4AZKA

Structural basis of l-phosphoserine binding to bacillus alcalophilus phosphoserine aminotransferase
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
360
structure length
360
Chain Sequence
VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Structural Basis of L-Phosphoserine Binding to Bacillus Alcalophilus Phosphoserine Aminotransferase
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
total genus 128
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2012-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4azkA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4azkA02
2NMPA 2BI1A 4AOAA 1V2FA 2YKXA 1GD9A 3RQ1A 3B1DA 3DZZA 5J8QA 4F5HA 3PD6A 4AO4A 1AHXA 1ASGA 1X29A 2AY7A 2Z61A 1N31A 4ITGA 3HMUA 4WXGA 4Q75A 2BIEA 2DKBA 2YRRA 1W3UA 1GC2A 1QJ5A 2O0RA 1H0CA 3BB8A 2AY6A 2HOYA 2WK9A 1BQAA 3I5TA 3L8AA 3WCOA 1WYTB 2ZYJA 3PGYA 1WYTA 4IY7A 1B9HA 3DRDA 3AOVA 4WYFA 1EG5A 2BKWA 1TARA 3WGBA 1QISA 2Z20A 2VLFA 1T3IA 3N5MA 5FT8A 1C4KA 1MLYA 2BYJA 1ASFA 1N2TA 2E7IA 2YCPA 3EZ1A 4JEVA 4RJYA 3FFHA 4W1XA 2D66A 4WYEA 3QGUA 3OKSA 5AX8A 1D7VA 1SPAA 3P1TA 2QB2A 1YJSA 1M4NA 3K40A 1M0QA 1X0MA 1CJ0A 4EB7A 3QN6A 1BJOA 1ASBA 4AZKA 3HL2A 4P7YA 1LS3A 1WSTA 4OYTA 1FG3A 3E2ZA 2DGMA 4UHNA 4Y0DA 3B8XA 1S09A 1FC4A 1G4XA 1SVVA 1AICA 1LC7A 2HUFA 1P3WA 2BI5A 2D63A 2QMAA 2VGVA 3EI8A 3GZCA 2JJFA 1CQ7A 3JWAA 3M5UA 3WLXA 2GSAA 3T32A 3AEJC 4ADEA 2YKVA 2EZ2A 4HF8A 2DGLA 3PIUA 4RITA 4IYOB 5FT6A 1RVUA 1J04A 1AAMA 4IYOA 3GBXA 1AX4A 3L44A 5E5IA 3VK4A 5G09A 1AY4A 2D64A 1WYUB 1S06A 4WB0A 2EGYA 4TN4A 2W8VA 4N0BA 1TOJA 1U08A 1DTYA 4AO9A 3MC6C 4Q31A 1B8GA 3RI6A 2VMQA 2HOZA 1M0NA 2OGAA 3NRAA 2YOBA 3JW9A 5FT4A 3A9YA 2PB0A 5EFSA 2W7HA 1QGNA 3USFA 4ZM3A 5EAAA 2R5EA 3FFRA 1DGEA 1MGVA 1O61A 3CAIA 1YIZA 3MEBA 4WP0A 2ZJGA 4CBRA 3EI7A 1MDOA 2HP1A 2HOXA 1TOGA 3BCBA 2VGUA 2AY2A 3AV7A 1M0PA 2Z67A 1JS6A 4MKJA 2AATA 2OATA 1PG8A 3JTXA 1TOEA 1X28A 1RV3A 3A8UX 1BT4A 4OBUA 1YJZA 2CB1A 4JF0A 4DQ6A 2D7ZA 1ECXA 3HQTA 2CFBA 1TOKA 4IXZA 2AY4A 4ZWVA 4GSAA 5LH9A 2AY1A 2FNUA 4MQQA 3ASBA 4E3QA 2ZY3A 2AY5A 2OGEA 3MAUA 3NU7A 4MGRA 1S08A 2QA3A 4DBCA 1BS0A 3JWBA 3WKRA 4JE5A 2CANA 1I29A 4Y0IA 1AJRA 1VEFA 1AY5A 4MQPA 3ATHA 2CJDA 4HVKA 4XJPA 3OP7A 3NYTA 1IAXA 2X8UA 2QBTA 1V2DA 1DJUA 4R5FA 3N75A 3TQXA 1OHYA 2VMZA 2AEUA 3AEMA 4RLGA 2W8TA 2GB3A 1OATA 2VMNA 3LY1A 4GDYA 3JU7A 4ZDPA 1AHFA 3ISLA 3WY7A 3LVLB 4BMKA 1M32A 4GEBA 3TFTA 2W7LA 3H7FA 4A6UA 4XAUA 3RUYA 4A6TA 2VMUA 3G7QA 2D7YA 1IUGA 2BYLA 2F8JA 3BWNC 3AEOA 3HDOA 4XEWA 4M2MA 2VMVA 4L0OA 1OHWA 3PDBA 3NDNA 4MSOA 4WBTA 1AAWA 3GETA 4RM1A 3DR4A 3ELPA 4BA4A 2GMSA 3K7YA 4W5KA 5G2QA 2Z9VA 4GRXA 3AENB 5HHYA 2ZUKA 4ZAHA 3PJ0A 5BJ3A 3CQ4A 4KAMA 3TFUA 2D65A 1WKHA 2CH1A 1AHEA 1ORDA 1VP4A 2QLRA 1GEXA 1OXOA 4TV7A 2TPLA 3FVXA 3QI6A 3FQ7A 2YCNA 3KE3A 4F5LA 2FM1A 1AHYA 1W7LA 3LVMA 1ASLA 2AY8A 5JAYA 2Z1ZA 4U2HA 1SZUA 3ELEA 4EMYA 2ZY5A 4H51A 3KGXA 4N0WA 2FYFA 5F8VA 1IAYA 4J5UA 3KGWA 1J32A 3B1EA 3FD0A 2VIBA 3KKIA 4BA5A 1CZCA 1JF9A 3FRKA 2W7MA 2Z9XA 3ECDA 3II0A 4TMRA 3F9TA 1B5OA 2AEVA 1W7MA 5EUEA 4ZASA 4B98A 2BIGA 4LNJA 1D7SA 2VGTA 2OQXA 1KKPA 4XQ2A 3N0LA 2VLHA 3E77A 4E3RA 1QIRA 2YCTA 3MAFB 2W8WA 1AY8A 2CJHA 3I16A 3ZRQA 1C9CA 3BV0A 1XEYA 4ZSYA 2BWPA 2VMPA 1LC5A 3QHXA 1BQDA 3GZDA 3TCMA 2QB3A 1MDXA 1ASNA 1QJ3A 3MKJA 3BS8A 4F4EA 3RBFA 1M0OA 1ASAA 1ELQA 1PFFA 3G8MA 3LVKA 2R0TA 4Q76A 5M4BA 1AHGA 2DGKA 4NOGA 1BJ4A 5E3KA 3RCHB 4A72A 4WYDA 1FG7A 1WYUA 3ZRPA 5DX5A 3G0TA 3LWSA 4BQ0A 5M49A 1UU2A 1QZ9A 2CJGA 1E5EA 3NTJA 1Z3ZA 1AIBA 4LC3A 2ZP7A 4OCAA 2ZY2A 1IX8A 1G7XA 1AKBA 4EFFA 8AATA 2HP2A 3GR9A 4ZLVA 1M7YA 4P3MA 1CQ8A 4F5MA 4R8DA 1GC0A 3E2YA 1D7UA 3QM2A 4Y0HA 2DKJA 3WZFA 4OTLA 5EQCA 3F6TA 3R4TA 3TATA 1TOIA 3H14A 2Z9WA 2FQ6A 2VMXA 1RVYA 2XH1A 4XJLA 5F9SA 1IBJA 1ASMA 2WKAA 3R9AA 4PIWA 1TATA 3EI9A 3BWOA 5D95A 1SF2A 3E6GA 1O62A 3LVJA 1AKAA 1ZC9A 1E5FA 2R5CB 3GJUA 1KL2A 2ZC0A 4CBSA 2Q7WA 4CVQA 3B1CA 1DGDA 3DXWA 3PDXA 4MKKA 4RIZA 1BJWA 4A0RA 4ZDOA 4B9BA 1S07A 2YHKA 4WYAA 1VJOA 2X3LA 3MADA 1AIAA 2CTZA 3FZ8A 1ELUA 4UQVA 2DR1A 1C0NA 3A2BA 1ARTA 3DR7A 3HLMA 4WD2A 3P6KA 2JISA 3EI5A 3FQ8A 4PFFA 3BCXA 2VMRA 9AATA 3FVSA 5M46A 1MAPA 2D5YA 4WXBA 3ACZA 3PA9A 4E77A 2O7CA 3FQAA 4ATPA 3F0HA 1H1CA 1IVRA 1UU1A 2V0YA 2GMUA 4UHOA 4AZJA 1YAAA 2ZSLA 2AY9A 2HUIA 2HZPA 4IXSA 2VMSA 4RKDA 5G2PA 2HORA 7AATA 2VGWA 2YRIA 1CL1A 1DJ9A 1OHVA 4GE9A 1ASCA 4I8AA 4F5JA 2Z9UA 3AEMC 1PMOA 3HVYA 1D7RA 5DB5A 5DJ1A 4IXOA 5G4IA 3CBFA 3DC1A 3ZZKA 4FFCA 4OMAA 3AENA 4JE5D 3W1HA 2W7IA 4PVFA 2BWOA 3GSBA 5EIGB 4A00A 3W1IA 2VI8A 3PAAA 4A0GA 4KXKA 1GCKA 2Z1YA 4FL0A 2VMTA 4JEWA 3K28A 2WK7A 3FTBA 4XJOA 4RKCA 3FDBA 1WYVB 2AY3A 1B9IA 1AJSB 4AH3A 1YOOA 4QGRA 3DXVA 4A6RA 3ZZJA 2R2NA 2E54A 5DJ9A 2VIAA 4ATQA 3E9KA 4K2MA 1IX6A 2CSTA 1EQBA 2X5DA 3PD6B 1I48A 1G7WA 3UE8A 2PB2A 4Q6RA 4JEZA 1AMQA 1YNUA 1KMJA 1QITA 4J8LA 2EZ1A 3NX3A 3A9XA 1LK9A 1AKCA 3BN1A 3VAXA 3FCRA 4IW7A 2GQNA 4BHDA 2CH2A 4A0HA 5G0AA 2VGZA 3EIAA 4JF1A 3WX9A 3NUIA 5LHAA 2FNIA 2XBNA 4W1VA 5FT5A 1B4XA 1B5PA 3EIBA 3MAFA 4LW2A 2YKUA 3D6KA 2VYCA 2W7JA 2BHXA 2EO5A 4R2NA 1N8PA 5M4DA 2JJGA 2O1BA 4R5ZA 3AEJA 3I4JA 1I43A 4OT8A 1MAQA 2BWNA 3VK3A 4CXQA 3CQ5A 3MBBA 4DGTA 1DFOA 2HUUA 1BJOB 4IX8A 1G4VA 4OC9A 5BJ4A 3BC8A 3GWPA 1GBNA 3RCHA 3NUBA 3AEPA 3NNKA 1XI9A 3E2ZB 3NYUA 4M2JA 4KYOA 4F5IA 2W7EA 1C7GA 1V2EA 3MC6A 1GEWA 1D2FA 3LG0A 1Y4IA 4WLJA 1AMRA 1LC8A 3AOWA 3Q8NA 3VOMA 3GZDC 4O6ZA 3UWCA 2W7GA 2C0RA 2WK8A 3JZLA 4WYGA 5G4JA 3WKSA 1LW4A 4WXFA 5EUDA 4CXRA 1AMAA 4ADDA 2ZSMA 4F5KA 2FN6A 5HXXA 1MLZA 1TASA 1WKGA 3HBXA 5HDMA 4XJMA 3ASAA 3EI6A 3NYSA 4WB0B 1BJNA 2E7UA 1ZODA 4W91A 1YIYA 3VK2A 4F5GA 3IHJA 4ISYA 4UOYA 1W23A 2BI3A 1YJYA 5EAVA 5C6UA 1C7NA 1OXPA 3B46A 4MQRA 2DOUA 4JEXA 4JEYA 4ZSWA 2R5CA 1UU0A 4M2KA 2VGSA 1BW0A 2W8UA 2G6WA 3LV2A 3FSLA 2W7DA 4LNLA 1W7NA 1ARIA 3W1JA 2PO3A 2W8JA 3FZ6A 4OBVA 3VP6A 4PFNA 3FVUA 2E7JA 2RFVA 4XK1A 4ZWMA 3NU8A 4GE4A 4K2IA 2OKJA 1DKAA 2X5FA 4EB5A 1SZSA 1CS1A 1C7OA 2CY8A 2EPJA 2YKYA 3A9ZA 3E2FA 4LNMA 5TF5A 1JS3A 1MDZA 2EH6A 2C44A 5E4ZA 4WLHA 3EUCA 3QPGA 4ZDLA 3WCNA 1GC3A 1UKJA 1GDEA 2CINA 1O4SA 1M6SA 4ADBA 1S0AA 3DYDA 1KL1A 2D61A 2JJEA 1CZEA 3QBOA 4F5FA 2JG2A 5EUNA 4U1TA 3ZRRA 5K8BA 4RAEA 4MY5A 3HT4A 1LKCA 2VMOA 5IWQA 2BI2A 1GC4A 2W7FA 4A0FA 3BWNA 2BIAA 1SZKA 1AMSA 2W7KA 4E1OA 3AELA 1CQ6A 5I92A 1ASEA 4ADCA 1SFFA 2V1PA 1I41A 1X2AA 4LW4A 3WGCA 2C7TA 1GEYA 3CQ6A 4GE7A 4WYCA 1BKGA 1JG8A 1O69A 1V72A 2OKKA 2VMWA 4EU1A 1CL2A 2VMYA 3BCAA 3FZ7A 1ASDA 2JGTA 4UHMA 3UAKA 1PMMA 1TPLA 3EZSA 3FDDA 5EIGA 1DJEA 1EJIA 1KMKA 1ZOBA 3DODA 3FKDA 4RJ0A 3RBLA 2BI9A 2ORDA 1IJIA 1KKJA 1LW5A 3PPLA 5D5SA 2JJHA 3PDBB 1ARHA 4ITXA 1ARSA 3IF2A 2ZY4A 1WYVA 1RV4A 1AJSA 2C81A 3DU4A 1ARGA 3AATA 4W1WA 1Z7DA 4K2BA 4W8IA 3COGA 2VI9A 4ZM4A 1IX7A
