  5LHA A;  1AJS B;  4ISY A;  1KMK A;  3MAD A;  1LW5 A;  4Q6R A;  1CQ7 A;  2BKW A;  4JF1 A;  5E3K A;  1BS0 A;  3K40 A;  3L8A A;  2D5Y A;  4JE5 D;  5M4B A;  4I8A A;  1C0N A;  3AEN B;  2BYJ A;  3FFR A;  1AY8 A;  4ADC A;  1BQD A;  3FFH A;  3JU7 A;  3JW9 A;  3MAF A;  3USF A;  1YNU A;  3N75 A;  1GDE A;  1H0C A;  1P3W A;  1GC3 A;  2DGM A;  3PD6 A;  4QGR A;  2FNI A;  2JJE A;  2O7C A;  9AAT A;  1ASE A;  4MQQ A;  1IX6 A;  5BJ3 A;  4EU1 A;  2A1V A;  4FL0 A;  4GE7 A;  2VMP A;  4XAU A;  1W7M A;  4MKJ A;  1J32 A;  1ELU A;  4DQ6 A;  1ARH A;  1CQ8 A;  3NNK A;  1B4X A;  4MGR A;  2W7M A;  1BKG A;  2ZY3 A;  1XEY A;  2ZYJ A;  2BHX A;  2R0T A;  4ZSY A;  2CH2 A;  1AAW A;  4ADB A;  4ATQ A;  2OKK A;  1I43 A;  2HOY A;  2DGK A;  4JE5 A;  2EZ2 A;  2W7I A;  3N4S A;  3E2Y A;  1OXO A;  3K28 A;  1BJO B;  2CJG A;  4A72 A;  2DOU A;  2YRR A;  4GE4 A;  4PVF A;  1TOI A;  1B8G A;  4PIW A;  4A6U A;  3KGX A;  2ZY5 A;  1AY4 A;  2W7G A;  3ASA A;  1N31 A;  4AZK A;  1B9I A;  3AEJ C;  4JF0 A;  4Y0I A;  4H51 A;  4MQP A;  2HP2 A;  2VMQ A;  3NU8 A;  3QI6 A;  2Q7W A;  5HHY A;  1WYU A;  1X2A A;  1ZOD A;  4EB7 A;  4F5I A;  4LNL A;  3HBX A;  3B1D A;  4J5U A;  1ASL A;  2Z1Z A;  4N0B A;  1OAT A;  3FD0 A;  3WCN A;  1D7R A;  4RIZ A;  5J8Q A;  4F5H A;  3EZS A;  2C44 A;  4A0G A;  4EB5 A;  1MDZ A;  4W1V A;  3ECD A;  1S07 A;  2WK7 A;  3WCO A;  3F6T A;  4KAM A;  1I29 A;  3A9Y A;  2W7L A;  5IWQ A;  4XJP A;  2D66 A;  3WY7 A;  3AEM C;  3ZRQ A;  1AX4 A;  1GCK A;  1OHY A;  2YCP A;  3NU7 A;  4F4E A;  3PDB B;  3FQ7 A;  3PJ0 A;  3TCM A;  1EG5 A;  4IXO A;  1YIZ A;  2X5F A;  2AY6 A;  1MAQ A;  4J8L A;  4Q31 A;  2GMS A;  2OGE A;  3UE8 A;  1M0N A;  4LNJ A;  4H63 Q;  4W1X A;  3VK3 A;  1M32 A;  4ADE A;  4W8I A;  4OTL A;  2EGY A;  5M4D A;  4IY7 A;  2FKI A;  4LW2 A;  1PMO A;  1KL2 A;  2E7I A;  1BT4 A;  3CAI A;  1MDO A;  3LVJ A;  3E6G A;  4OBV A;  1TOE A;  3M5U A;  3BB8 A;  5TF5 A;  3FRK A;  4JEX A;  2AY3 A;  1ELQ A;  1CZE A;  3PGY A;  2VGU A;  2Z20 A;  3EI6 A;  3EUC A;  3PA9 A;  4P3M A;  4OT8 A;  3N7N A;  3WX9 A;  1WYV B;  1OHV A;  4K2I A;  3EI8 A;  3AAT A;  4ZDL A;  4F5M A;  1ARS A;  2OGA A;  1ASA A;  3LVK A;  3R9A A;  4P7Y A;  3FKD A;  1TAS A;  1WYT A;  3E2Z A;  2V1P A;  4Q75 A;  5G2Q A;  2BI3 A;  4WLH A;  1GEY A;  4U2H A;  1M7Y A;  3FVS A;  3WGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...