4H51A

Crystal structure of a putative aspartate aminotransferase from leishmania major friedlin
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
401
structure length
397
Chain Sequence
MTTAERWQKIQAQAPDVIFDLAKRAAAAKGPKANLVIGAYRDEQGRPYPLRVVRKAEQLLLDMNLDYEYLPISGYQPFIDEAVKIIYGELENLVAVQTLSGTGAVSLGAKLLTRVFDAETTPIYLSDPTWPNHYGVVKAAGWKNICTYAYYDPKTVSLNFEGMKKDILAAPDGSVFILHQCAHNPTGVDPSQEQWNEIASLMLAKHHQVFFDSAYQGYASGSLDTDAYAARLFARRGIEVLLAQSFSNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRRTVYDELLRLQTPGSWEHVINQIGMFSFLGLSKAQCEYCQNHNIFITVSGRANMAGLTHETALMLAQTINDAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of aspartate aminotransferases from Trypanosoma brucei, Leishmania major and Giardia lamblia.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords Aspartate aminotransferase
total genus 158
structure length 397
sequence length 401
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4h51A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4h51A01
2VGUA 4WLJA 4KYOA 5D5SA 4DGTA 5G0AA 1JS3A 2HORA 2W7KA 2HOZA 2O7CA 1J32A 4WYEA 2OKKA 3F6TA 3VK2A 1Y4IA 3PPLA 2Z9XA 4LC3A 1E5EA 2ZP7A 1BKGA 1W7NA 1WKHA 3K7YA 1ELUA 5FT8A 5EUNA 4B9BA 2XBNA 1GD9A 1QZ9A 8AATA 3TFUA 2BI3A 2VMZA 4R5ZA 1IX7A 2EGYA 3AEJA 3M5UA 2CSTA 1GBNA 1DGDA 1S06A 4CXRA 3AENB 1KKPA 3AELA 2PB0A 3EZ1A 4GSAA 2D66A 3LV2A 3FVUA 4PFNA 4Q6RA 4PVFA 3WGCA 2BIAA 4IXZA 1GC4A 4FFCA 2WKAA 3R4TA 2X5DA 3B46A 3NDNA 1AJSA 3GETA 3OKSA 1EJIA 4LNMA 4LNLA 1LW5A 3RQ1A 3UWCA 4EB7A 3G7QA 3PGYA 9AATA 2ZJGA 2YKUA 1ECXA 4JF0A 1C4KA 1LS3A 3AENA 4WLHA 3WCNA 2BI5A 3AV7A 2BI1A 4L0OA 1DJEA 5EQCA 3BWNA 1P3WA 5K8BA 1GDEA 5EIGA 3HBXA 1C7GA 3WY7A 4ZM3A 3LVJA 1CZEA 2EO5A 4WD2A 4RJYA 3QM2A 4K2IA 4OBVA 4MQPA 1AAMA 2BKWA 2Z9VA 4WYAA 4ZLVA 3RBLA 2VMTA 3B8XA 3TCMA 4I8AA 2CH2A 5I92A 3A9XA 4AO4A 4F5IA 2XH1A 1B5PA 3E77A 2G6WA 5DJ1A 3QI6A 4PFFA 1UU2A 1M0QA 1ASFA 1PFFA 3II0A 4OC9A 1ARSA 2E54A 3EIBA 3LY1A 2C7TA 4IY7A 3DR4A 3HMUA 2F8JA 5G2QA 1X29A 4ITXA 1MLZA 1ASBA 1OHVA 1X28A 3FQAA 2CH1A 1WYVB 3QGUA 4F5FA 1W7LA 3I5TA 4E3QA 1ZC9A 2X8UA 3BCAA 2VGSA 2AY6A 2W7JA 1M0OA 3B1EA 3B1DA 4O6ZA 3BCXA 1MGVA 2W8TA 3E2FA 3KE3A 3VK4A 2BYLA 3TATA 2ZY2A 3MC6A 1ASCA 2FN6A 4KXKA 1FC4A 1AJRA 3EIAA 3JWBA 4XAUA 4Y0HA 2CJHA 1AIBA 2FQ6A 2QMAA 4EU1A 1ASMA 1IX6A 3MEBA 1AHFA 3NYUA 2EZ2A 3GZCA 4JEYA 1QISA 2VLFA 3E2ZA 3BCBA 1O69A 2Z1ZA 2D63A 3ATHA 3FFHA 4W8IA 5LH9A 2EH6A 4UOYA 3QBOA 4IW7A 4U1TA 2R0TA 5F9SA 4WXGA 4CXQA 1QJ5A 2NMPA 3ACZA 2BYJA 1BJNA 3H14A 3KKIA 3E9KA 1VJOA 3FZ8A 1C9CA 1LK9A 1UU1A 3GSBA 2HUFA 2HP1A 2HUIA 1B4XA 4BMKA 1ASDA 4WB0B 1ASEA 2YCNA 2W8VA 3WGBA 1BJWA 1WSTA 4XJOA 1V2EA 3FVXA 4DQ6A 3PDBB 4TN4A 4J5UA 3A8UX 4RLGA 2YOBA 1AHGA 1QIRA 3DODA 1MDOA 5AX8A 2C81A 3IF2A 1KMKA 1ZOBA 1IAXA 3FDDA 1C7NA 5DJ9A 3COGA 2JGTA 4LW2A 4OYTA 1YNUA 1D7RA 4W1VA 1CQ6A 3DRDA 2QLRA 1EG5A 3W1JA 1D2FA 4BA4A 1DJ9A 2Z20A 3FKDA 1N31A 3PAAA 2ZY4A 4N0BA 1B9HA 4GE4A 1E5FA 1KL2A 2WK7A 2WK9A 1BT4A 3GBXA 3PD6B 4HF8A 4JEXA 1M6SA 4U2HA 3KGXA 1SZSA 3RCHB 5G2PA 2FM1A 1JF9A 5G4JA 2QB2A 3ECDA 2V0YA 3NU7A 1TOEA 1VP4A 1X0MA 3L8AA 3FQ7A 2CB1A 1SVVA 1FG7A 1RV4A 1YIZA 2PO3A 1BQAA 4ZSYA 3K40A 4MGRA 4IYOA 4WBTA 5M46A 4R2NA 4NOGA 4WXBA 2AEUA 1TASA 2FYFA 1O62A 3CAIA 3NNKA 2YCTA 4J8LA 4MY5A 4CVQA 2YKVA 2VMNA 1DTYA 2W7FA 3EI7A 4JEWA 3HQTA 3PDBA 3PIUA 1B8GA 1OXPA 1S09A 4IX8A 5EUDA 1MDZA 4WYDA 5F8VA 1M0NA 4Y0IA 4JE5D 1DGEA 3DXWA 4UQVA 1ARHA 2AY8A 2BIGA 2OKJA 1CL1A 1CQ7A 2WK8A 3A9ZA 5TF5A 4E3RA 2X3LA 4F5GA 4ZAHA 1BJOA 4A6RA 3G0TA 4OBUA 3GZDC 2AY3A 4ADCA 2EZ1A 4P3MA 3DZZA 2Q7WA 3LG0A 4XJPA 1TPLA 1XEYA 1YJSA 1GEXA 4P7YA 3JWAA 1V2DA 1C0NA 3JZLA 2C44A 2DKBA 1G4VA 3F9TA 5BJ3A 3JU7A 1Z7DA 4A0RA 4R8DA 3EI5A 1M7YA 2C0RA 3QPGA 3LVLB 2JG2A 2W7GA 3LVKA 2OQXA 1YJYA 3AOVA 3MKJA 3P6KA 3DYDA 5E3KA 5EIGB 1TARA 1IJIA 4H51A 1WYUA 4GDYA 1UU0A 4MSOA 4RJ0A 3WCOA 1ELQA 1RVUA 3AEJC 4LW4A 1O4SA 2R5CA 2YKYA 2E7IA 3R9AA 1RVYA 3PD6A 4A0HA 3E2ZB 2R2NA 1CS1A 2Z61A 2AY5A 3A9YA 3IHJA 4ADBA 4AZJA 1YJZA 1GC0A 2VMQA 2DGKA 1YIYA 4TMRA 3HVYA 4BQ0A 2D5YA 3DXVA 3FZ6A 4B98A 4F5HA 3HDOA 1LC7A 