chains in the Genus database with same CATH superfamily
2NMPA 2BI1A 2G7JA 4AOAA 1V2FA 2YKXA 1GD9A 3RQ1A 3B1DA 3DZZA 5J8QA 4F5HA 3PD6A 4AO4A 1AHXA 1ASGA 1X29A 2AY7A 2Z61A 1N31A 4ITGA 3HMUA 4WXGA 4Q75A 2BIEA 2DKBA 2YRRA 1W3UA 1GC2A 1QJ5A 2O0RA 1H0CA 3BB8A 2AY6A 2HOYA 2WK9A 1BQAA 3I5TA 3L8AA 3WCOA 1WYTB 2ZYJA 3PGYA 3N4XA 1WYTA 4IY7A 1B9HA 3DRDA 3AOVA 4WYFA 1EG5A 2BKWA 1TARA 3WGBA 1QISA 2Z20A 2VLFA 1T3IA 3N5MA 5FT8A 1C4KA 1MLYA 2BYJA 1ASFA 1N2TA 2E7IA 2YCPA 3EZ1A 4JEVA 4RJYA 3FFHA 4W1XA 2D66A 4WYEA 3QGUA 3OKSA 5AX8A 1D7VA 1SPAA 3P1TA 2QB2A 1YJSA 1M4NA 3K40A 1M0QA 1X0MA 1CJ0A 4EB7A 3QN6A 1BJOA 1ASBA 4AZKA 3HL2A 4P7YA 1LS3A 1WSTA 4OYTA 1FG3A 3E2ZA 2DGMA 4UHNA 4Y0DA 3B8XA 1S09A 1FC4A 1G4XA 1SVVA 1AICA 1LC7A 2HUFA 1P3WA 2BI5A 2D63A 2QMAA 2VGVA 3EI8A 3GZCA 2JJFA 1CQ7A 3JWAA 3M5UA 3WLXA 2GSAA 3T32A 3AEJC 4ADEA 2YKVA 2EZ2A 4HF8A 2DGLA 3PIUA 4RITA 4IYOB 5FT6A 1RVUA 1J04A 1AAMA 4IYOA 3GBXA 1AX4A 3L44A 5E5IA 3VK4A 5G09A 1AY4A 2D64A 1WYUB 1S06A 4WB0A 2EGYA 4TN4A 2W8VA 4N0BA 1TOJA 1U08A 1DTYA 4AO9A 3MC6C 4Q31A 1B8GA 3RI6A 2VMQA 2HOZA 1M0NA 2OGAA 3NRAA 2YOBA 3JW9A 5FT4A 3A9YA 2PB0A 5EFSA 2W7HA 1QGNA 3USFA 4ZM3A 5EAAA 2R5EA 3FFRA 1DGEA 1MGVA 1O61A 3CAIA 1YIZA 3MEBA 4WP0A 2ZJGA 4CBRA 3EI7A 1MDOA 2HP1A 2HOXA 1TOGA 3BCBA 2VGUA 2AY2A 3AV7A 1M0PA 2Z67A 1JS6A 4MKJA 2AATA 2OATA 1PG8A 3JTXA 1TOEA 1X28A 1RV3A 3A8UX 1BT4A 4OBUA 1YJZA 2CB1A 4JF0A 4DQ6A 2D7ZA 1ECXA 3HQTA 2CFBA 1TOKA 4IXZA 2AY4A 4ZWVA 4GSAA 5LH9A 2AY1A 2FNUA 4MQQA 3ASBA 4E3QA 2ZY3A 2AY5A 2OGEA 3MAUA 3NU7A 4MGRA 1S08A 2QA3A 4DBCA 1BS0A 3JWBA 3WKRA 4JE5A 2CANA 1I29A 4Y0IA 1AJRA 1VEFA 1AY5A 4MQPA 3ATHA 2CJDA 4HVKA 4XJPA 3OP7A 3NYTA 1IAXA 2X8UA 2QBTA 1V2DA 1DJUA 4R5FA 3N4SA 3N75A 2EYQA 3TQXA 1OHYA 2VMZA 2AEUA 3AEMA 4RLGA 2W8TA 2GB3A 1OATA 2VMNA 3LY1A 4GDYA 3JU7A 4ZDPA 2QSRA 1AHFA 3ISLA 3WY7A 3LVLB 4BMKA 1M32A 4GEBA 3TFTA 2W7LA 3H7FA 4A6UA 4XAUA 3RUYA 4A6TA 2VMUA 3G7QA 2D7YA 1IUGA 2BYLA 2F8JA 3BWNC 3AEOA 3HDOA 4XEWA 4M2MA 2VMVA 4L0OA 1OHWA 3PDBA 3NDNA 4MSOA 4WBTA 1AAWA 3GETA 4RM1A 3DR4A 3ELPA 4BA4A 2GMSA 3K7YA 4W5KA 5G2QA 2Z9VA 4GRXA 3AENB 5HHYA 2ZUKA 4ZAHA 3PJ0A 5BJ3A 3CQ4A 4KAMA 3TFUA 2D65A 1WKHA 2CH1A 1AHEA 1ORDA 1VP4A 2QLRA 1GEXA 1OXOA 4TV7A 2TPLA 3FVXA 3QI6A 3FQ7A 2YCNA 3KE3A 4F5LA 2FM1A 1AHYA 1W7LA 3LVMA 1ASLA 2AY8A 5JAYA 2Z1ZA 4U2HA 1SZUA 3ELEA 4EMYA 2ZY5A 4H51A 3KGXA 4N0WA 2FYFA 5F8VA 1IAYA 4J5UA 3KGWA 1J32A 3B1EA 3FD0A 2VIBA 3KKIA 4BA5A 1CZCA 1JF9A 3FRKA 2W7MA 2Z9XA 3ECDA 3II0A 4TMRA 3F9TA 1B5OA 2AEVA 1W7MA 5EUEA 4ZASA 4B98A 2BIGA 4LNJA 1D7SA 2VGTA 2OQXA 1KKPA 4XQ2A 3N0LA 2VLHA 3E77A 4E3RA 1QIRA 2YCTA 3MAFB 2W8WA 1AY8A 2CJHA 3I16A 3ZRQA 1C9CA 3BV0A 1XEYA 4ZSYA 2BWPA 2VMPA 1LC5A 3QHXA 1BQDA 3GZDA 3TCMA 2QB3A 1MDXA 1ASNA 1QJ3A 3MKJA 3BS8A 4F4EA 3RBFA 1M0OA 1ASAA 1ELQA 1PFFA 3G8MA 3LVKA 2R0TA 4Q76A 5M4BA 1AHGA 2DGKA 4NOGA 1BJ4A 5E3KA 3RCHB 4A72A 4WYDA 1FG7A 1WYUA 3ZRPA 5DX5A 3G0TA 3LWSA 4BQ0A 5M49A 1UU2A 1QZ9A 2CJGA 1E5EA 3NTJA 1Z3ZA 1AIBA 4LC3A 2ZP7A 4OCAA 2ZY2A 1IX8A 1G7XA 1AKBA 4EFFA 5KTBA 8AATA 2HP2A 3GR9A 4ZLVA 1M7YA 4P3MA 1CQ8A 4F5MA 4R8DA 1GC0A 3E2YA 1D7UA 3QM2A 4Y0HA 2DKJA 3WZFA 4OTLA 5EQCA 3F6TA 3R4TA 3TATA 1TOIA 3H14A 2Z9WA 2FQ6A 2VMXA 1RVYA 2XH1A 4XJLA 5F9SA 1IBJA 1ASMA 2WKAA 3R9AA 4PIWA 1TATA 3EI9A 3BWOA 5D95A 1SF2A 3E6GA 1O62A 3LVJA 1AKAA 1ZC9A 1E5FA 2R5CB 3GJUA 1KL2A 2ZC0A 4CBSA 2Q7WA 3H9XA 4CVQA 3B1CA 1DGDA 3DXWA 3PDXA 4MKKA 4RIZA 1BJWA 4A0RA 4ZDOA 4B9BA 1S07A 2YHKA 4WYAA 1VJOA 2X3LA 3MADA 1AIAA 2CTZA 3FZ8A 1ELUA 4UQVA 2DR1A 1C0NA 3A2BA 1ARTA 3DR7A 3HLMA 4WD2A 3P6KA 2JISA 3EI5A 3FQ8A 4PFFA 3BCXA 2VMRA 9AATA 3FVSA 5M46A 1MAPA 2D5YA 4WXBA 3ACZA 3PA9A 2FKIA 4E77A 2O7CA 3FQAA 4ATPA 3F0HA 1H1CA 1IVRA 1UU1A 2V0YA 2WB6A 2GMUA 4UHOA 4AZJA 1YAAA 2ZSLA 2AY9A 2HUIA 2HZPA 4H63Q 4IXSA 2VMSA 4RKDA 5G2PA 2HORA 7AATA 2VGWA 2YRIA 1CL1A 1DJ9A 1OHVA 4GE9A 1ASCA 4I8AA 4F5JA 2Z9UA 3AEMC 1PMOA 3HVYA 1D7RA 5DB5A 5DJ1A 4IXOA 5G4IA 3CBFA 3DC1A 3ZZKA 4FFCA 4OMAA 3AENA 4JE5D 3W1HA 2W7IA 4PVFA 2BWOA 3GSBA 5EIGB 4A00A 3W1IA 2VI8A 3PAAA 4A0GA 4KXKA 1GCKA 2Z1YA 4FL0A 2VMTA 4JEWA 3K28A 2WK7A 3FTBA 4XJOA 4RKCA 3FDBA 1WYVB 2AY3A 1B9IA 1AJSB 4AH3A 1YOOA 4QGRA 3DXVA 4A6RA 3ZZJA 2R2NA 2E54A 5DJ9A 2VIAA 4ATQA 3E9KA 4K2MA 1IX6A 2CSTA 1EQBA 2X5DA 3PD6B 1I48A 1G7WA 3UE8A 2PB2A 4Q6RA 4JEZA 1AMQA 1YNUA 1KMJA 1QITA 4J8LA 2EZ1A 3NX3A 3A9XA 1LK9A 1AKCA 3BN1A 3VAXA 3FCRA 4IW7A 2GQNA 4BHDA 2CH2A 4A0HA 5G0AA 2VGZA 3EIAA 4JF1A 3WX9A 3N7NA 3NUIA 5LHAA 2FNIA 2XBNA 4W1VA 5FT5A 1B4XA 1B5PA 3EIBA 3MAFA 4LW2A 2YKUA 3D6KA 2VYCA 2W7JA 2BHXA 2EO5A 4R2NA 1N8PA 5M4DA 2JJGA 2O1BA 4R5ZA 3AEJA 3I4JA 1I43A 4OT8A 1MAQA 2BWNA 3VK3A 4CXQA 3CQ5A 3MBBA 4DGTA 1DFOA 2HUUA 1BJOB 4IX8A 1G4VA 4OC9A 5BJ4A 3BC8A 3GWPA 2KFPA 1GBNA 3RCHA 3NUBA 3AEPA 3NNKA 1XI9A 3E2ZB 3NYUA 4M2JA 4KYOA 4F5IA 2W7EA 1C7GA 1V2EA 3MC6A 1GEWA 1D2FA 3LG0A 1Y4IA 4WLJA 1AMRA 1LC8A 3AOWA 3Q8NA 3VOMA 3GZDC 1KAFA 4O6ZA 3UWCA 2W7GA 2C0RA 2WK8A 3JZLA 4WYGA 5G4JA 3WKSA 1LW4A 4WXFA 5EUDA 4K05A 4CXRA 1AMAA 4ADDA 2ZSMA 4F5KA 2FN6A 5HXXA 1MLZA 1TASA 1WKGA 3HBXA 5HDMA 4XJMA 3ASAA 