2AY7A 1I29A 2JJEA 2QB3A 1FG3A 1MAPA 5IWQA 2EPJA 3DC1A 4F5LA 1B5OA 5DB5A 4A0FA 4UHOA 1D7SA 1LW4A 2AY4A 2ZSMA 1GCKA 4A0GA 3VK3A 4AH3A 1U08A 3ELPA 3EUCA 4WB0A 3AEOA 4BA5A 3EI8A 1QJ3A 2VGWA 3GR9A 4WP0A 2OGAA 2ZYJA 3LVMA 1KMJA 3PA9A 5C6UA 2Z9WA 5BJ4A 3NUBA 1SZKA 1GC2A 2GMUA 3AEMC 5M4DA 3FZ7A 1AMAA 1WYTA 3N5MA 4JE5A 4Y0DA 4DBCA 2HP2A 3CQ6A 1WYUB 3GWPA 3GZDA 2CJDA 4TV7A 3RI6A 2VMOA 4EFFA 2VI9A 1IVRA 2VYCA 3BB8A 1W23A 2VMSA 3QN6A 2DGLA 4Q76A 4F5MA 2QBTA 4A6TA 4GE7A 5E5IA 3FDBA 3OP7A 2HOYA 4K2BA 1TOJA 1AMRA 4AOAA 1OXOA 3ELEA 4ADEA 4LNJA 1VEFA 1S0AA 1ASNA 3VP6A 2X5FA 7AATA 3GJUA 3ASBA 3W1IA 2CANA 2JJGA 3EZSA 3AEPA 3BC8A 3P1TA 3I4JA 2BWOA 1DJUA 2E7JA 3WZFA 3PJ0A 2DR1A 4IYOB 4ATQA 2CFBA 1AY5A 3ZRPA 4RKDA 2YRRA 3HLMA 1AHEA 2ZY5A 1RV3A 1M0PA 2CJGA 3HT4A 2W7HA 4ITGA 3WKRA 2E7UA 3MADA 3MC6C 4ATPA 4N0WA 3MAUA 1Z3ZA 1CQ8A 4RITA 3TFTA 4WYGA 3AATA 3K28A 3PDXA 1G4XA 2JJFA 4UHMA 2W7IA 2OATA 4A6UA 5HDMA 1AKAA 2VMVA 4W1WA 1BJOB 4MKKA 4PIWA 1W3UA 3NTJA 1AAWA 4RM1A 2GQNA 1G7XA 1I41A 1BS0A 3G8MA 4AO9A 1BQDA 3N75A 4CBSA 3FQ8A 1H1CA 2HZPA 3CQ4A 5HHYA 3RUYA 4ZSWA 1AX4A 1WKGA 2HOXA 1PG8A 1M4NA 2GMSA 1SPAA 4RAEA 4A00A 2D65A 4W91A 2D64A 4RKCA 1N8PA 2RFVA 4XQ2A 3ZZKA 1XI9A 1GC3A 2Z9UA 4RIZA 4E77A 2QA3A 1AHXA 4GEBA 3FSLA 3BS8A 4Q31A 3WLXA 5M49A 3D6KA 3MBBA 2ZC0A 2DKJA 1YAAA 2ORDA 1W7MA 3NU8A 2V1PA 3ZZJA 4ZDLA 1C7OA 4E1OA 3HL2A 1LC8A 1S08A 2W7DA 4IXOA 2D61A 2DGMA 2BWNA 1PMMA 4UHNA 2HUUA 2FNUA 2YHKA 2GB3A 4Q75A 1B9IA 4MQRA 1TOIA 2W7LA 4ZDPA 4W5KA 4WYFA 2VMXA 1IX8A 2VI8A 4GE9A 4OT8A 5EAVA 1J04A 1BJ4A 4F5JA 4EMYA 3QHXA 1S07A 2AATA 2AY1A 2DOUA 1DFOA 1AY4A 3RBFA 1JS6A 2YKXA 4BHDA 2VMUA 5FT5A 2D7YA 2R5CB 1OHYA 3UE8A 2CTZA 4M2KA 2O1BA 2D7ZA 2OGEA 2ZSLA 1TATA 3A2BA 1ARGA 1CL2A 5FT6A 1ARIA 1AKBA 4HVKA 3RCHA 1WYTB 1MDXA 3WKSA 3CQ5A 1QITA 1SZUA 2JJHA 1X2AA 3NYTA 2W7MA 4ZWVA 3DU4A 1ORDA 4IXSA 4ZASA 4JEZA 5D95A 5G4IA 1AHYA 2BHXA 5J8QA 3E2YA 3T32A 1G7WA 2TPLA 3LWSA 1KKJA 2W8UA 1EQBA 3EI9A 3FCRA 4XEWA 1MLYA 4GRXA 4AZKA 3ZRRA 2PB2A 4OMAA 5EAAA 1UKJA 2YRIA 1ASLA 1CZCA 2JISA 1WYVA 3NYSA 2Z1YA 2VMYA 3USFA 4KAMA 4M2MA 4MKJA 5E4ZA 1AJSB 1OATA 3BN1A 2GSAA 4A72A 4OCAA 3TQXA 3BWNC 2AY2A 4R5FA 5HXXA 1TOKA 1IBJA 2BI2A 3FTBA 4XK1A 1AKCA 1ZODA 2VGTA 3E6GA 5JAYA 3EI6A 5G09A 3CBFA 3UAKA 1AY8A 3JW9A 3Q8NA 3F0HA 4OTLA 1DKAA 3ISLA 1T3IA 2O0RA 2BWPA 1OHWA 1D7UA 1SF2A 1V72A 3KGWA 1I43A 1PMOA 2VMPA 3H7FA 3FRKA 3I16A 4XJLA 3VOMA 5M4BA 3DR7A 3WX9A 1CJ0A 1KL1A 2FNIA 4ISYA 1JG8A 1MAQA 2VGZA 1IUGA 1N2TA 3JTXA 4JF1A 2R5EA 1ARTA 2VGVA 3MAFB 2BI9A 2AEVA 1M32A 1LKCA 3NRAA 1GEWA 1V2FA 1H0CA 5EUEA 3VAXA 2YCPA 3FFRA 5LHAA 4WXFA 2AY9A 1LC5A 4JEVA 4QGRA 1AIAA 4K2MA 4CBRA 4EB5A 1ASAA 2CINA 1TOGA 3FD0A 3BV0A 4MQQA 2VLHA 3BWOA 1IAYA 2VIBA 2VIAA 1YOOA 4FL0A 2CY8A 3N0LA 5EFSA 4ZDOA 1GEYA 1AICA 1ASGA 2ZY3A 4ZWMA 4F5KA 2W7EA 3MAFA 1O61A 1QGNA 1SFFA 2BIEA 4ADDA 4ZM4A 2VMWA 5DX5A 4F4EA 2W8WA 4W1XA 3FVSA 3NX3A 3AEMA 3L44A 5FT4A 1BW0A 1AMSA 2W8JA 2Z67A 3AOWA 4XJMA 1I48A 3NUIA 3ASAA 4WYCA 3W1HA 1D7VA 3B1CA 2VMRA 1AMQA 4M2JA 2ZUKA 3ZRQA
chains in the Genus database with same CATH superfamily
2VGUA 4WLJA 4KYOA 5D5SA 4DGTA 5G0AA 1JS3A 2HORA 2W7KA 2HOZA 2O7CA 1J32A 4WYEA 2OKKA 3F6TA 3VK2A 1KAFA 1Y4IA 3PPLA 4H63Q 2Z9XA 4LC3A 1E5EA 2ZP7A 1BKGA 1W7NA 1WKHA 3K7YA 1ELUA 5FT8A 5EUNA 4B9BA 2XBNA 1GD9A 1QZ9A 8AATA 3TFUA 2BI3A 2VMZA 4R5ZA 1IX7A 2EGYA 3AEJA 3M5UA 2CSTA 1GBNA 1DGDA 1S06A 4CXRA 3AENB 1KKPA 3AELA 2PB0A 3EZ1A 2G7JA 4GSAA 2D66A 3LV2A 3FVUA 4PFNA 4Q6RA 4PVFA 3WGCA 2BIAA 4IXZA 1GC4A 4FFCA 2WKAA 3R4TA 2X5DA 3B46A 3NDNA 1AJSA 3GETA 3OKSA 1EJIA 4LNMA 4LNLA 1LW5A 3RQ1A 3UWCA 4EB7A 3G7QA 3PGYA 9AATA 2ZJGA 2YKUA 1ECXA 4JF0A 1C4KA 1LS3A 3AENA 4WLHA 3WCNA 2BI5A 3AV7A 2BI1A 4L0OA 1DJEA 5EQCA 3BWNA 1P3WA 5K8BA 1GDEA 5EIGA 3HBXA 1C7GA 3WY7A 4ZM3A 3LVJA 1CZEA 2EO5A 4WD2A 4RJYA 3QM2A 4K2IA 4OBVA 4MQPA 1AAMA 2BKWA 2Z9VA 4WYAA 4ZLVA 3RBLA 2VMTA 3B8XA 3TCMA 4I8AA 2CH2A 5I92A 3A9XA 4AO4A 4F5IA 2XH1A 1B5PA 3E77A 2G6WA 5DJ1A 3QI6A 4PFFA 1UU2A 1M0QA 1ASFA 1PFFA 3II0A 4OC9A 1ARSA 2E54A 3EIBA 3LY1A 2C7TA 4IY7A 3DR4A 3HMUA 2F8JA 5G2QA 1X29A 4ITXA 1MLZA 1ASBA 1OHVA 1X28A 3FQAA 2CH1A 1WYVB 3QGUA 4F5FA 1W7LA 3I5TA 4E3QA 1ZC9A 2X8UA 3BCAA 2VGSA 2AY6A 2W7JA 1M0OA 3B1EA 3B1DA 4O6ZA 3BCXA 1MGVA 2W8TA 3E2FA 3KE3A 3VK4A 2BYLA 3TATA 3N7NA 2ZY2A 3MC6A 1ASCA 2FN6A 4KXKA 1FC4A 1AJRA 3EIAA 3JWBA 4XAUA 4Y0HA 2CJHA 1AIBA 2FQ6A 2QMAA 3H9XA 4EU1A 1ASMA 1IX6A 3MEBA 1AHFA 3NYUA 2EZ2A 3GZCA 4JEYA 1QISA 2VLFA 3E2ZA 3BCBA 1O69A 2Z1ZA 2D63A 3ATHA 3FFHA 4W8IA 5LH9A 2EH6A 4K05A 4UOYA 3QBOA 4IW7A 4U1TA 2R0TA 5F9SA 4WXGA 4CXQA 1QJ5A 2NMPA 3ACZA 2BYJA 1BJNA 3H14A 3KKIA 3E9KA 1VJOA 3FZ8A 1C9CA 1LK9A 1UU1A 3GSBA 2HUFA 2HP1A 2HUIA 1B4XA 4BMKA 1ASDA 4WB0B 1ASEA 2YCNA 2W8VA 3WGBA 1BJWA 1WSTA 4XJOA 1V2EA 3FVXA 4DQ6A 3PDBB 4TN4A 4J5UA 3A8UX 4RLGA 2YOBA 1AHGA 1QIRA 3DODA 1MDOA 5AX8A 2C81A 3IF2A 1KMKA 1ZOBA 1IAXA 3FDDA 1C7NA 5DJ9A 3COGA 2JGTA 4LW2A 4OYTA 1YNUA 1D7RA 4W1VA 1CQ6A 3DRDA 2QLRA 1EG5A 3W1JA 1D2FA 4BA4A 1DJ9A 2Z20A 3FKDA 1N31A 3PAAA 2ZY4A 4N0BA 1B9HA 4GE4A 1E5FA 1KL2A 2WK7A 2WK9A 1BT4A 3GBXA 3PD6B 4HF8A 4JEXA 1M6SA 4U2HA 3KGXA 1SZSA 3RCHB 5G2PA 2FM1A 1JF9A 5G4JA 2QB2A 3ECDA 2V0YA 3NU7A 1TOEA 1VP4A 1X0MA 3L8AA 3FQ7A 2CB1A 1SVVA 1FG7A 1RV4A 1YIZA 2PO3A 1BQAA 4ZSYA 3K40A 4MGRA 4IYOA 4WBTA 5M46A 4R2NA 4NOGA 4WXBA 2AEUA 1TASA 2FYFA 1O62A 3CAIA 3NNKA 2YCTA 4J8LA 4MY5A 4CVQA 2YKVA 2VMNA 1DTYA 2W7FA 3EI7A 4JEWA 3HQTA 3PDBA 3PIUA 1B8GA 1OXPA 1S09A 4IX8A 5EUDA 1MDZA 4WYDA 5F8VA 1M0NA 4Y0IA 4JE5D 1DGEA 3DXWA 4UQVA 1ARHA 2AY8A 2BIGA 2OKJA 1CL1A 1CQ7A 2WK8A 3A9ZA 5TF5A 4E3RA 2X3LA 4F5GA 4ZAHA 1BJOA 4A6RA 3G0TA 4OBUA 3N4XA 3GZDC 2AY3A 4ADCA 2EZ1A 4P3MA 3DZZA 2Q7WA 3LG0A 4XJPA 1TPLA 1XEYA 1YJSA 1GEXA 4P7YA 3JWAA 1V2DA 1C0NA 3JZLA 2C44A 2DKBA 1G4VA 3F9TA 5BJ3A 3JU7A 1Z7DA 4A0RA 4R8DA 3EI5A 1M7YA 2C0RA 3QPGA 3LVLB 2JG2A 2W7GA 3LVKA 2OQXA 1YJYA 3AOVA 3MKJA 3P6KA 3DYDA 5E3KA 5EIGB 1TARA 1IJIA 4H51A 1WYUA 4GDYA 1UU0A 4MSOA 4RJ0A 3WCOA 1ELQA 1RVUA 3AEJC 4LW4A 1O4SA 2R5CA 2YKYA 2E7IA 3R9AA 1RVYA 3PD6A 4A0HA 3E2ZB 2R2NA 1CS1A 2Z61A 2AY5A 3A9YA 3IHJA 4ADBA 4AZJA 1YJZA 1GC0A 2VMQA 2DGKA 1YIYA 4TMRA 3HVYA 4BQ0A 2D5YA 3DXVA 3FZ6A 4B98A 4F5HA 3HDOA 1LC7A 2AY7A 1I29A 2JJEA 2QB3A 1FG3A 1MAPA 5IWQA 2EPJA 3DC1A 4F5LA 1B5OA 5DB5A 4A0FA 4UHOA 1D7SA 1LW4A 2AY4A 2ZSMA 1GCKA 4A0GA 3VK3A 4AH3A 1U08A 3ELPA 3EUCA 4WB0A 3AEOA 4BA5A 3EI8A 1QJ3A 2VGWA 3GR9A 4WP0A 2OGAA 2ZYJA 3LVMA 1KMJA 3PA9A 5C6UA 2Z9WA 5BJ4A 3NUBA 1SZKA 1GC2A 2GMUA 3AEMC 5M4DA 3FZ7A 1AMAA 1WYTA 3N5MA 4JE5A 4Y0DA 4DBCA 2HP2A 3CQ6A 1WYUB 3GWPA 3GZDA 2CJDA 4TV7A 3RI6A 2VMOA 4EFFA 2VI9A 1IVRA 2VYCA 3BB8A 1W23A 2VMSA 3QN6A 2DGLA 4Q76A 4F5MA 2QBTA 4A6TA 4GE7A 5E5IA 3FDBA 3OP7A 2HOYA 4K2BA 1TOJA 1AMRA 4AOAA 1OXOA 3ELEA 4ADEA 4LNJA 1VEFA 1S0AA 1ASNA 3VP6A 2X5FA 7AATA 3GJUA 3ASBA 3W1IA 2CANA 2JJGA 3EZSA 3AEPA 3BC8A 3P1TA 3I4JA 2BWOA 1DJUA 2E7JA 3WZFA 3PJ0A 2DR1A 4IYOB 4ATQA 2CFBA 1AY5A 3ZRPA 4RKDA 2YRRA 3HLMA 1AHEA 2ZY5A 1RV3A 1M0PA 2CJGA 3HT4A 2W7HA 4ITGA 3WKRA 2E7UA 3MADA 3MC6C 4ATPA 4N0WA 3MAUA 1Z3ZA 1CQ8A 4RITA 3TFTA 4WYGA 3AATA 3K28A 3PDXA 1G4XA 2JJFA 4UHMA 2W7IA 3N4SA 2OATA 4A6UA 5HDMA 1AKAA 2VMVA 4W1WA 1BJOB 4MKKA 4PIWA 1W3UA 3NTJA 1AAWA 4RM1A 2GQNA 1G7XA 1I41A 1BS0A 3G8MA 4AO9A 1BQDA 2WB6A 3N75A 4CBSA 3FQ8A 1H1CA 2HZPA 3CQ4A 5HHYA 3RUYA 4ZSWA 1AX4A 1WKGA 2HOXA 1PG8A 1M4NA 2GMSA 1SPAA 4RAEA 4A00A 2D65A 4W91A 2D64A 4RKCA 1N8PA 2RFVA 4XQ2A 3ZZKA 1XI9A 1GC3A 2Z9UA 4RIZA 4E77A 2QA3A 1AHXA 4GEBA 3FSLA 3BS8A 4Q31A 3WLXA 5M49A 3D6KA 3MBBA 2ZC0A 2DKJA 1YAAA 2QSRA 2ORDA 3N4RA 1W7MA 3NU8A 2V1PA 3ZZJA 4ZDLA 1C7OA 4E1OA 3HL2A 1LC8A 1S08A 2W7DA 4IXOA 2D61A 2DGMA 2BWNA 1PMMA 4UHNA 2HUUA 2FNUA 2YHKA 2GB3A 4Q75A 1B9IA 4MQRA 1TOIA 2W7LA 4ZDPA 4W5KA 4WYFA 2VMXA 1IX8A 2VI8A 4GE9A 4OT8A 5EAVA 1J04A 1BJ4A 4F5JA 4EMYA 3QHXA 1S07A 2AATA 2AY1A 2DOUA 1DFOA 1AY4A 3RBFA 1JS6A 2YKXA 4BHDA 2VMUA 5FT5A 2D7YA 2R5CB 1OHYA 3UE8A 2CTZA 4M2KA 2O1BA 2D7ZA 2OGEA 2ZSLA 1TATA 3A2BA 1ARGA 1CL2A 5FT6A 1ARIA 1AKBA 4HVKA 3RCHA 1WYTB 1MDXA 3WKSA 3CQ5A 1QITA 1SZUA 2JJHA 2A1VA 1X2AA 3NYTA 2W7MA 4ZWVA 3DU4A 1ORDA 4IXSA 4ZASA 4JEZA 5D95A 5G4IA 1AHYA 2BHXA 5J8QA 