3EI6A 3NYSA 4WB0B 1BJNA 2E7UA 1ZODA 4W91A 1YIYA 3VK2A 4F5GA 3IHJA 4ISYA 4UOYA 1W23A 2BI3A 1YJYA 5EAVA 5C6UA 1C7NA 1OXPA 3B46A 4MQRA 2DOUA 4JEXA 4JEYA 4ZSWA 2R5CA 1UU0A 4M2KA 2VGSA 1BW0A 2W8UA 2G6WA 3LV2A 3FSLA 2W7DA 4LNLA 1W7NA 1ARIA 3W1JA 2PO3A 2W8JA 3FZ6A 4OBVA 3VP6A 3N4RA 4PFNA 3FVUA 2E7JA 2RFVA 4XK1A 4ZWMA 3NU8A 4GE4A 4K2IA 2OKJA 1DKAA 2X5FA 4EB5A 1SZSA 1CS1A 1C7OA 2CY8A 2EPJA 2YKYA 3A9ZA 3E2FA 4LNMA 5TF5A 1JS3A 1MDZA 2EH6A 2C44A 5E4ZA 4WLHA 3EUCA 3QPGA 4ZDLA 3WCNA 1GC3A 1UKJA 1GDEA 2CINA 1O4SA 1M6SA 4ADBA 1S0AA 3DYDA 1KL1A 2D61A 2JJEA 1CZEA 3QBOA 2A1VA 4F5FA 2JG2A 5EUNA 4U1TA 3ZRRA 5K8BA 4RAEA 4MY5A 3HT4A 1LKCA 2VMOA 5IWQA 2BI2A 1GC4A 2W7FA 4A0FA 3BWNA 2BIAA 1SZKA 1AMSA 2W7KA 4E1OA 3AELA 1CQ6A 5I92A 1ASEA 4ADCA 1SFFA 2V1PA 1I41A 1X2AA 4LW4A 3WGCA 2C7TA 1GEYA 3CQ6A 4GE7A 4WYCA 1BKGA 1JG8A 1O69A 1V72A 2OKKA 2VMWA 4EU1A 1CL2A 2VMYA 3BCAA 3FZ7A 1ASDA 2JGTA 4UHMA 3UAKA 1PMMA 1TPLA 3EZSA 3FDDA 5EIGA 1DJEA 1EJIA 1KMKA 1ZOBA 3DODA 3FKDA 4RJ0A 3RBLA 2BI9A 2ORDA 1IJIA 1KKJA 1LW5A 3PPLA 5D5SA 2JJHA 3PDBB 1ARHA 4ITXA 1ARSA 3IF2A 2ZY4A 1WYVA 1RV4A 1AJSA 2C81A 3DU4A 1ARGA 3AATA 4W1WA 1Z7DA 4K2BA 4W8IA 3COGA 2VI9A 4ZM4A 1IX7A
chains in the Genus database with same CATH topology
2NMPA 2BI1A 2G7JA 4AOAA 1V2FA 2YKXA 1GD9A 3RQ1A 3B1DA 3DZZA 5J8QA 4F5HA 3PD6A 4AO4A 1AHXA 1ASGA 1X29A 2AY7A 2Z61A 1N31A 4ITGA 3HMUA 4WXGA 4Q75A 2BIEA 2DKBA 2YRRA 1W3UA 1GC2A 1QJ5A 2O0RA 1H0CA 3BB8A 2AY6A 2HOYA 2WK9A 1BQAA 3I5TA 3L8AA 3WCOA 1WYTB 2ZYJA 3PGYA 3N4XA 1WYTA 4IY7A 1B9HA 3DRDA 3AOVA 4WYFA 1EG5A 2BKWA 1TARA 3WGBA 1QISA 2Z20A 2VLFA 1T3IA 3N5MA 5FT8A 1C4KA 1MLYA 2BYJA 1ASFA 1N2TA 2E7IA 2YCPA 3EZ1A 4JEVA 4RJYA 3FFHA 4W1XA 2D66A 4WYEA 3QGUA 3OKSA 5AX8A 1D7VA 1SPAA 3P1TA 2QB2A 1YJSA 1M4NA 3K40A 1M0QA 1X0MA 1CJ0A 4EB7A 3QN6A 1BJOA 1ASBA 4AZKA 3HL2A 4P7YA 1LS3A 1WSTA 4OYTA 1FG3A 3E2ZA 2DGMA 4UHNA 4Y0DA 3B8XA 1S09A 1FC4A 1G4XA 1SVVA 1AICA 1LC7A 2HUFA 1P3WA 2BI5A 2D63A 2QMAA 2VGVA 3EI8A 3GZCA 2JJFA 1CQ7A 3JWAA 3M5UA 3WLXA 2GSAA 3T32A 3AEJC 4ADEA 2YKVA 2EZ2A 4HF8A 2DGLA 3PIUA 4RITA 4IYOB 5FT6A 1RVUA 1J04A 1AAMA 4IYOA 3GBXA 1AX4A 3L44A 5E5IA 3VK4A 5G09A 1AY4A 2D64A 1WYUB 1S06A 4WB0A 2EGYA 4TN4A 2W8VA 4N0BA 1TOJA 1U08A 1DTYA 4AO9A 3MC6C 4Q31A 1B8GA 3RI6A 2VMQA 2HOZA 1M0NA 2OGAA 3NRAA 2YOBA 3JW9A 5FT4A 3A9YA 2PB0A 5EFSA 2W7HA 1QGNA 3USFA 4ZM3A 5EAAA 2R5EA 3FFRA 1DGEA 1MGVA 1O61A 3CAIA 1YIZA 3MEBA 4WP0A 2ZJGA 4CBRA 3EI7A 1MDOA 2HP1A 2HOXA 1TOGA 3BCBA 2VGUA 2AY2A 3AV7A 1M0PA 2Z67A 1JS6A 4MKJA 2AATA 2OATA 1PG8A 3JTXA 1TOEA 1X28A 1RV3A 3A8UX 1BT4A 4OBUA 1YJZA 2CB1A 4JF0A 4DQ6A 2D7ZA 1ECXA 3HQTA 2CFBA 1TOKA 4IXZA 2AY4A 4ZWVA 4GSAA 5LH9A 2AY1A 2FNUA 4MQQA 3ASBA 4E3QA 2ZY3A 2AY5A 2OGEA 3MAUA 3NU7A 4MGRA 1S08A 2QA3A 4DBCA 1BS0A 3JWBA 3WKRA 4JE5A 2CANA 1I29A 4Y0IA 1AJRA 1VEFA 1AY5A 4MQPA 3ATHA 2CJDA 4HVKA 4XJPA 3OP7A 3NYTA 1IAXA 2X8UA 2QBTA 1V2DA 1DJUA 4R5FA 3N4SA 3N75A 2EYQA 3TQXA 1OHYA 2VMZA 2AEUA 3AEMA 4RLGA 2W8TA 2GB3A 1OATA 2VMNA 3LY1A 4GDYA 3JU7A 4ZDPA 2QSRA 1AHFA 3ISLA 3WY7A 3LVLB 4BMKA 1M32A 4GEBA 3TFTA 2W7LA 3H7FA 4A6UA 4XAUA 3RUYA 4A6TA 2VMUA 3G7QA 2D7YA 1IUGA 2BYLA 2F8JA 3BWNC 3AEOA 3HDOA 4XEWA 4M2MA 2VMVA 4L0OA 1OHWA 3PDBA 3NDNA 4MSOA 4WBTA 1AAWA 3GETA 4RM1A 3DR4A 3ELPA 4BA4A 2GMSA 3K7YA 4W5KA 5G2QA 2Z9VA 4GRXA 3AENB 5HHYA 2ZUKA 4ZAHA 3PJ0A 5BJ3A 3CQ4A 4KAMA 3TFUA 2D65A 1WKHA 2CH1A 1AHEA 1ORDA 1VP4A 2QLRA 1GEXA 1OXOA 4TV7A 2TPLA 3FVXA 3QI6A 3FQ7A 2YCNA 3KE3A 4F5LA 2FM1A 1AHYA 1W7LA 3LVMA 1ASLA 2AY8A 5JAYA 2Z1ZA 4U2HA 1SZUA 3ELEA 4EMYA 2ZY5A 4H51A 3KGXA 4N0WA 2FYFA 5F8VA 1IAYA 4J5UA 3KGWA 1J32A 3B1EA 3FD0A 2VIBA 3KKIA 4BA5A 1CZCA 1JF9A 3FRKA 2W7MA 2Z9XA 3ECDA 3II0A 4TMRA 3F9TA 1B5OA 2AEVA 1W7MA 5EUEA 4ZASA 4B98A 2BIGA 4LNJA 1D7SA 2VGTA 2OQXA 1KKPA 4XQ2A 3N0LA 2VLHA 3E77A 4E3RA 1QIRA 2YCTA 3MAFB 2W8WA 1AY8A 2CJHA 3I16A 3ZRQA 1C9CA 3BV0A 1XEYA 4ZSYA 2BWPA 2VMPA 1LC5A 3QHXA 1BQDA 3GZDA 3TCMA 2QB3A 1MDXA 1ASNA 1QJ3A 3MKJA 3BS8A 4F4EA 3RBFA 1M0OA 1ASAA 1ELQA 1PFFA 3G8MA 3LVKA 2R0TA 4Q76A 5M4BA 1AHGA 2DGKA 4NOGA 1BJ4A 5E3KA 3RCHB 4A72A 4WYDA 1FG7A 1WYUA 3ZRPA 5DX5A 3G0TA 3LWSA 4BQ0A 5M49A 1UU2A 1QZ9A 2CJGA 1E5EA 3NTJA 1Z3ZA 1AIBA 4LC3A 2ZP7A 4OCAA 2ZY2A 1IX8A 1G7XA 1AKBA 4EFFA 5KTBA 8AATA 2HP2A 3GR9A 4ZLVA 1M7YA 4P3MA 1CQ8A 4F5MA 4R8DA 1GC0A 3E2YA 1D7UA 3QM2A 4Y0HA 2DKJA 3WZFA 4OTLA 5EQCA 3F6TA 3R4TA 3TATA 1TOIA 3H14A 2Z9WA 2FQ6A 2VMXA 1RVYA 2XH1A 4XJLA 5F9SA 1IBJA 1ASMA 2WKAA 3R9AA 4PIWA 1TATA 3EI9A 3BWOA 5D95A 1SF2A 3E6GA 1O62A 3LVJA 1AKAA 1ZC9A 1E5FA 2R5CB 3GJUA 1KL2A 2ZC0A 4CBSA 2Q7WA 3H9XA 4CVQA 3B1CA 1DGDA 3DXWA 3PDXA 4MKKA 4RIZA 1BJWA 4A0RA 4ZDOA 4B9BA 1S07A 2YHKA 4WYAA 1VJOA 2X3LA 3MADA 1AIAA 2CTZA 3FZ8A 1ELUA 4UQVA 2DR1A 1C0NA 3A2BA 1ARTA 3DR7A 3HLMA 4WD2A 3P6KA 2JISA 3EI5A 3FQ8A 4PFFA 3BCXA 2VMRA 9AATA 3FVSA 5M46A 1MAPA 2D5YA 4WXBA 3ACZA 3PA9A 2FKIA 4E77A 2O7CA 3FQAA 4ATPA 3F0HA 1H1CA 1IVRA 1UU1A 2V0YA 2WB6A 2GMUA 4UHOA 4AZJA 1YAAA 2ZSLA 2AY9A 2HUIA 2HZPA 4H63Q 4IXSA 2VMSA 4RKDA 5G2PA 2HORA 7AATA 2VGWA 2YRIA 1CL1A 1DJ9A 1OHVA 4GE9A 1ASCA 4I8AA 4F5JA 2Z9UA 3AEMC 1PMOA 3HVYA 1D7RA 5DB5A 5DJ1A 4IXOA 5G4IA 3CBFA 3DC1A 3ZZKA 4FFCA 4OMAA 3AENA 4JE5D 3W1HA 2W7IA 4PVFA 2BWOA 3GSBA 5EIGB 4A00A 3W1IA 2VI8A 3PAAA 4A0GA 4KXKA 1GCKA 2Z1YA 4FL0A 2VMTA 4JEWA 3K28A 2WK7A 3FTBA 4XJOA 4RKCA 3FDBA 1WYVB 2AY3A 1B9IA 1AJSB 4AH3A 1YOOA 4QGRA 3DXVA 4A6RA 3ZZJA 2R2NA 2E54A 5DJ9A 2VIAA 4ATQA 3E9KA 4K2MA 1IX6A 2CSTA 1EQBA 2X5DA 3PD6B 1I48A 1G7WA 3UE8A 2PB2A 4Q6RA 4JEZA 1AMQA 1YNUA 1KMJA 1QITA 4J8LA 2EZ1A 3NX3A 3A9XA 1LK9A 1AKCA 3BN1A 3VAXA 3FCRA 4IW7A 2GQNA 4BHDA 2CH2A 4A0HA 5G0AA 2VGZA 3EIAA 4JF1A 3WX9A 3N7NA 3NUIA 5LHAA 2FNIA 2XBNA 4W1VA 5FT5A 1B4XA 1B5PA 3EIBA 3MAFA 4LW2A 2YKUA 3D6KA 2VYCA 2W7JA 2BHXA 2EO5A 4R2NA 1N8PA 5M4DA 2JJGA 2O1BA 4R5ZA 3AEJA 3I4JA 1I43A 4OT8A 1MAQA 2BWNA 3VK3A 4CXQA 3CQ5A 3MBBA 4DGTA 1DFOA 2HUUA 1BJOB 4IX8A 1G4VA 4OC9A 5BJ4A 3BC8A 