3E2YA 3T32A 1G7WA 2TPLA 3LWSA 1KKJA 2W8UA 1EQBA 3EI9A 3FCRA 4XEWA 1MLYA 4GRXA 4AZKA 3ZRRA 2PB2A 4OMAA 5EAAA 1UKJA 2YRIA 1ASLA 1CZCA 2JISA 1WYVA 2KFPA 3NYSA 2Z1YA 2VMYA 3USFA 4KAMA 4M2MA 4MKJA 5E4ZA 1AJSB 1OATA 3BN1A 2GSAA 4A72A 2FKIA 4OCAA 3TQXA 3BWNC 2AY2A 4R5FA 5HXXA 1TOKA 1IBJA 2BI2A 3FTBA 4XK1A 1AKCA 1ZODA 2VGTA 3E6GA 5JAYA 3EI6A 5G09A 3CBFA 3UAKA 1AY8A 3JW9A 3Q8NA 3F0HA 4OTLA 1DKAA 3ISLA 1T3IA 2O0RA 2BWPA 1OHWA 1D7UA 1SF2A 1V72A 3KGWA 1I43A 1PMOA 2VMPA 3H7FA 3FRKA 3I16A 4XJLA 3VOMA 5M4BA 2EYQA 3DR7A 3WX9A 1CJ0A 1KL1A 2FNIA 4ISYA 1JG8A 1MAQA 2VGZA 1IUGA 1N2TA 3JTXA 4JF1A 2R5EA 1ARTA 2VGVA 3MAFB 2BI9A 2AEVA 1M32A 1LKCA 3NRAA 1GEWA 1V2FA 1H0CA 5EUEA 3VAXA 2YCPA 3FFRA 5LHAA 4WXFA 2AY9A 1LC5A 4JEVA 4QGRA 1AIAA 4K2MA 4CBRA 4EB5A 1ASAA 2CINA 1TOGA 3FD0A 3BV0A 4MQQA 2VLHA 3BWOA 1IAYA 2VIBA 2VIAA 1YOOA 4FL0A 2CY8A 3N0LA 5EFSA 4ZDOA 1GEYA 1AICA 1ASGA 2ZY3A 4ZWMA 4F5KA 2W7EA 3MAFA 1O61A 1QGNA 1SFFA 2BIEA 4ADDA 4ZM4A 2VMWA 5DX5A 4F4EA 2W8WA 4W1XA 3FVSA 5KTBA 3NX3A 3AEMA 3L44A 5FT4A 1BW0A 1AMSA 2W8JA 2Z67A 3AOWA 4XJMA 1I48A 3NUIA 3ASAA 4WYCA 3W1HA 1D7VA 3B1CA 2VMRA 1AMQA 4M2JA 2ZUKA 3ZRQA
chains in the Genus database with same CATH topology
2VGUA 4WLJA 4KYOA 5D5SA 4DGTA 5G0AA 1JS3A 2HORA 2W7KA 2HOZA 2O7CA 1J32A 4WYEA 2OKKA 3F6TA 3VK2A 1Y4IA 3PPLA 4H63Q 2Z9XA 4LC3A 1E5EA 2ZP7A 1BKGA 1W7NA 1WKHA 3K7YA 1ELUA 5FT8A 5EUNA 4B9BA 2XBNA 1GD9A 1QZ9A 8AATA 3TFUA 2BI3A 2VMZA 4R5ZA 1IX7A 2EGYA 3AEJA 3M5UA 2CSTA 1GBNA 1DGDA 1S06A 4CXRA 3AENB 1KKPA 3AELA 2PB0A 3EZ1A 2G7JA 4GSAA 2D66A 3LV2A 3FVUA 4PFNA 4Q6RA 4PVFA 3WGCA 2BIAA 4IXZA 1GC4A 4FFCA 2WKAA 3R4TA 2X5DA 3B46A 3NDNA 1AJSA 3GETA 3OKSA 1EJIA 4LNMA 4LNLA 1LW5A 3RQ1A 3UWCA 4EB7A 3G7QA 3PGYA 9AATA 2ZJGA 2YKUA 1ECXA 4JF0A 1C4KA 1LS3A 3AENA 4WLHA 3WCNA 2BI5A 3AV7A 2BI1A 4L0OA 1DJEA 5EQCA 3BWNA 1P3WA 5K8BA 1GDEA 5EIGA 3HBXA 1C7GA 3WY7A 4ZM3A 3LVJA 1CZEA 2EO5A 4WD2A 4RJYA 3QM2A 4K2IA 4OBVA 4MQPA 1AAMA 2BKWA 2Z9VA 4WYAA 4ZLVA 3RBLA 2VMTA 3B8XA 3TCMA 4I8AA 2CH2A 5I92A 3A9XA 4AO4A 4F5IA 2XH1A 1B5PA 3E77A 2G6WA 5DJ1A 3QI6A 4PFFA 1UU2A 1M0QA 1ASFA 1PFFA 3II0A 4OC9A 1ARSA 2E54A 3EIBA 3LY1A 2C7TA 4IY7A 3DR4A 3HMUA 2F8JA 5G2QA 1X29A 4ITXA 1MLZA 1ASBA 1OHVA 1X28A 3FQAA 2CH1A 1WYVB 3QGUA 4F5FA 1W7LA 3I5TA 4E3QA 1ZC9A 2X8UA 3BCAA 2VGSA 2AY6A 2W7JA 1M0OA 3B1EA 3B1DA 4O6ZA 3BCXA 1MGVA 2W8TA 3E2FA 3KE3A 3VK4A 2BYLA 3TATA 3N7NA 2ZY2A 3MC6A 1ASCA 2FN6A 4KXKA 1FC4A 1AJRA 3EIAA 3JWBA 4XAUA 4Y0HA 2CJHA 1AIBA 2FQ6A 2QMAA 3H9XA 4EU1A 1ASMA 1IX6A 3MEBA 1AHFA 3NYUA 2EZ2A 3GZCA 4JEYA 1QISA 2VLFA 3E2ZA 3BCBA 1O69A 2Z1ZA 2D63A 3ATHA 3FFHA 4W8IA 5LH9A 2EH6A 4K05A 4UOYA 3QBOA 4IW7A 4U1TA 2R0TA 5F9SA 4WXGA 4CXQA 1QJ5A 2NMPA 3ACZA 2BYJA 1BJNA 3H14A 3KKIA 3E9KA 1VJOA 3FZ8A 1C9CA 1LK9A 1UU1A 3GSBA 2HUFA 2HP1A 2HUIA 1B4XA 4BMKA 1ASDA 4WB0B 1ASEA 2YCNA 2W8VA 3WGBA 1BJWA 1WSTA 4XJOA 1V2EA 3FVXA 4DQ6A 3PDBB 4TN4A 4J5UA 3A8UX 4RLGA 2YOBA 1AHGA 1QIRA 3DODA 1MDOA 5AX8A 2C81A 3IF2A 1KMKA 1ZOBA 1IAXA 3FDDA 1C7NA 5DJ9A 3COGA 2JGTA 4LW2A 4OYTA 1YNUA 1D7RA 4W1VA 1CQ6A 3DRDA 2QLRA 1EG5A 3W1JA 1D2FA 4BA4A 1DJ9A 2Z20A 3FKDA 1N31A 3PAAA 2ZY4A 4N0BA 1B9HA 4GE4A 1E5FA 1KL2A 2WK7A 2WK9A 1BT4A 3GBXA 3PD6B 4HF8A 4JEXA 1M6SA 4U2HA 3KGXA 1SZSA 3RCHB 5G2PA 2FM1A 1JF9A 5G4JA 2QB2A 3ECDA 2V0YA 3NU7A 1TOEA 1VP4A 1X0MA 3L8AA 3FQ7A 2CB1A 1SVVA 1FG7A 1RV4A 1YIZA 2PO3A 1BQAA 4ZSYA 3K40A 4MGRA 4IYOA 4WBTA 5M46A 4R2NA 4NOGA 4WXBA 2AEUA 1TASA 2FYFA 1O62A 3CAIA 3NNKA 2YCTA 4J8LA 4MY5A 4CVQA 2YKVA 2VMNA 1DTYA 2W7FA 3EI7A 4JEWA 3HQTA 3PDBA 3PIUA 1B8GA 1OXPA 1S09A 4IX8A 5EUDA 1MDZA 4WYDA 5F8VA 1M0NA 4Y0IA 4JE5D 1DGEA 3DXWA 4UQVA 1ARHA 2AY8A 2BIGA 2OKJA 1CL1A 1CQ7A 2WK8A 3A9ZA 5TF5A 4E3RA 2X3LA 4F5GA 4ZAHA 1BJOA 4A6RA 3G0TA 4OBUA 3N4XA 3GZDC 2AY3A 4ADCA 2EZ1A 4P3MA 3DZZA 2Q7WA 3LG0A 4XJPA 1TPLA 1XEYA 1YJSA 1GEXA 4P7YA 3JWAA 1V2DA 1C0NA 3JZLA 2C44A 2DKBA 1G4VA 3F9TA 5BJ3A 3JU7A 1Z7DA 4A0RA 4R8DA 3EI5A 1M7YA 2C0RA 3QPGA 3LVLB 2JG2A 2W7GA 3LVKA 2OQXA 1YJYA 3AOVA 3MKJA 3P6KA 3DYDA 5E3KA 5EIGB 1TARA 1IJIA 4H51A 1WYUA 4GDYA 1UU0A 4MSOA 4RJ0A 3WCOA 1ELQA 1RVUA 3AEJC 4LW4A 1O4SA 2R5CA 2YKYA 2E7IA 3R9AA 1RVYA 3PD6A 4A0HA 3E2ZB 2R2NA 1CS1A 2Z61A 2AY5A 3A9YA 3IHJA 4ADBA 4AZJA 1YJZA 1GC0A 2VMQA 2DGKA 1YIYA 4TMRA 3HVYA 4BQ0A 2D5YA 3DXVA 3FZ6A 4B98A 4F5HA 3HDOA 1LC7A 2AY7A 1I29A 2JJEA 2QB3A 1FG3A 1MAPA 5IWQA 2EPJA 3DC1A 4F5LA 1B5OA 5DB5A 4A0FA 4UHOA 1D7SA 1LW4A 2AY4A 2ZSMA 1GCKA 4A0GA 3VK3A 4AH3A 1U08A 3ELPA 3EUCA 4WB0A 3AEOA 4BA5A 3EI8A 1QJ3A 2VGWA 3GR9A 4WP0A 2OGAA 2ZYJA 3LVMA 1KMJA 3PA9A 5C6UA 2Z9WA 5BJ4A 3NUBA 1SZKA 1GC2A 2GMUA 3AEMC 5M4DA 3FZ7A 1AMAA 1WYTA 3N5MA 4JE5A 4Y0DA 4DBCA 2HP2A 3CQ6A 1WYUB 3GWPA 3GZDA 2CJDA 4TV7A 3RI6A 2VMOA 4EFFA 2VI9A 1IVRA 2VYCA 3BB8A 1W23A 2VMSA 3QN6A 2DGLA 4Q76A 4F5MA 2QBTA 4A6TA 4GE7A 5E5IA 3FDBA 3OP7A 2HOYA 4K2BA 1TOJA 1AMRA 4AOAA 1OXOA 3ELEA 4ADEA 4LNJA 1VEFA 1S0AA 1ASNA 3VP6A 2X5FA 7AATA 3GJUA 3ASBA 3W1IA 2CANA 2JJGA 3EZSA 3AEPA 3BC8A 3P1TA 3I4JA 2BWOA 1DJUA 2E7JA 3WZFA 3PJ0A 2DR1A 4IYOB 4ATQA 2CFBA 1AY5A 3ZRPA 4RKDA 2YRRA 3HLMA 1AHEA 2ZY5A 1RV3A 1M0PA 2CJGA 3HT4A 2W7HA 4ITGA 3WKRA 2E7UA 3MADA 3MC6C 4ATPA 4N0WA 3MAUA 1Z3ZA 1CQ8A 4RITA 3TFTA 4WYGA 3AATA 3K28A 3PDXA 1G4XA 2JJFA 4UHMA 2W7IA 3N4SA 2OATA 4A6UA 5HDMA 1AKAA 2VMVA 4W1WA 1BJOB 4MKKA 4PIWA 1W3UA 3NTJA 1AAWA 4RM1A 2GQNA 1G7XA 1I41A 1BS0A 3G8MA 4AO9A 1BQDA 2WB6A 3N75A 4CBSA 3FQ8A 1H1CA 2HZPA 3CQ4A 5HHYA 3RUYA 4ZSWA 1AX4A 1WKGA 2HOXA 1PG8A 1M4NA 2GMSA 1SPAA 4RAEA 4A00A 2D65A 4W91A 2D64A 4RKCA 1N8PA 2RFVA 4XQ2A 3ZZKA 1XI9A 1GC3A 2Z9UA 4RIZA 4E77A 2QA3A 1AHXA 4GEBA 3FSLA 3BS8A 4Q31A 3WLXA 5M49A 3D6KA 3MBBA 2ZC0A 2DKJA 1YAAA 2QSRA 2ORDA 3N4RA 1W7MA 3NU8A 2V1PA 3ZZJA 4ZDLA 1C7OA 4E1OA 3HL2A 1LC8A 1S08A 2W7DA 4IXOA 2D61A 2DGMA 2BWNA 1PMMA 4UHNA 2HUUA 2FNUA 2YHKA 2GB3A 4Q75A 1B9IA 4MQRA 1TOIA 2W7LA 4ZDPA 4W5KA 4WYFA 2VMXA 1IX8A 2VI8A 4GE9A 4OT8A 5EAVA 1J04A 1BJ4A 4F5JA 4EMYA 3QHXA 1S07A 2AATA 2AY1A 2DOUA 1DFOA 1AY4A 3RBFA 1JS6A 2YKXA 4BHDA 2VMUA 5FT5A 2D7YA 2R5CB 1OHYA 3UE8A 2CTZA 4M2KA 2O1BA 2D7ZA 2OGEA 2ZSLA 1TATA 3A2BA 1ARGA 1CL2A 5FT6A 1ARIA 1AKBA 4HVKA 3RCHA 1WYTB 1MDXA 3WKSA 3CQ5A 1QITA 1SZUA 2JJHA 2A1VA 1X2AA 3NYTA 2W7MA 4ZWVA 3DU4A 1ORDA 4IXSA 4ZASA 4JEZA 5D95A 5G4IA 1AHYA 2BHXA 5J8QA 3E2YA 3T32A 1G7WA 2TPLA 3LWSA 1KKJA 2W8UA 1EQBA 3EI9A 3FCRA 4XEWA 1MLYA 4GRXA 4AZKA 3ZRRA 2PB2A 4OMAA 5EAAA 1UKJA 2YRIA 1ASLA 1CZCA 2JISA 1WYVA 2KFPA 3NYSA 2Z1YA 2VMYA 3USFA 4KAMA 4M2MA 4MKJA 5E4ZA 1AJSB 1OATA 3BN1A 2GSAA 4A72A 2FKIA 4OCAA 3TQXA 3BWNC 2AY2A 4R5FA 5HXXA 1TOKA 1IBJA 2BI2A 3FTBA 4XK1A 1AKCA 1ZODA 2VGTA 3E6GA 5JAYA 3EI6A 5G09A 3CBFA 3UAKA 1AY8A 3JW9A 3Q8NA 3F0HA 4OTLA 1DKAA 3ISLA 1T3IA 2O0RA 2BWPA 1OHWA 1D7UA 1SF2A 1V72A 3KGWA 1I43A 1PMOA 2VMPA 3H7FA 3FRKA 3I16A 4XJLA 3VOMA 5M4BA 2EYQA 3DR7A 3WX9A 1CJ0A 1KL1A 2FNIA 4ISYA 1JG8A 1MAQA 2VGZA 1IUGA 1N2TA 3JTXA 4JF1A 2R5EA 1ARTA 2VGVA 3MAFB 2BI9A 2AEVA 1M32A 1LKCA 3NRAA 1GEWA 1V2FA 1H0CA 5EUEA 3VAXA 2YCPA 3FFRA 5LHAA 4WXFA 2AY9A 1LC5A 4JEVA 4QGRA 1AIAA 4K2MA 4CBRA 4EB5A 1ASAA 2CINA 1TOGA 3FD0A 3BV0A 4MQQA 2VLHA 3BWOA 1IAYA 2VIBA 2VIAA 1YOOA 4FL0A 2CY8A 3N0LA 5EFSA 4ZDOA 1GEYA 1AICA 1ASGA 2ZY3A 4ZWMA 4F5KA 2W7EA 3MAFA 1O61A 1QGNA 1SFFA 2BIEA 4ADDA 4ZM4A 2VMWA 5DX5A 4F4EA 2W8WA 4W1XA 3FVSA 5KTBA 3NX3A 3AEMA 3L44A 5FT4A 1BW0A 1AMSA 2W8JA 2Z67A 3AOWA 4XJMA 1I48A 3NUIA 3ASAA 4WYCA 3W1HA 1D7VA 3B1CA 2VMRA 1AMQA 4M2JA 2ZUKA 3ZRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VGU A;  4WLJ A;  4KYO A;  5D5S A;  4DGT A;  5G0A A;  1JS3 A;  2HOR A;  2W7K A;  2HOZ A;  2O7C A;  1J32 A;  4WYE A;  2OKK A;  3F6T A;  3VK2 A;  1Y4I A;  3PPL A;  2Z9X A;  4LC3 A;  1E5E A;  2ZP7 A;  1BKG A;  1W7N A;  1WKH A;  3K7Y A;  1ELU A;  5FT8 A;  5EUN A;  4B9B A;  2XBN A;  1GD9 A;  1QZ9 A;  8AAT A;  3TFU A;  2BI3 A;  2VMZ A;  4R5Z A;  1IX7 A;  2EGY A;  3AEJ A;  3M5U A;  2CST A;  1GBN A;  1DGD A;  1S06 A;  4CXR A;  3AEN B;  1KKP A;  3AEL A;  2PB0 A;  3EZ1 A;  4GSA A;  2D66 A;  3LV2 A;  3FVU A;  4PFN A;  4Q6R A;  4PVF A;  3WGC A;  2BIA A;  4IXZ A;  1GC4 A;  4FFC A;  2WKA A;  3R4T A;  2X5D A;  3B46 A;  3NDN A;  1AJS A;  3GET A;  3OKS A;  1EJI A;  4LNM