3GWPA 2KFPA 1GBNA 3RCHA 3NUBA 3AEPA 3NNKA 1XI9A 3E2ZB 3NYUA 4M2JA 4KYOA 4F5IA 2W7EA 1C7GA 1V2EA 3MC6A 1GEWA 1D2FA 3LG0A 1Y4IA 4WLJA 1AMRA 1LC8A 3AOWA 3Q8NA 3VOMA 3GZDC 4O6ZA 3UWCA 2W7GA 2C0RA 2WK8A 3JZLA 4WYGA 5G4JA 3WKSA 1LW4A 4WXFA 5EUDA 4K05A 4CXRA 1AMAA 4ADDA 2ZSMA 4F5KA 2FN6A 5HXXA 1MLZA 1TASA 1WKGA 3HBXA 5HDMA 4XJMA 3ASAA 3EI6A 3NYSA 4WB0B 1BJNA 2E7UA 1ZODA 4W91A 1YIYA 3VK2A 4F5GA 3IHJA 4ISYA 4UOYA 1W23A 2BI3A 1YJYA 5EAVA 5C6UA 1C7NA 1OXPA 3B46A 4MQRA 2DOUA 4JEXA 4JEYA 4ZSWA 2R5CA 1UU0A 4M2KA 2VGSA 1BW0A 2W8UA 2G6WA 3LV2A 3FSLA 2W7DA 4LNLA 1W7NA 1ARIA 3W1JA 2PO3A 2W8JA 3FZ6A 4OBVA 3VP6A 3N4RA 4PFNA 3FVUA 2E7JA 2RFVA 4XK1A 4ZWMA 3NU8A 4GE4A 4K2IA 2OKJA 1DKAA 2X5FA 4EB5A 1SZSA 1CS1A 1C7OA 2CY8A 2EPJA 2YKYA 3A9ZA 3E2FA 4LNMA 5TF5A 1JS3A 1MDZA 2EH6A 2C44A 5E4ZA 4WLHA 3EUCA 3QPGA 4ZDLA 3WCNA 1GC3A 1UKJA 1GDEA 2CINA 1O4SA 1M6SA 4ADBA 1S0AA 3DYDA 1KL1A 2D61A 2JJEA 1CZEA 3QBOA 2A1VA 4F5FA 2JG2A 5EUNA 4U1TA 3ZRRA 5K8BA 4RAEA 4MY5A 3HT4A 1LKCA 2VMOA 5IWQA 2BI2A 1GC4A 2W7FA 4A0FA 3BWNA 2BIAA 1SZKA 1AMSA 2W7KA 4E1OA 3AELA 1CQ6A 5I92A 1ASEA 4ADCA 1SFFA 2V1PA 1I41A 1X2AA 4LW4A 3WGCA 2C7TA 1GEYA 3CQ6A 4GE7A 4WYCA 1BKGA 1JG8A 1O69A 1V72A 2OKKA 2VMWA 4EU1A 1CL2A 2VMYA 3BCAA 3FZ7A 1ASDA 2JGTA 4UHMA 3UAKA 1PMMA 1TPLA 3EZSA 3FDDA 5EIGA 1DJEA 1EJIA 1KMKA 1ZOBA 3DODA 3FKDA 4RJ0A 3RBLA 2BI9A 2ORDA 1IJIA 1KKJA 1LW5A 3PPLA 5D5SA 2JJHA 3PDBB 1ARHA 4ITXA 1ARSA 3IF2A 2ZY4A 1WYVA 1RV4A 1AJSA 2C81A 3DU4A 1ARGA 3AATA 4W1WA 1Z7DA 4K2BA 4W8IA 3COGA 2VI9A 4ZM4A 1IX7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NMP A;  2BI1 A;  4AOA A;  1V2F A;  2YKX A;  1GD9 A;  3RQ1 A;  3B1D A;  3DZZ A;  5J8Q A;  4F5H A;  3PD6 A;  4AO4 A;  1AHX A;  1ASG A;  1X29 A;  2AY7 A;  2Z61 A;  1N31 A;  4ITG A;  3HMU A;  4WXG A;  4Q75 A;  2BIE A;  2DKB A;  2YRR A;  1W3U A;  1GC2 A;  1QJ5 A;  2O0R A;  1H0C A;  3BB8 A;  2AY6 A;  2HOY A;  2WK9 A;  1BQA A;  3I5T A;  3L8A A;  3WCO A;  1WYT B;  2ZYJ A;  3PGY A;  1WYT A;  4IY7 A;  1B9H A;  3DRD A;  3AOV A;  4WYF A;  1EG5 A;  2BKW A;  1TAR A;  3WGB A;  1QIS A;  2Z20 A;  2VLF A;  1T3I A;  3N5M A;  5FT8 A;  1C4K A;  1MLY A;  2BYJ A;  1ASF A;  1N2T A;  2E7I A;  2YCP A;  3EZ1 A;  4JEV A;  4RJY A;  3FFH A;  4W1X A;  2D66 A;  4WYE A;  3QGU A;  3OKS A;  5AX8 A;  1D7V A;  1SPA A;  3P1T A;  2QB2 A;  1YJS A;  1M4N A;  3K40 A;  1M0Q A;  1X0M A;  1CJ0 A;  4EB7 A;  3QN6 A;  1BJO A;  1ASB A;  4AZK A;  3HL2 A;  4P7Y A;  1LS3 A;  1WST A;  4OYT A;  1FG3 A;  3E2Z A;  2DGM A;  4UHN A;  4Y0D A;  3B8X A;  1S09 A;  1FC4 A;  1G4X A;  1SVV A;  1AIC A;  1LC7 A;  2HUF A;  1P3W A;  2BI5 A;  2D63 A;  2QMA A;  2VGV A;  3EI8 A;  3GZC A;  2JJF A;  1CQ7 A;  3JWA A;  3M5U A;  3WLX A;  2GSA A;  3T32 A;  3AEJ C;  4ADE A;  2YKV A;  2EZ2 A;  4HF8 A;  2DGL A;  3PIU A;  4RIT A;  4IYO B;  5FT6 A;  1RVU A;  1J04 A;  1AAM A;  4IYO A;  3GBX A;  1AX4 A;  3L44 A;  5E5I A;  3VK4 A;  5G09 A;  1AY4 A;  2D64 A;  1WYU B;  1S06 A;  4WB0 A;  2EGY A;  4TN4 A;  2W8V A;  4N0B A;  1TOJ A;  1U08 A;  1DTY A;  4AO9 A;  3MC6 C;  4Q31 A;  1B8G A;  3RI6 A;  2VMQ A;  2HOZ A;  1M0N A;  2OGA A;  3NRA A;  2YOB A;  3JW9 A;  5FT4 A;  3A9Y A;  2PB0 A;  5EFS A;  2W7H A;  1QGN A;  3USF A;  4ZM3 A;  5EAA A;  2R5E A;  3FFR A;  1DGE A;  1MGV A;  1O61 A;  3CAI A;  1YIZ A;  3MEB A;  4WP0 A;  2ZJG A;  4CBR A;  3EI7 A;  1MDO A;  2HP1 A;  2HOX A;  1TOG A;  3BCB A;  2VGU A;  2AY2 A;  3AV7 A;  1M0P A;  2Z67 A;  1JS6 A;  4MKJ A;  2AAT A;  2OAT A;  1PG8 A;  3JTX A;  1TOE A;  1X28 A;  1RV3 A;  3A8U X;  1BT4 A;  4OBU A;  1YJZ A;  2CB1 A;  4JF0 A;  4DQ6 A;  2D7Z A;  1ECX A;  3HQT A;  2CFB A;  1TOK A;  4IXZ A;  2AY4 A;  4ZWV A;  4GSA A;  5LH9 A;  2AY1 A;  2FNU A;  4MQQ A;  3ASB A;  4E3Q A;  2ZY3 A;  2AY5 A;  2OGE A;  3MAU A;  3NU7 A;  4MGR A;  1S08 A;  2QA3 A;  4DBC A;  1BS0 A;  3JWB A;  3WKR A;  4JE5 A;  2CAN A;  1I29 A;  4Y0I A;  1AJR A;  1VEF A;  1AY5 A;  4MQP A;  3ATH A;  2CJD A;  4HVK A;  4XJP A;  3OP7 A;  3NYT A;  1IAX A;  2X8U A;  2QBT A;  1V2D A;  1DJU A;  4R5F A;  3N75 A;  3TQX A;  1OHY A;  2VMZ A;  2AEU A;  3AEM A;  4RLG A;  2W8T A;  2GB3 A;  1OAT A;  2VMN A;  3LY1 A;  4GDY A;  3JU7 A;  4ZDP A;  1AHF A;  3ISL A;  3WY7 A;  3LVL B;  4BMK A;  1M32 A;  4GEB A;  3TFT A;  2W7L A;  3H7F A;  4A6U A;  4XAU A;  3RUY A;  4A6T A;  2VMU A;  3G7Q A;  2D7Y A;  1IUG A;  2BYL A;  2F8J A;  3BWN C;  3AEO A;  3HDO A;  4XEW A;  4M2M A;  2VMV A;  4L0O A;  1OHW A;  3PDB A;  3NDN A;  4MSO A;  4WBT A;  1AAW A;  3GET A;  4RM1 A;  3DR4 A;  3ELP A;  4BA4 A;  2GMS A;  3K7Y A;  4W5K A;  5G2Q A;  2Z9V A;  4GRX A;  3AEN B;  5HHY A;  2ZUK A;  4ZAH A;  3PJ0 A;  5BJ3 A;  3CQ4 A;  4KAM A;  3TFU A;  2D65 A;  1WKH A;  2CH1 A;  1AHE A;  1ORD A;  1VP4 A;  2QLR A;  1GEX A;  1OXO A;  4TV7 A;  2TPL A;  3FVX A;  3QI6 A;  3FQ7 A;  2YCN A;  3KE3 A;  4F5L A;  2FM1 A;  1AHY A;  1W7L A;  3LVM A;  1ASL A;  2AY8 A;  5JAY A;  2Z1Z A;  4U2H A;  1SZU A;  3ELE A;  4EMY A;  2ZY5 A;  4H51 A;  3KGX A;  4N0W A;  2FYF A;  5F8V A;  1IAY A;  4J5U A;  3KGW A;  1J32 A;  3B1E A;  3FD0 A;  2VIB A;  3KKI A;  4BA5 A;  1CZC A;  1JF9 A;  3FRK A;  2W7M A;  2Z9X A;  3ECD A;  3II0 A;  4TMR A;  3F9T A;  1B5O A;  2AEV A;  1W7M A;  5EUE A;  4ZAS A;  4B98 A;  2BIG A;  4LNJ A;  1D7S A;  2VGT A;  2OQX A;  1KKP A;  4XQ2 A;  3N0L A;  2VLH A;  3E77 A;  4E3R A;  1QIR A;  2YCT A;  3MAF B;  2W8W A;  1AY8 A;  2CJH A;  3I16 A;  3ZRQ A;  1C9C A;  3BV0 A;  1XEY A;  4ZSY A;  2BWP A;  2VMP A;  1LC5 A;  3QHX A;  1BQD A;  3GZD A;  3TCM A;  2QB3 A;  1MDX A;  1ASN A;  1QJ3 A;  3MKJ A;  3BS8 A;  4F4E A;  3RBF A;  1M0O A;  1ASA A;  1ELQ A;  1PFF A;  3G8M A;  3LVK A;  2R0T A;  4Q76 A;  5M4B A;  1AHG A;  2DGK A;  4NOG A;  1BJ4 A;  5E3K A;  3RCH B;  4A72 A;  4WYD A;  1FG7 A;  1WYU A;  3ZRP A;  5DX5 A;  3G0T A;  3LWS A;  4BQ0 A;  5M49 A;  1UU2 A;  1QZ9 A;  2CJG A;  1E5E A;  3NTJ A;  1Z3Z A;  1AIB A;  4LC3 A;  2ZP7 A;  4OCA A;  2ZY2 A;  1IX8 A;  1G7X A;  1AKB A;  4EFF A;  8AAT A;  2HP2 A;  3GR9 A;  4ZLV A;  1M7Y A;  4P3M A;  1CQ8 A;  4F5M A;  4R8D A;  1GC0 A;  3E2Y A;  1D7U A;  3QM2 A;  4Y0H A;  2DKJ A;  3WZF A;  4OTL A;  5EQC A;  3F6T A;  3R4T A;  3TAT A;  1TOI A;  3H14 A;  2Z9W A;  2FQ6 A;  2VMX A;  1RVY A;  2XH1 A;  4XJL A;  5F9S A;  1IBJ A;  1ASM A;  2WKA A;  3R9A A;  4PIW A;  1TAT A;  3EI9 A;  3BWO A;  5D95 A;  1SF2 A;  3E6G A;  1O62 A;  3LVJ A;  1AKA A;  1ZC9 A;  1E5F A;  2R5C B;  3GJU A;  1KL2 A;  2ZC0 A;  4CBS A;  2Q7W A;  4CVQ A;  3B1C A;  1DGD A;  3DXW A;  3PDX A;  4MKK A;  4RIZ A;  1BJW A;  4A0R A;  4ZDO A;  4B9B A;  1S07 A;  2YHK A;  4WYA A;  1VJO A;  2X3L A;  3MAD A;  1AIA A;  2CTZ A;  3FZ8 A;  1ELU A;  4UQV A;  2DR1 A;  1C0N A;  3A2B A;  1ART A;  3DR7 A;  3HLM A;  4WD2 A;  3P6K A;  2JIS A;  3EI5 A;  3FQ8 A;  4PFF A;  3BCX A;  2VMR A;  9AAT A;  3FVS A;  5M46 A;  1MAP A;  2D5Y A;  4WXB A;  3ACZ A;  3PA9 A;  4E77 A;  2O7C A;  3FQA A;  4ATP A;  3F0H A;  1H1C A;  1IVR A;  1UU1 A;  2V0Y A;  2GMU A;  4UHO A;  4AZJ A;  1YAA A;  2ZSL A;  2AY9 A;  2HUI A;  2HZP A;  4IXS A;  2VMS A;  4RKD A;  5G2P A;  2HOR A;  7AAT A;  2VGW A;  2YRI A;  1CL1 A;  1DJ9 A;  1OHV A;  4GE9 A;  1ASC A;  4I8A A;  4F5J A;  2Z9U A;  3AEM C;  1PMO A;  3HVY A;  1D7R A;  5DB5 A;  5DJ1 A;  4IXO A;  5G4I A;  3CBF A;  3DC1 A;  3ZZK A;  4FFC A;  4OMA A;  3AEN A;  4JE5 D;  3W1H A;  2W7I A;  4PVF A;  2BWO A;  3GSB A;  5EIG B;  4A00 A;  3W1I A;  2VI8 A;  3PAA A;  4A0G A;  4KXK A;  1GCK A;  2Z1Y A;  4FL0 A;  2VMT A;  4JEW A;  3K28 A;  2WK7 A;  3FTB A;  4XJO A;  4RKC A;  3FDB A;  1WYV B;  2AY3 A;  1B9I A;  1AJS B;  4AH3 A;  1YOO A;  4QGR A;  3DXV A;  4A6R A;  3ZZJ A;  2R2N A;  2E54 A;  5DJ9 A;  2VIA A;  4ATQ A;  3E9K A;  4K2M A;  1IX6 A;  2CST A;  1EQB A;  2X5D A;  3PD6 B;  1I48 A;  1G7W A;  3UE8 A;  2PB2 A;  4Q6R A;  4JEZ A;  1AMQ A;  1YNU A;  1KMJ A;  1QIT A;  4J8L A;  2EZ1 A;  3NX3 A;  3A9X A;  1LK9 A;  1AKC A;  3BN1 A;  3VAX A;  3FCR A;  4IW7 A;  2GQN A;  4BHD A;  2CH2 A;  4A0H A;  5G0A A;  2VGZ A;  3EIA A;  4JF1 A;  3WX9 A;  3NUI A;  5LHA A;  2FNI A;  2XBN A;  4W1V A;  5FT5 A;  1B4X A;  1B5P A;  3EIB A;  3MAF A;  4LW2 A;  2YKU A;  3D6K A;  2VYC A;  2W7J A;  2BHX A;  2EO5 A;  4R2N A;  1N8P A;  5M4D A;  2JJG A;  2O1B A;  4R5Z A;  3AEJ A;  3I4J A;  1I43 A;  4OT8 A;  1MAQ A;  2BWN A;  3VK3 A;  4CXQ A;  3CQ5 A;  3MBB A;  4DGT A;  1DFO A;  2HUU A;  1BJO B;  4IX8 A;  1G4V A;  4OC9 A;  5BJ4 A;  3BC8 A;  3GWP A;  1GBN A;  3RCH A;  3NUB A;  3AEP A;  3NNK A;  1XI9 A;  3E2Z B;  3NYU A;  4M2J A;  4KYO A;  4F5I A;  2W7E A;  1C7G A;  1V2E A;  3MC6 A;  1GEW A;  1D2F A;  3LG0 A;  1Y4I A;  4WLJ A;  1AMR A;  1LC8 A;  3AOW A;  3Q8N A;  3VOM A;  3GZD C;  4O6Z A;  3UWC A;  2W7G A;  2C0R A;  2WK8 A;  3JZL A;  4WYG A;  5G4J A;  3WKS A;  1LW4 A;  4WXF A;  5EUD A;  4CXR A;  1AMA A;  4ADD A;  2ZSM A;  4F5K A;  2FN6 A;  5HXX A;  1MLZ A;  1TAS A;  1WKG A;  3HBX A;  5HDM A;  4XJM A;  3ASA A;  3EI6 A;  3NYS A;  4WB0 B;  1BJN A;  2E7U A;  1ZOD A;  4W91 A;  1YIY A;  3VK2 A;  4F5G A;  3IHJ A;  4ISY A;  4UOY A;  1W23 A;  2BI3 A;  1YJY A;  5EAV A;  5C6U A;  1C7N A;  1OXP A;  3B46 A;  4MQR A;  2DOU A;  4JEX A;  4JEY A;  4ZSW A;  2R5C A;  1UU0 A;  4M2K A;  2VGS A;  1BW0 A;  2W8U A;  2G6W A;  3LV2 A;  3FSL A;  2W7D A;  4LNL A;  1W7N A;  1ARI A;  3W1J A;  2PO3 A;  2W8J A;  3FZ6 A;  4OBV A;  3VP6 A;  4PFN A;  3FVU A;  2E7J A;  2RFV A;  4XK1 A;  4ZWM A;  3NU8 A;  4GE4 A;  4K2I A;  2OKJ A;  1DKA A;  2X5F A;  4EB5 A;  1SZS A;  1CS1 A;  1C7O A;  2CY8 A;  2EPJ A;  2YKY A;  3A9Z A;  3E2F A;  4LNM A;  5TF5 A;  1JS3 A;  1MDZ A;  2EH6 A;  2C44 A;  5E4Z A;  4WLH A;  3EUC A;  3QPG A;  4ZDL A;  3WCN A;  1GC3 A;  1UKJ A;  1GDE A;  2CIN A;  1O4S A;  1M6S A;  4ADB A;  1S0A A;  3DYD A;  1KL1 A;  2D61 A;  2JJE A;  1CZE A;  3QBO A;  4F5F A;  2JG2 A;  5EUN A;  4U1T A;  3ZRR A;  5K8B A;  4RAE A;  4MY5 A;  3HT4 A;  1LKC A;  2VMO A;  5IWQ A;  2BI2 A;  1GC4 A;  2W7F A;  4A0F A;  3BWN A;  2BIA A;  1SZK A;  1AMS A;  2W7K A;  4E1O A;  3AEL A;  1CQ6 A;  5I92 A;  1ASE A;  4ADC A;  1SFF A;  2V1P A;  1I41 A;  1X2A A;  4LW4 A;  3WGC A;  2C7T A;  1GEY A;  3CQ6 A;  4GE7 A;  4WYC A;  1BKG A;  1JG8 A;  1O69 A;  1V72 A;  2OKK A;  2VMW A;  4EU1 A;  1CL2 A;  2VMY A;  3BCA A;  3FZ7 A;  1ASD A;  2JGT A;  4UHM A;  3UAK A;  1PMM A;  1TPL A;  3EZS A;  3FDD A;  5EIG A;  1DJE A;  1EJI A;  1KMK A;  1ZOB A;  3DOD A;  3FKD A;  4RJ0 A;  3RBL A;  2BI9 A;  2ORD A;  1IJI A;  1KKJ A;  1LW5 A;  3PPL A;  5D5S A;  2JJH A;  3PDB B;  1ARH A;  4ITX A;  1ARS A;  3IF2 A;  2ZY4 A;  1WYV A;  1RV4 A;  1AJS A;  2C81 A;  3DU4 A;  1ARG A;  3AAT A;  4W1W A;  1Z7D A;  4K2B A;  4W8I A;  3COG A;  2VI9 A;  4ZM4 A;  1IX7 A; 
#chains in the Genus database with same CATH topology
 2NMP A;  2BI1 A;  2G7J A;  4AOA A;  1V2F A;  2YKX A;  1GD9 A;  3RQ1 A;  3B1D A;  3DZZ A;  5J8Q A;  4F5H A;  3PD6 A;  4AO4 A;  1AHX A;  1ASG A;  1X29 A;  2AY7 A;  2Z61 A;  1N31 A;  4ITG A;  3HMU A;  4WXG A;  4Q75 A;  2BIE A;  2DKB A;  2YRR A;  1W3U A;  1GC2 A;  1QJ5 A;  2O0R A;  1H0C A;  3BB8 A;  2AY6 A;  2HOY A;  2WK9 A;  1BQA A;  3I5T A;  3L8A A;  3WCO A;  1WYT B;  2ZYJ A;  3PGY A;  3N4X A;  1WYT A;  4IY7 A;  1B9H A;  3DRD A;  3AOV A;  4WYF A;  1EG5 A;  2BKW A;  1TAR A;  3WGB A;  1QIS A;  2Z20 A;  2VLF A;  1T3I A;  3N5M A;  5FT8 A;  1C4K A;  1MLY A;  2BYJ A;  1ASF A;  1N2T A;  2E7I A;  2YCP A;  3EZ1 A;  4JEV A;  4RJY A;  3FFH A;  4W1X A;  2D66 A;  4WYE A;  3QGU A;  3OKS A;  5AX8 A;  1D7V A;  1SPA A;  3P1T A;  2QB2 A;  1YJS A;  1M4N A;  3K40 A;  1M0Q A;  1X0M A;  1CJ0 A;  4EB7 A;  3QN6 A;  1BJO A;  1ASB A;  4AZK A;  3HL2 A;  4P7Y A;  1LS3 A;  1WST A;  4OYT A;  1FG3 A;  3E2Z A;  2DGM A;  4UHN A;  4Y0D A;  3B8X A;  1S09 A;  1FC4 A;  1G4X