A;  4LNL A;  1LW5 A;  3RQ1 A;  3UWC A;  4EB7 A;  3G7Q A;  3PGY A;  9AAT A;  2ZJG A;  2YKU A;  1ECX A;  4JF0 A;  1C4K A;  1LS3 A;  3AEN A;  4WLH A;  3WCN A;  2BI5 A;  3AV7 A;  2BI1 A;  4L0O A;  1DJE A;  5EQC A;  3BWN A;  1P3W A;  5K8B A;  1GDE A;  5EIG A;  3HBX A;  1C7G A;  3WY7 A;  4ZM3 A;  3LVJ A;  1CZE A;  2EO5 A;  4WD2 A;  4RJY A;  3QM2 A;  4K2I A;  4OBV A;  4MQP A;  1AAM A;  2BKW A;  2Z9V A;  4WYA A;  4ZLV A;  3RBL A;  2VMT A;  3B8X A;  3TCM A;  4I8A A;  2CH2 A;  5I92 A;  3A9X A;  4AO4 A;  4F5I A;  2XH1 A;  1B5P A;  3E77 A;  2G6W A;  5DJ1 A;  3QI6 A;  4PFF A;  1UU2 A;  1M0Q A;  1ASF A;  1PFF A;  3II0 A;  4OC9 A;  1ARS A;  2E54 A;  3EIB A;  3LY1 A;  2C7T A;  4IY7 A;  3DR4 A;  3HMU A;  2F8J A;  5G2Q A;  1X29 A;  4ITX A;  1MLZ A;  1ASB A;  1OHV A;  1X28 A;  3FQA A;  2CH1 A;  1WYV B;  3QGU A;  4F5F A;  1W7L A;  3I5T A;  4E3Q A;  1ZC9 A;  2X8U A;  3BCA A;  2VGS A;  2AY6 A;  2W7J A;  1M0O A;  3B1E A;  3B1D A;  4O6Z A;  3BCX A;  1MGV A;  2W8T A;  3E2F A;  3KE3 A;  3VK4 A;  2BYL A;  3TAT A;  2ZY2 A;  3MC6 A;  1ASC A;  2FN6 A;  4KXK A;  1FC4 A;  1AJR A;  3EIA A;  3JWB A;  4XAU A;  4Y0H A;  2CJH A;  1AIB A;  2FQ6 A;  2QMA A;  4EU1 A;  1ASM A;  1IX6 A;  3MEB A;  1AHF A;  3NYU A;  2EZ2 A;  3GZC A;  4JEY A;  1QIS A;  2VLF A;  3E2Z A;  3BCB A;  1O69 A;  2Z1Z A;  2D63 A;  3ATH A;  3FFH A;  4W8I A;  5LH9 A;  2EH6 A;  4UOY A;  3QBO A;  4IW7 A;  4U1T A;  2R0T A;  5F9S A;  4WXG A;  4CXQ A;  1QJ5 A;  2NMP A;  3ACZ A;  2BYJ A;  1BJN A;  3H14 A;  3KKI A;  3E9K A;  1VJO A;  3FZ8 A;  1C9C A;  1LK9 A;  1UU1 A;  3GSB A;  2HUF A;  2HP1 A;  2HUI A;  1B4X A;  4BMK A;  1ASD A;  4WB0 B;  1ASE A;  2YCN A;  2W8V A;  3WGB A;  1BJW A;  1WST A;  4XJO A;  1V2E A;  3FVX A;  4DQ6 A;  3PDB B;  4TN4 A;  4J5U A;  3A8U X;  4RLG A;  2YOB A;  1AHG A;  1QIR A;  3DOD A;  1MDO A;  5AX8 A;  2C81 A;  3IF2 A;  1KMK A;  1ZOB A;  1IAX A;  3FDD A;  1C7N A;  5DJ9 A;  3COG A;  2JGT A;  4LW2 A;  4OYT A;  1YNU A;  1D7R A;  4W1V A;  1CQ6 A;  3DRD A;  2QLR A;  1EG5 A;  3W1J A;  1D2F A;  4BA4 A;  1DJ9 A;  2Z20 A;  3FKD A;  1N31 A;  3PAA A;  2ZY4 A;  4N0B A;  1B9H A;  4GE4 A;  1E5F A;  1KL2 A;  2WK7 A;  2WK9 A;  1BT4 A;  3GBX A;  3PD6 B;  4HF8 A;  4JEX A;  1M6S A;  4U2H A;  3KGX A;  1SZS A;  3RCH B;  5G2P A;  2FM1 A;  1JF9 A;  5G4J A;  2QB2 A;  3ECD A;  2V0Y A;  3NU7 A;  1TOE A;  1VP4 A;  1X0M A;  3L8A A;  3FQ7 A;  2CB1 A;  1SVV A;  1FG7 A;  1RV4 A;  1YIZ A;  2PO3 A;  1BQA A;  4ZSY A;  3K40 A;  4MGR A;  4IYO A;  4WBT A;  5M46 A;  4R2N A;  4NOG A;  4WXB A;  2AEU A;  1TAS A;  2FYF A;  1O62 A;  3CAI A;  3NNK A;  2YCT A;  4J8L A;  4MY5 A;  4CVQ A;  2YKV A;  2VMN A;  1DTY A;  2W7F A;  3EI7 A;  4JEW A;  3HQT A;  3PDB A;  3PIU A;  1B8G A;  1OXP A;  1S09 A;  4IX8 A;  5EUD A;  1MDZ A;  4WYD A;  5F8V A;  1M0N A;  4Y0I A;  4JE5 D;  1DGE A;  3DXW A;  4UQV A;  1ARH A;  2AY8 A;  2BIG A;  2OKJ A;  1CL1 A;  1CQ7 A;  2WK8 A;  3A9Z A;  5TF5 A;  4E3R A;  2X3L A;  4F5G A;  4ZAH A;  1BJO A;  4A6R A;  3G0T A;  4OBU A;  3GZD C;  2AY3 A;  4ADC A;  2EZ1 A;  4P3M A;  3DZZ A;  2Q7W A;  3LG0 A;  4XJP A;  1TPL A;  1XEY A;  1YJS A;  1GEX A;  4P7Y A;  3JWA A;  1V2D A;  1C0N A;  3JZL A;  2C44 A;  2DKB A;  1G4V A;  3F9T A;  5BJ3 A;  3JU7 A;  1Z7D A;  4A0R A;  4R8D A;  3EI5 A;  1M7Y A;  2C0R A;  3QPG A;  3LVL B;  2JG2 A;  2W7G A;  3LVK A;  2OQX A;  1YJY A;  3AOV A;  3MKJ A;  3P6K A;  3DYD A;  5E3K A;  5EIG B;  1TAR A;  1IJI A;  4H51 A;  1WYU A;  4GDY A;  1UU0 A;  4MSO A;  4RJ0 A;  3WCO A;  1ELQ A;  1RVU A;  3AEJ C;  4LW4 A;  1O4S A;  2R5C A;  2YKY A;  2E7I A;  3R9A A;  1RVY A;  3PD6 A;  4A0H A;  3E2Z B;  2R2N A;  1CS1 A;  2Z61 A;  2AY5 A;  3A9Y A;  3IHJ A;  4ADB A;  4AZJ A;  1YJZ A;  1GC0 A;  2VMQ A;  2DGK A;  1YIY A;  4TMR A;  3HVY A;  4BQ0 A;  2D5Y A;  3DXV A;  3FZ6 A;  4B98 A;  4F5H A;  3HDO A;  1LC7 A;  2AY7 A;  1I29 A;  2JJE A;  2QB3 A;  1FG3 A;  1MAP A;  5IWQ A;  2EPJ A;  3DC1 A;  4F5L A;  1B5O A;  5DB5 A;  4A0F A;  4UHO A;  1D7S A;  1LW4 A;  2AY4 A;  2ZSM A;  1GCK A;  4A0G A;  3VK3 A;  4AH3 A;  1U08 A;  3ELP A;  3EUC A;  4WB0 A;  3AEO A;  4BA5 A;  3EI8 A;  1QJ3 A;  2VGW A;  3GR9 A;  4WP0 A;  2OGA A;  2ZYJ A;  3LVM A;  1KMJ A;  3PA9 A;  5C6U A;  2Z9W A;  5BJ4 A;  3NUB A;  1SZK A;  1GC2 A;  2GMU A;  3AEM C;  5M4D A;  3FZ7 A;  1AMA A;  1WYT A;  3N5M A;  4JE5 A;  4Y0D A;  4DBC A;  2HP2 A;  3CQ6 A;  1WYU B;  3GWP A;  3GZD A;  2CJD A;  4TV7 A;  3RI6 A;  2VMO A;  4EFF A;  2VI9 A;  1IVR A;  2VYC A;  3BB8 A;  1W23 A;  2VMS A;  3QN6 A;  2DGL A;  4Q76 A;  4F5M A;  2QBT A;  4A6T A;  4GE7 A;  5E5I A;  3FDB A;  3OP7 A;  2HOY A;  4K2B A;  1TOJ A;  1AMR A;  4AOA A;  1OXO A;  3ELE A;  4ADE A;  4LNJ A;  1VEF A;  1S0A A;  1ASN A;  3VP6 A;  2X5F A;  7AAT A;  3GJU A;  3ASB A;  3W1I A;  2CAN A;  2JJG A;  3EZS A;  3AEP A;  3BC8 A;  3P1T A;  3I4J A;  2BWO A;  1DJU A;  2E7J A;  3WZF A;  3PJ0 A;  2DR1 A;  4IYO B;  4ATQ A;  2CFB A;  1AY5 A;  3ZRP A;  4RKD A;  2YRR A;  3HLM A;  1AHE A;  2ZY5 A;  1RV3 A;  1M0P A;  2CJG A;  3HT4 A;  2W7H A;  4ITG A;  3WKR A;  2E7U A;  3MAD A;  3MC6 C;  4ATP A;  4N0W A;  3MAU A;  1Z3Z A;  1CQ8 A;  4RIT A;  3TFT A;  4WYG A;  3AAT A;  3K28 A;  3PDX A;  1G4X A;  2JJF A;  4UHM A;  2W7I A;  2OAT A;  4A6U A;  5HDM A;  1AKA A;  2VMV A;  4W1W A;  1BJO B;  4MKK A;  4PIW A;  1W3U A;  3NTJ A;  1AAW A;  4RM1 A;  2GQN A;  1G7X A;  1I41 A;  1BS0 A;  3G8M A;  4AO9 A;  1BQD A;  3N75 A;  4CBS A;  3FQ8 A;  1H1C A;  2HZP A;  3CQ4 A;  5HHY A;  3RUY A;  4ZSW A;  1AX4 A;  1WKG A;  2HOX A;  1PG8 A;  1M4N A;  2GMS A;  1SPA A;  4RAE A;  4A00 A;  2D65 A;  4W91 A;  2D64 A;  4RKC A;  1N8P A;  2RFV A;  4XQ2 A;  3ZZK A;  1XI9 A;  1GC3 A;  2Z9U A;  4RIZ A;  4E77 A;  2QA3 A;  1AHX A;  4GEB A;  3FSL A;  3BS8 A;  4Q31 A;  3WLX A;  5M49 A;  3D6K A;  3MBB A;  2ZC0 A;  2DKJ A;  1YAA A;  2ORD A;  1W7M A;  3NU8 A;  2V1P A;  3ZZJ A;  4ZDL A;  1C7O A;  4E1O A;  3HL2 A;  1LC8 A;  1S08 A;  2W7D A;  4IXO A;  2D61 A;  2DGM A;  2BWN A;  1PMM A;  4UHN A;  2HUU A;  2FNU A;  2YHK A;  2GB3 A;  4Q75 A;  1B9I A;  4MQR A;  1TOI A;  2W7L A;  4ZDP A;  4W5K A;  4WYF A;  2VMX A;  1IX8 A;  2VI8 A;  4GE9 A;  4OT8 A;  5EAV A;  1J04 A;  1BJ4 A;  4F5J A;  4EMY A;  3QHX A;  1S07 A;  2AAT A;  2AY1 A;  2DOU A;  1DFO A;  1AY4 A;  3RBF A;  1JS6 A;  2YKX A;  4BHD A;  2VMU A;  5FT5 A;  2D7Y A;  2R5C B;  1OHY A;  3UE8 A;  2CTZ A;  4M2K A;  2O1B A;  2D7Z A;  2OGE A;  2ZSL A;  1TAT A;  3A2B A;  1ARG A;  1CL2 A;  5FT6 A;  1ARI A;  1AKB A;  4HVK A;  3RCH A;  1WYT B;  1MDX A;  3WKS A;  3CQ5 A;  1QIT A;  1SZU A;  2JJH A;  1X2A A;  3NYT A;  2W7M A;  4ZWV A;  3DU4 A;  1ORD A;  4IXS A;  4ZAS A;  4JEZ A;  5D95 A;  5G4I A;  1AHY A;  2BHX A;  5J8Q A;  3E2Y A;  3T32 A;  1G7W A;  2TPL A;  3LWS A;  1KKJ A;  2W8U A;  1EQB A;  3EI9 A;  3FCR A;  4XEW A;  1MLY A;  4GRX A;  4AZK A;  3ZRR A;  2PB2 A;  4OMA A;  5EAA A;  1UKJ A;  2YRI A;  1ASL A;  1CZC A;  2JIS A;  1WYV A;  3NYS A;  2Z1Y A;  2VMY A;  3USF A;  4KAM A;  4M2M A;  4MKJ A;  5E4Z A;  1AJS B;  1OAT A;  3BN1 A;  2GSA A;  4A72 A;  4OCA A;  3TQX A;  3BWN C;  2AY2 A;  4R5F A;  5HXX A;  1TOK A;  1IBJ A;  2BI2 A;  3FTB A;  4XK1 A;  1AKC A;  1ZOD A;  2VGT A;  3E6G A;  5JAY A;  3EI6 A;  5G09 A;  3CBF A;  3UAK A;  1AY8 A;  3JW9 A;  3Q8N A;  3F0H A;  4OTL A;  1DKA A;  3ISL A;  1T3I A;  2O0R A;  2BWP A;  1OHW A;  1D7U A;  1SF2 A;  1V72 A;  3KGW A;  1I43 A;  1PMO A;  2VMP A;  3H7F A;  3FRK A;  3I16 A;  4XJL A;  3VOM A;  5M4B A;  3DR7 A;  3WX9 A;  1CJ0 A;  1KL1 A;  2FNI A;  4ISY A;  1JG8 A;  1MAQ A;  2VGZ A;  1IUG A;  1N2T A;  3JTX A;  4JF1 A;  2R5E A;  1ART A;  2VGV A;  3MAF B;  2BI9 A;  2AEV A;  1M32 A;  1LKC A;  3NRA A;  1GEW A;  1V2F A;  1H0C A;  5EUE A;  3VAX A;  2YCP A;  3FFR A;  5LHA A;  4WXF A;  2AY9 A;  1LC5 A;  4JEV A;  4QGR A;  1AIA A;  4K2M A;  4CBR A;  4EB5 A;  1ASA A;  2CIN A;  1TOG A;  3FD0 A;  3BV0 A;  4MQQ A;  2VLH A;  3BWO A;  1IAY A;  2VIB A;  2VIA A;  1YOO A;  4FL0 A;  2CY8 A;  3N0L A;  5EFS A;  4ZDO A;  1GEY A;  1AIC A;  1ASG A;  2ZY3 A;  4ZWM A;  4F5K A;  2W7E A;  3MAF A;  1O61 A;  1QGN A;  1SFF A;  2BIE A;  4ADD A;  4ZM4 A;  2VMW A;  5DX5 A;  4F4E A;  2W8W A;  4W1X A;  3FVS A;  3NX3 A;  3AEM A;  3L44 A;  5FT4 A;  1BW0 A;  1AMS A;  2W8J A;  2Z67 A;  3AOW A;  4XJM A;  1I48 A;  3NUI A;  3ASA A;  4WYC A;  3W1H A;  1D7V A;  3B1C A;  2VMR A;  1AMQ A;  4M2J A;  2ZUK A;  3ZRQ A; 