A;  1SVV A;  1AIC A;  1LC7 A;  2HUF A;  1P3W A;  2BI5 A;  2D63 A;  2QMA A;  2VGV A;  3EI8 A;  3GZC A;  2JJF A;  1CQ7 A;  3JWA A;  3M5U A;  3WLX A;  2GSA A;  3T32 A;  3AEJ C;  4ADE A;  2YKV A;  2EZ2 A;  4HF8 A;  2DGL A;  3PIU A;  4RIT A;  4IYO B;  5FT6 A;  1RVU A;  1J04 A;  1AAM A;  4IYO A;  3GBX A;  1AX4 A;  3L44 A;  5E5I A;  3VK4 A;  5G09 A;  1AY4 A;  2D64 A;  1WYU B;  1S06 A;  4WB0 A;  2EGY A;  4TN4 A;  2W8V A;  4N0B A;  1TOJ A;  1U08 A;  1DTY A;  4AO9 A;  3MC6 C;  4Q31 A;  1B8G A;  3RI6 A;  2VMQ A;  2HOZ A;  1M0N A;  2OGA A;  3NRA A;  2YOB A;  3JW9 A;  5FT4 A;  3A9Y A;  2PB0 A;  5EFS A;  2W7H A;  1QGN A;  3USF A;  4ZM3 A;  5EAA A;  2R5E A;  3FFR A;  1DGE A;  1MGV A;  1O61 A;  3CAI A;  1YIZ A;  3MEB A;  4WP0 A;  2ZJG A;  4CBR A;  3EI7 A;  1MDO A;  2HP1 A;  2HOX A;  1TOG A;  3BCB A;  2VGU A;  2AY2 A;  3AV7 A;  1M0P A;  2Z67 A;  1JS6 A;  4MKJ A;  2AAT A;  2OAT A;  1PG8 A;  3JTX A;  1TOE A;  1X28 A;  1RV3 A;  3A8U X;  1BT4 A;  4OBU A;  1YJZ A;  2CB1 A;  4JF0 A;  4DQ6 A;  2D7Z A;  1ECX A;  3HQT A;  2CFB A;  1TOK A;  4IXZ A;  2AY4 A;  4ZWV A;  4GSA A;  5LH9 A;  2AY1 A;  2FNU A;  4MQQ A;  3ASB A;  4E3Q A;  2ZY3 A;  2AY5 A;  2OGE A;  3MAU A;  3NU7 A;  4MGR A;  1S08 A;  2QA3 A;  4DBC A;  1BS0 A;  3JWB A;  3WKR A;  4JE5 A;  2CAN A;  1I29 A;  4Y0I A;  1AJR A;  1VEF A;  1AY5 A;  4MQP A;  3ATH A;  2CJD A;  4HVK A;  4XJP A;  3OP7 A;  3NYT A;  1IAX A;  2X8U A;  2QBT A;  1V2D A;  1DJU A;  4R5F A;  3N4S A;  3N75 A;  2EYQ A;  3TQX A;  1OHY A;  2VMZ A;  2AEU A;  3AEM A;  4RLG A;  2W8T A;  2GB3 A;  1OAT A;  2VMN A;  3LY1 A;  4GDY A;  3JU7 A;  4ZDP A;  2QSR A;  1AHF A;  3ISL A;  3WY7 A;  3LVL B;  4BMK A;  1M32 A;  4GEB A;  3TFT A;  2W7L A;  3H7F A;  4A6U A;  4XAU A;  3RUY A;  4A6T A;  2VMU A;  3G7Q A;  2D7Y A;  1IUG A;  2BYL A;  2F8J A;  3BWN C;  3AEO A;  3HDO A;  4XEW A;  4M2M A;  2VMV A;  4L0O A;  1OHW A;  3PDB A;  3NDN A;  4MSO A;  4WBT A;  1AAW A;  3GET A;  4RM1 A;  3DR4 A;  3ELP A;  4BA4 A;  2GMS A;  3K7Y A;  4W5K A;  5G2Q A;  2Z9V A;  4GRX A;  3AEN B;  5HHY A;  2ZUK A;  4ZAH A;  3PJ0 A;  5BJ3 A;  3CQ4 A;  4KAM A;  3TFU A;  2D65 A;  1WKH A;  2CH1 A;  1AHE A;  1ORD A;  1VP4 A;  2QLR A;  1GEX A;  1OXO A;  4TV7 A;  2TPL A;  3FVX A;  3QI6 A;  3FQ7 A;  2YCN A;  3KE3 A;  4F5L A;  2FM1 A;  1AHY A;  1W7L A;  3LVM A;  1ASL A;  2AY8 A;  5JAY A;  2Z1Z A;  4U2H A;  1SZU A;  3ELE A;  4EMY A;  2ZY5 A;  4H51 A;  3KGX A;  4N0W A;  2FYF A;  5F8V A;  1IAY A;  4J5U A;  3KGW A;  1J32 A;  3B1E A;  3FD0 A;  2VIB A;  3KKI A;  4BA5 A;  1CZC A;  1JF9 A;  3FRK A;  2W7M A;  2Z9X A;  3ECD A;  3II0 A;  4TMR A;  3F9T A;  1B5O A;  2AEV A;  1W7M A;  5EUE A;  4ZAS A;  4B98 A;  2BIG A;  4LNJ A;  1D7S A;  2VGT A;  2OQX A;  1KKP A;  4XQ2 A;  3N0L A;  2VLH A;  3E77 A;  4E3R A;  1QIR A;  2YCT A;  3MAF B;  2W8W A;  1AY8 A;  2CJH A;  3I16 A;  3ZRQ A;  1C9C A;  3BV0 A;  1XEY A;  4ZSY A;  2BWP A;  2VMP A;  1LC5 A;  3QHX A;  1BQD A;  3GZD A;  3TCM A;  2QB3 A;  1MDX A;  1ASN A;  1QJ3 A;  3MKJ A;  3BS8 A;  4F4E A;  3RBF A;  1M0O A;  1ASA A;  1ELQ A;  1PFF A;  3G8M A;  3LVK A;  2R0T A;  4Q76 A;  5M4B A;  1AHG A;  2DGK A;  4NOG A;  1BJ4 A;  5E3K A;  3RCH B;  4A72 A;  4WYD A;  1FG7 A;  1WYU A;  3ZRP A;  5DX5 A;  3G0T A;  3LWS A;  4BQ0 A;  5M49 A;  1UU2 A;  1QZ9 A;  2CJG A;  1E5E A;  3NTJ A;  1Z3Z A;  1AIB A;  4LC3 A;  2ZP7 A;  4OCA A;  2ZY2 A;  1IX8 A;  1G7X A;  1AKB A;  4EFF A;  5KTB A;  8AAT A;  2HP2 A;  3GR9 A;  4ZLV A;  1M7Y A;  4P3M A;  1CQ8 A;  4F5M A;  4R8D A;  1GC0 A;  3E2Y A;  1D7U A;  3QM2 A;  4Y0H A;  2DKJ A;  3WZF A;  4OTL A;  5EQC A;  3F6T A;  3R4T A;  3TAT A;  1TOI A;  3H14 A;  2Z9W A;  2FQ6 A;  2VMX A;  1RVY A;  2XH1 A;  4XJL A;  5F9S A;  1IBJ A;  1ASM A;  2WKA A;  3R9A A;  4PIW A;  1TAT A;  3EI9 A;  3BWO A;  5D95 A;  1SF2 A;  3E6G A;  1O62 A;  3LVJ A;  1AKA A;  1ZC9 A;  1E5F A;  2R5C B;  3GJU A;  1KL2 A;  2ZC0 A;  4CBS A;  2Q7W A;  3H9X A;  4CVQ A;  3B1C A;  1DGD A;  3DXW A;  3PDX A;  4MKK A;  4RIZ A;  1BJW A;  4A0R A;  4ZDO A;  4B9B A;  1S07 A;  2YHK A;  4WYA A;  1VJO A;  2X3L A;  3MAD A;  1AIA A;  2CTZ A;  3FZ8 A;  1ELU A;  4UQV A;  2DR1 A;  1C0N A;  3A2B A;  1ART A;  3DR7 A;  3HLM A;  4WD2 A;  3P6K A;  2JIS A;  3EI5 A;  3FQ8 A;  4PFF A;  3BCX A;  2VMR A;  9AAT A;  3FVS A;  5M46 A;  1MAP A;  2D5Y A;  4WXB A;  3ACZ A;  3PA9 A;  2FKI A;  4E77 A;  2O7C A;  3FQA A;  4ATP A;  3F0H A;  1H1C A;  1IVR A;  1UU1 A;  2V0Y A;  2WB6 A;  2GMU A;  4UHO A;  4AZJ A;  1YAA A;  2ZSL A;  2AY9 A;  2HUI A;  2HZP A;  4H63 Q;  4IXS A;  2VMS A;  4RKD A;  5G2P A;  2HOR A;  7AAT A;  2VGW A;  2YRI A;  1CL1 A;  1DJ9 A;  1OHV A;  4GE9 A;  1ASC A;  4I8A A;  4F5J A;  2Z9U A;  3AEM C;  1PMO A;  3HVY A;  1D7R A;  5DB5 A;  5DJ1 A;  4IXO A;  5G4I A;  3CBF A;  3DC1 A;  3ZZK A;  4FFC A;  4OMA A;  3AEN A;  4JE5 D;  3W1H A;  2W7I A;  4PVF A;  2BWO A;  3GSB A;  5EIG B;  4A00 A;  3W1I A;  2VI8 A;  3PAA A;  4A0G A;  4KXK A;  1GCK A;  2Z1Y A;  4FL0 A;  2VMT A;  4JEW A;  3K28 A;  2WK7 A;  3FTB A;  4XJO A;  4RKC A;  3FDB A;  1WYV B;  2AY3 A;  1B9I A;  1AJS B;  4AH3 A;  1YOO A;  4QGR A;  3DXV A;  4A6R A;  3ZZJ A;  2R2N A;  2E54 A;  5DJ9 A;  2VIA A;  4ATQ A;  3E9K A;  4K2M A;  1IX6 A;  2CST A;  1EQB A;  2X5D A;  3PD6 B;  1I48 A;  1G7W A;  3UE8 A;  2PB2 A;  4Q6R A;  4JEZ A;  1AMQ A;  1YNU A;  1KMJ A;  1QIT A;  4J8L A;  2EZ1 A;  3NX3 A;  3A9X A;  1LK9 A;  1AKC A;  3BN1 A;  3VAX A;  3FCR A;  4IW7 A;  2GQN A;  4BHD A;  2CH2 A;  4A0H A;  5G0A A;  2VGZ A;  3EIA A;  4JF1 A;  3WX9 A;  3N7N A;  3NUI A;  5LHA A;  2FNI A;  2XBN A;  4W1V A;  5FT5 A;  1B4X A;  1B5P A;  3EIB A;  3MAF A;  4LW2 A;  2YKU A;  3D6K A;  2VYC A;  2W7J A;  2BHX A;  2EO5 A;  4R2N A;  1N8P A;  5M4D A;  2JJG A;  2O1B A;  4R5Z A;  3AEJ A;  3I4J A;  1I43 A;  4OT8 A;  1MAQ A;  2BWN A;  3VK3 A;  4CXQ A;  3CQ5 A;  3MBB A;  4DGT A;  1DFO A;  2HUU A;  1BJO B;  4IX8 A;  1G4V A;  4OC9 A;  5BJ4 A;  3BC8 A;  3GWP A;  2KFP A;  1GBN A;  3RCH A;  3NUB A;  3AEP A;  3NNK A;  1XI9 A;  3E2Z B;  3NYU A;  4M2J A;  4KYO A;  4F5I A;  2W7E A;  1C7G A;  1V2E A;  3MC6 A;  1GEW A;  1D2F A;  3LG0 A;  1Y4I A;  4WLJ A;  1AMR A;  1LC8 A;  3AOW A;  3Q8N A;  3VOM A;  3GZD C;  1KAF A;  4O6Z A;  3UWC A;  2W7G A;  2C0R A;  2WK8 A;  3JZL A;  4WYG A;  5G4J A;  3WKS A;  1LW4 A;  4WXF A;  5EUD A;  4K05 A;  4CXR A;  1AMA A;  4ADD A;  2ZSM A;  4F5K A;  2FN6 A;  5HXX A;  1MLZ A;  1TAS A;  1WKG A;  3HBX A;  5HDM A;  4XJM A;  3ASA A;  3EI6 A;  3NYS A;  4WB0 B;  1BJN A;  2E7U A;  1ZOD A;  4W91 A;  1YIY A;  3VK2 A;  4F5G A;  3IHJ A;  4ISY A;  4UOY A;  1W23 A;  2BI3 A;  1YJY A;  5EAV A;  5C6U A;  1C7N A;  1OXP A;  3B46 A;  4MQR A;  2DOU A;  4JEX A;  4JEY A;  4ZSW A;  2R5C A;  1UU0 A;  4M2K A;  2VGS A;  1BW0 A;  2W8U A;  2G6W A;  3LV2 A;  3FSL A;  2W7D A;  4LNL A;  1W7N A;  1ARI A;  3W1J A;  2PO3 A;  2W8J A;  3FZ6 A;  4OBV A;  3VP6 A;  3N4R A;  4PFN A;  3FVU A;  2E7J A;  2RFV A;  4XK1 A;  4ZWM A;  3NU8 A;  4GE4 A;  4K2I A;  2OKJ A;  1DKA A;  2X5F A;  4EB5 A;  1SZS A;  1CS1 A;  1C7O A;  2CY8 A;  2EPJ A;  2YKY A;  3A9Z A;  3E2F A;  4LNM A;  5TF5 A;  1JS3 A;  1MDZ A;  2EH6 A;  2C44 A;  5E4Z A;  4WLH A;  3EUC A;  3QPG A;  4ZDL A;  3WCN A;  1GC3 A;  1UKJ A;  1GDE A;  2CIN A;  1O4S A;  1M6S A;  4ADB A;  1S0A A;  3DYD A;  1KL1 A;  2D61 A;  2JJE A;  1CZE A;  3QBO A;  2A1V A;  4F5F A;  2JG2 A;  5EUN A;  4U1T A;  3ZRR A;  5K8B A;  4RAE A;  4MY5 A;  3HT4 A;  1LKC A;  2VMO A;  5IWQ A;  2BI2 A;  1GC4 A;  2W7F A;  4A0F A;  3BWN A;  2BIA A;  1SZK A;  1AMS A;  2W7K A;  4E1O A;  3AEL A;  1CQ6 A;  5I92 A;  1ASE A;  4ADC A;  1SFF A;  2V1P A;  1I41 A;  1X2A A;  4LW4 A;  3WGC A;  2C7T A;  1GEY A;  3CQ6 A;  4GE7 A;  4WYC A;  1BKG A;  1JG8 A;  1O69 A;  1V72 A;  2OKK A;  2VMW A;  4EU1 A;  1CL2 A;  2VMY A;  3BCA A;  3FZ7 A;  1ASD A;  2JGT A;  4UHM A;  3UAK A;  1PMM A;  1TPL A;  3EZS A;  3FDD A;  5EIG A;  1DJE A;  1EJI A;  1KMK A;  1ZOB A;  3DOD A;  3FKD A;  4RJ0 A;  3RBL A;  2BI9 A;  2ORD A;  1IJI A;  1KKJ A;  1LW5 A;  3PPL A;  5D5S A;  2JJH A;  3PDB B;  1ARH A;  4ITX A;  1ARS A;  3IF2 A;  2ZY4 A;  1WYV A;  1RV4 A;  1AJS A;  2C81 A;  3DU4 A;  1ARG A;  3AAT A;  4W1W A;  1Z7D A;  4K2B A;  4W8I A;  3COG A;  2VI9 A;  4ZM4 A;  1IX7 A; 
#chains in the Genus database with same CATH homology
 2NMP A;  2BI1 A;  2G7J A;  4AOA A;  1V2F A;  2YKX A;  1GD9 A;  3RQ1 A;  3B1D A;  3DZZ A;  5J8Q A;  4F5H A;  3PD6 A;  4AO4 A;  1AHX A;  1ASG A;  1X29 A;  2AY7 A;  2Z61 A;  1N31 A;  4ITG A;  3HMU A;  4WXG A;  4Q75 A;  2BIE A;  2DKB A;  2YRR A;  1W3U A;  1GC2 A;  1QJ5 A;  2O0R A;  1H0C A;  3BB8 A;  2AY6 A;  2HOY A;  2WK9 A;  1BQA A;  3I5T A;  3L8A A;  3WCO A;  1WYT B;  2ZYJ A;  3PGY A;  3N4X A;  1WYT A;  4IY7 A;  1B9H A;  3DRD A;  3AOV A;  4WYF A;  1EG5 A;  2BKW A;  1TAR A;  3WGB A;  1QIS A;  2Z20 A;  2VLF A;  1T3I A;  3N5M A;  5FT8 A;  1C4K A;  1MLY A;  2BYJ A;  1ASF A;  1N2T A;  2E7I A;  2YCP A;  3EZ1 A;  4JEV A;  4RJY A;  3FFH A;  4W1X A;  2D66 A;  4WYE A;  3QGU A;  3OKS A;  5AX8 A;  1D7V A;  1SPA A;  3P1T A;  2QB2 A;  1YJS A;  1M4N A;  3K40 A;  1M0Q A;  1X0M A;  1CJ0 A;  4EB7 A;  3QN6 A;  1BJO A;  1ASB A;  4AZK A;  3HL2 A;  4P7Y A;  1LS3 A;  1WST A;  4OYT A;  1FG3 A;  3E2Z A;  2DGM A;  4UHN A;  4Y0D A;  3B8X A;  1S09 A;  1FC4 A;  1G4X A;  1SVV A;  1AIC A;  1LC7 A;  2HUF A;  1P3W A;  2BI5 A;  2D63 A;  2QMA A;  2VGV A;  3EI8 A;  3GZC A;  2JJF A;  1CQ7 A;  3JWA A;  3M5U A;  3WLX A;  2GSA A;  3T32 A;  3AEJ C;  4ADE A;  2YKV A;  2EZ2 A;  4HF8 A;  2DGL A;  3PIU A;  4RIT A;  4IYO B;  5FT6 A;  1RVU A;  1J04 A;  1AAM A;  4IYO A;  3GBX A;  1AX4 A;  3L44 A;  5E5I A;  3VK4 A;  5G09 A;  1AY4 A;  2D64 A;  1WYU B;  1S06 A;  4WB0 A;  2EGY A;  4TN4 A;  2W8V A;  4N0B A;  1TOJ A;  1U08 A;  1DTY A;  4AO9 A;  3MC6 C;  4Q31 A;  1B8G A;  3RI6 A;  2VMQ A;  2HOZ A;  1M0N A;  2OGA A;  3NRA A;  2YOB A;  3JW9 A;  5FT4 A;  3A9Y A;  2PB0 A;  5EFS A;  2W7H A;  1QGN A;  3USF A;  4ZM3 A;  5EAA A;  2R5E A;  3FFR A;  1DGE A;  1MGV A;  1O61 A;  3CAI A;  1YIZ A;  3MEB A;  4WP0 A;  2ZJG A;  4CBR A;  3EI7 A;  1MDO A;  2HP1 A;  2HOX A;  1TOG A;  3BCB A;  2VGU A;  2AY2 A;  3AV7 A;  1M0P A;  2Z67 A;  1JS6 A;  4MKJ A;  2AAT A;  2OAT A;  1PG8 A;  3JTX A;  1TOE A;  1X28 A;  1RV3 A;  3A8U X;  1BT4 A;  4OBU A;  1YJZ A;  2CB1 A;  4JF0 A;  4DQ6 A;  2D7Z A;  1ECX A;  3HQT A;  2CFB A;  1TOK A;  4IXZ A;  2AY4 A;  4ZWV A;  4GSA A;  5LH9 A;  2AY1 A;  2FNU A;  4MQQ A;  3ASB A;  4E3Q A;  2ZY3 A;  2AY5 A;  2OGE A;  3MAU A;  3NU7 A;  4MGR A;  1S08 A;  2QA3 A;  4DBC A;  1BS0 A;  3JWB A;  3WKR A;  4JE5 A;  2CAN A;  1I29 A;  4Y0I A;  1AJR A;  1VEF A;  1AY5 A;  4MQP A;  3ATH A;  2CJD A;  4HVK A;  4XJP A;  3OP7 A;  3NYT A;  1IAX A;  2X8U A;  2QBT A;  1V2D A;  1DJU A;  4R5F A;  3N4S A;  3N75 A;  2EYQ A;  3TQX A;  1OHY A;  2VMZ A;  2AEU A;  3AEM A;  4RLG A;  2W8T A;  2GB3 A;  1OAT A;  2VMN A;  3LY1 A;  4GDY A;  3JU7 A;  4ZDP A;  2QSR A;  1AHF A;  3ISL A;  3WY7 A;  3LVL B;  4BMK A;  1M32 A;  4GEB A;  3TFT A;  2W7L A;  3H7F A;  4A6U A;  4XAU A;  3RUY A;  4A6T A;  2VMU A;  3G7Q A;  2D7Y A;  1IUG A;  2BYL A;  2F8J A;  3BWN C;  3AEO A;  3HDO A;  4XEW A;  4M2M A;  2VMV A;  4L0O A;  1OHW A;  3PDB A;  3NDN A;  4MSO A;  4WBT A;  1AAW A;  3GET A;  4RM1 A;  3DR4 A;  3ELP A;  4BA4 A;  2GMS A;  3K7Y A;  4W5K A;  5G2Q A;  2Z9V A;  4GRX A;  3AEN B;  5HHY A;  2ZUK A;  4ZAH A;  3PJ0 A;  5BJ3 A;  3CQ4 A;  4KAM A;  3TFU A;  2D65 A;  1WKH A;  2CH1 A;  1AHE A;  1ORD A;  1VP4 A;  2QLR A;  1GEX A;  1OXO A;  4TV7 A;  2TPL A;  3FVX A;  3QI6 A;  3FQ7 A;  2YCN A;  3KE3 A;  4F5L A;  2FM1 A;  1AHY A;  1W7L A;  3LVM A;  1ASL A;  2AY8 A;  5JAY A;  2Z1Z A;  4U2H A;  1SZU A;  3ELE A;  4EMY A;  2ZY5 A;  4H51 A;  3KGX A;  4N0W A;  2FYF A;  5F8V A;  1IAY A;  4J5U A;  3KGW A;  1J32 A;  3B1E A;  3FD0 A;  2VIB A;  3KKI A;  4BA5 A;  1CZC A;  1JF9 A;  3FRK A;  2W7M A;  2Z9X A;  3ECD A;  3II0 A;  4TMR A;  3F9T A;  1B5O A;  2AEV A;  1W7M A;  5EUE A;  4ZAS A;  4B98 A;  2BIG A;  4LNJ A;  1D7S A;  2VGT A;  2OQX A;  1KKP A;  4XQ2 A;  3N0L A;  2VLH A;  3E77 A;  4E3R A;  1QIR A;  2YCT A;  3MAF B;  2W8W A;  1AY8 A;  2CJH A;  3I16 A;  3ZRQ A;  1C9C A;  3BV0 A;  1XEY A;  4ZSY A;  2BWP A;  2VMP A;  1LC5 A;  3QHX A;  1BQD A;  3GZD A;  3TCM A;  2QB3 A;  1MDX A;  1ASN A;  1QJ3 A;  3MKJ A;  3BS8 A;  4F4E A;  3RBF A;  1M0O A;  1ASA A;  1ELQ A;  1PFF A;  3G8M A;  3LVK A;  2R0T A;  4Q76 A;  5M4B A;  1AHG A;  2DGK A;  4NOG A;  1BJ4 A;  5E3K A;  3RCH B;  4A72 A;  4WYD A;  1FG7 A;  1WYU A;  3ZRP A;  5DX5 A;  3G0T A;  3LWS A;  4BQ0 A;  5M49 A;  1UU2 A;  1QZ9 A;  2CJG A;  1E5E A;  3NTJ A;  1Z3Z A;  1AIB A;  4LC3 A;  2ZP7 A;  4OCA A;  2ZY2 A;  1IX8 A;  1G7X A;  1AKB A;  4EFF A;  5KTB A;  8AAT A;  2HP2 A;  3GR9 A;  4ZLV A;  1M7Y A;  4P3M A;  1CQ8 A;  4F5M A;  4R8D A;  1GC0 A;  3E2Y A;  1D7U A;  3QM2 A;  4Y0H A;  2DKJ A;  3WZF A;  4OTL A;  5EQC A;  3F6T A;  3R4T A;  3TAT A;  1TOI A;  3H14 A;  2Z9W A;  2FQ6 A;  2VMX A;  1RVY A;  2XH1 A;  4XJL A;  5F9S A;  1IBJ A;  1ASM A;  2WKA A;  3R9A A;  4PIW A;  1TAT A;  3EI9 A;  3BWO A;  5D95 A;  1SF2 A;  3E6G A;  1O62 A;  3LVJ A;  1AKA A;  1ZC9 A;  1E5F A;  2R5C B;  3GJU A;  1KL2 A;  2ZC0 A;  4CBS A;  2Q7W A;  3H9X A;  4CVQ A;  3B1C A;  1DGD A;  3DXW A;  3PDX A;  4MKK A;  4RIZ A;  1BJW A;  4A0R A;  4ZDO A;  4B9B A;  1S07 A;  2YHK A;  4WYA A;  1VJO A;  2X3L A;  3MAD A;  1AIA A;  2CTZ A;  3FZ8 A;  1ELU A;  4UQV A;  2DR1 A;  1C0N A;  3A2B A;  1ART A;  3DR7 A;  3HLM A;  4WD2 A;  3P6K A;  2JIS A;  3EI5 A;  3FQ8 A;  4PFF A;  3BCX A;  2VMR A;  9AAT A;  3FVS A;  5M46 A;  1MAP A;  2D5Y A;  4WXB A;  3ACZ A;  3PA9 A;  2FKI A;  4E77 A;  2O7C A;  3FQA A;  4ATP A;  3F0H A;  1H1C A;  1IVR A;  1UU1 A;  2V0Y A;  2WB6 A;  2GMU A;  4UHO A;  4AZJ A;  1YAA A;  2ZSL A;  2AY9 A;  2HUI A;  2HZP A;  4H63 Q;  4IXS A;  2VMS A;  4RKD A;  5G2P A;  2HOR A;  7AAT A;  2VGW A;  2YRI A;  1CL1 A;  1DJ9 A;  1OHV A;  4GE9 A;  1ASC A;  4I8A A;  4F5J A;  2Z9U A;  3AEM C;  1PMO A;  3HVY A;  1D7R A;  5DB5 A;  5DJ1 A;  4IXO A;  5G4I A;  3CBF A;  3DC1 A;  3ZZK A;  4FFC A;  4OMA A;  3AEN A;  4JE5 D;  3W1H A;  2W7I A;  4PVF A;  2BWO A;  3GSB A;  5EIG B;  4A00 A;  3W1I A;  2VI8 A;  3PAA A;  4A0G A;  4KXK A;  1GCK A;  2Z1Y A;  4FL0 A;  2VMT A;  4JEW A;  3K28 A;  2WK7 A;  3FTB A;  4XJO A;  4RKC A;  3FDB A;  1WYV B;  2AY3 A;  1B9I A;  1AJS B;  4AH3 A;  1YOO A;  4QGR A;  3DXV A;  4A6R A;  3ZZJ A;  2R2N A;  2E54 A;  5DJ9 A;  2VIA A;  4ATQ A;  3E9K A;  4K2M A;  1IX6 A;  2CST A;  1EQB A;  2X5D A;  3PD6 B;  1I48 A;  1G7W A;  3UE8 A;  2PB2 A;  4Q6R A;  4JEZ A;  1AMQ A;  1YNU A;  1KMJ A;  1QIT A;  4J8L A;  2EZ1 A;  3NX3 A;  3A9X A;  1LK9 A;  1AKC A;  3BN1 A;  3VAX A;  3FCR A;  4IW7 A;  2GQN A;  4BHD A;  2CH2 A;  4A0H A;  5G0A A;  2VGZ A;  3EIA A;  4JF1 A;  3WX9 A;  3N7N A;  3NUI A;  5LHA A;  2FNI A;  2XBN A;  4W1V A;  5FT5 A;  1B4X A;  1B5P A;  3EIB A;  3MAF A;  4LW2 A;  2YKU A;  3D6K A;  2VYC A;  2W7J A;  2BHX A;  2EO5 A;  4R2N A;  1N8P A;  5M4D A;  2JJG A;  2O1B A;  4R5Z A;  3AEJ A;  3I4J A;  1I43 A;  4OT8 A;  1MAQ A;  2BWN A;  3VK3 A;  4CXQ A;  3CQ5 A;  3MBB A;  4DGT A;  1DFO A;  2HUU A;  1BJO B;  4IX8 A;  1G4V A;  4OC9 A;  5BJ4 A;  3BC8 A;  3GWP A;  2KFP A;  1GBN A;  3RCH A;  3NUB A;  3AEP A;  3NNK A;  1XI9 A;  3E2Z B;  3NYU A;  4M2J A;  4KYO A;  4F5I A;  2W7E A;  1C7G A;  1V2E A;  3MC6 A;  1GEW A;  1D2F A;  3LG0 A;  1Y4I A;  4WLJ A;  1AMR A;  1LC8 A;  3AOW A;  3Q8N A;  3VOM A;  3GZD C;  4O6Z A;  3UWC A;  2W7G A;  2C0R A;  2WK8 A;  3JZL A;  4WYG A;  5G4J A;  3WKS A;  1LW4 A;  4WXF A;  5EUD A;  4K05 A;  4CXR A;  1AMA A;  4ADD A;  2ZSM A;  4F5K A;  2FN6 A;  5HXX A;  1MLZ A;  1TAS A;  1WKG A;  3HBX A;  5HDM A;  4XJM A;  3ASA A;  3EI6 A;  3NYS A;  4WB0 B;  1BJN A;  2E7U A;  1ZOD A;  4W91 A;  1YIY A;  3VK2 A;  4F5G A;  3IHJ A;  4ISY A;  4UOY A;  1W23 A;  2BI3 A;  1YJY A;  5EAV A;  5C6U A;  1C7N A;  1OXP A;  3B46 A;  4MQR A;  2DOU A;  4JEX A;  4JEY A;  4ZSW A;  2R5C A;  1UU0 A;  4M2K A;  2VGS A;  1BW0 A;  2W8U A;  2G6W A;  3LV2 A;  3FSL A;  2W7D A;  4LNL A;  1W7N A;  1ARI A;  3W1J A;  2PO3 A;  2W8J A;  3FZ6 A;  4OBV A;  3VP6 A;  3N4R A;  4PFN A;  3FVU A;  2E7J A;  2RFV A;  4XK1 A;  4ZWM A;  3NU8 A;  4GE4 A;  4K2I A;  2OKJ A;  1DKA A;  2X5F A;  4EB5 A;  1SZS A;  1CS1 A;  1C7O A;  2CY8 A;  2EPJ A;  2YKY A;  3A9Z A;  3E2F A;  4LNM A;  5TF5 A;  1JS3 A;  1MDZ A;  2EH6 A;  2C44 A;  5E4Z A;  4WLH A;  3EUC A;  3QPG A;  4ZDL A;  3WCN A;  1GC3 A;  1UKJ A;  1GDE A;  2CIN A;  1O4S A;  1M6S A;  4ADB A;  1S0A A;  3DYD A;  1KL1 A;  2D61 A;  2JJE A;  1CZE A;  3QBO A;  2A1V A;  4F5F A;  2JG2 A;  5EUN A;  4U1T A;  3ZRR A;  5K8B A;  4RAE A;  4MY5 A;  3HT4 A;  1LKC A;  2VMO A;  5IWQ A;  2BI2 A;  1GC4 A;  2W7F A;  4A0F A;  3BWN A;  2BIA A;  1SZK A;  1AMS A;  2W7K A;  4E1O A;  3AEL A;  1CQ6 A;  5I92 A;  1ASE A;  4ADC A;  1SFF A;  2V1P A;  1I41 A;  1X2A A;  4LW4 A;  3WGC A;  2C7T A;  1GEY A;  3CQ6 A;  4GE7 A;  4WYC A;  1BKG A;  1JG8 A;  1O69 A;  1V72 A;  2OKK A;  2VMW A;  4EU1 A;  1CL2 A;  2VMY A;  3BCA A;  3FZ7 A;  1ASD A;  2JGT A;  4UHM A;  3UAK A;  1PMM A;  1TPL A;  3EZS A;  3FDD A;  5EIG A;  1DJE A;  1EJI A;  1KMK A;  1ZOB A;  3DOD A;  3FKD A;  4RJ0 A;  3RBL A;  2BI9 A;  2ORD A;  1IJI A;  1KKJ A;  1LW5 A;  3PPL A;  5D5S A;  2JJH A;  3PDB B;  1ARH A;  4ITX A;  1ARS A;  3IF2 A;  2ZY4 A;  1WYV A;  1RV4 A;  1AJS A;  2C81 A;  3DU4 A;  1ARG A;  3AAT A;  4W1W A;  1Z7D A;  4K2B A;  4W8I A;  3COG A;  2VI9 A;  4ZM4 A;  1IX7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...