#chains in the Genus database with same CATH topology
 2VGU A;  4WLJ A;  4KYO A;  5D5S A;  4DGT A;  5G0A A;  1JS3 A;  2HOR A;  2W7K A;  2HOZ A;  2O7C A;  1J32 A;  4WYE A;  2OKK A;  3F6T A;  3VK2 A;  1KAF A;  1Y4I A;  3PPL A;  4H63 Q;  2Z9X A;  4LC3 A;  1E5E A;  2ZP7 A;  1BKG A;  1W7N A;  1WKH A;  3K7Y A;  1ELU A;  5FT8 A;  5EUN A;  4B9B A;  2XBN A;  1GD9 A;  1QZ9 A;  8AAT A;  3TFU A;  2BI3 A;  2VMZ A;  4R5Z A;  1IX7 A;  2EGY A;  3AEJ A;  3M5U A;  2CST A;  1GBN A;  1DGD A;  1S06 A;  4CXR A;  3AEN B;  1KKP A;  3AEL A;  2PB0 A;  3EZ1 A;  2G7J A;  4GSA A;  2D66 A;  3LV2 A;  3FVU A;  4PFN A;  4Q6R A;  4PVF A;  3WGC A;  2BIA A;  4IXZ A;  1GC4 A;  4FFC A;  2WKA A;  3R4T A;  2X5D A;  3B46 A;  3NDN A;  1AJS A;  3GET A;  3OKS A;  1EJI A;  4LNM A;  4LNL A;  1LW5 A;  3RQ1 A;  3UWC A;  4EB7 A;  3G7Q A;  3PGY A;  9AAT A;  2ZJG A;  2YKU A;  1ECX A;  4JF0 A;  1C4K A;  1LS3 A;  3AEN A;  4WLH A;  3WCN A;  2BI5 A;  3AV7 A;  2BI1 A;  4L0O A;  1DJE A;  5EQC A;  3BWN A;  1P3W A;  5K8B A;  1GDE A;  5EIG A;  3HBX A;  1C7G A;  3WY7 A;  4ZM3 A;  3LVJ A;  1CZE A;  2EO5 A;  4WD2 A;  4RJY A;  3QM2 A;  4K2I A;  4OBV A;  4MQP A;  1AAM A;  2BKW A;  2Z9V A;  4WYA A;  4ZLV A;  3RBL A;  2VMT A;  3B8X A;  3TCM A;  4I8A A;  2CH2 A;  5I92 A;  3A9X A;  4AO4 A;  4F5I A;  2XH1 A;  1B5P A;  3E77 A;  2G6W A;  5DJ1 A;  3QI6 A;  4PFF A;  1UU2 A;  1M0Q A;  1ASF A;  1PFF A;  3II0 A;  4OC9 A;  1ARS A;  2E54 A;  3EIB A;  3LY1 A;  2C7T A;  4IY7 A;  3DR4 A;  3HMU A;  2F8J A;  5G2Q A;  1X29 A;  4ITX A;  1MLZ A;  1ASB A;  1OHV A;  1X28 A;  3FQA A;  2CH1 A;  1WYV B;  3QGU A;  4F5F A;  1W7L A;  3I5T A;  4E3Q A;  1ZC9 A;  2X8U A;  3BCA A;  2VGS A;  2AY6 A;  2W7J A;  1M0O A;  3B1E A;  3B1D A;  4O6Z A;  3BCX A;  1MGV A;  2W8T A;  3E2F A;  3KE3 A;  3VK4 A;  2BYL A;  3TAT A;  3N7N A;  2ZY2 A;  3MC6 A;  1ASC A;  2FN6 A;  4KXK A;  1FC4 A;  1AJR A;  3EIA A;  3JWB A;  4XAU A;  4Y0H A;  2CJH A;  1AIB A;  2FQ6 A;  2QMA A;  3H9X A;  4EU1 A;  1ASM A;  1IX6 A;  3MEB A;  1AHF A;  3NYU A;  2EZ2 A;  3GZC A;  4JEY A;  1QIS A;  2VLF A;  3E2Z A;  3BCB A;  1O69 A;  2Z1Z A;  2D63 A;  3ATH A;  3FFH A;  4W8I A;  5LH9 A;  2EH6 A;  4K05 A;  4UOY A;  3QBO A;  4IW7 A;  4U1T A;  2R0T A;  5F9S A;  4WXG A;  4CXQ A;  1QJ5 A;  2NMP A;  3ACZ A;  2BYJ A;  1BJN A;  3H14 A;  3KKI A;  3E9K A;  1VJO A;  3FZ8 A;  1C9C A;  1LK9 A;  1UU1 A;  3GSB A;  2HUF A;  2HP1 A;  2HUI A;  1B4X A;  4BMK A;  1ASD A;  4WB0 B;  1ASE A;  2YCN A;  2W8V A;  3WGB A;  1BJW A;  1WST A;  4XJO A;  1V2E A;  3FVX A;  4DQ6 A;  3PDB B;  4TN4 A;  4J5U A;  3A8U X;  4RLG A;  2YOB A;  1AHG A;  1QIR A;  3DOD A;  1MDO A;  5AX8 A;  2C81 A;  3IF2 A;  1KMK A;  1ZOB A;  1IAX A;  3FDD A;  1C7N A;  5DJ9 A;  3COG A;  2JGT A;  4LW2 A;  4OYT A;  1YNU A;  1D7R A;  4W1V A;  1CQ6 A;  3DRD A;  2QLR A;  1EG5 A;  3W1J A;  1D2F A;  4BA4 A;  1DJ9 A;  2Z20 A;  3FKD A;  1N31 A;  3PAA A;  2ZY4 A;  4N0B A;  1B9H A;  4GE4 A;  1E5F A;  1KL2 A;  2WK7 A;  2WK9 A;  1BT4 A;  3GBX A;  3PD6 B;  4HF8 A;  4JEX A;  1M6S A;  4U2H A;  3KGX A;  1SZS A;  3RCH B;  5G2P A;  2FM1 A;  1JF9 A;  5G4J A;  2QB2 A;  3ECD A;  2V0Y A;  3NU7 A;  1TOE A;  1VP4 A;  1X0M A;  3L8A A;  3FQ7 A;  2CB1 A;  1SVV A;  1FG7 A;  1RV4 A;  1YIZ A;  2PO3 A;  1BQA A;  4ZSY A;  3K40 A;  4MGR A;  4IYO A;  4WBT A;  5M46 A;  4R2N A;  4NOG A;  4WXB A;  2AEU A;  1TAS A;  2FYF A;  1O62 A;  3CAI A;  3NNK A;  2YCT A;  4J8L A;  4MY5 A;  4CVQ A;  2YKV A;  2VMN A;  1DTY A;  2W7F A;  3EI7 A;  4JEW A;  3HQT A;  3PDB A;  3PIU A;  1B8G A;  1OXP A;  1S09 A;  4IX8 A;  5EUD A;  1MDZ A;  4WYD A;  5F8V A;  1M0N A;  4Y0I A;  4JE5 D;  1DGE A;  3DXW A;  4UQV A;  1ARH A;  2AY8 A;  2BIG A;  2OKJ A;  1CL1 A;  1CQ7 A;  2WK8 A;  3A9Z A;  5TF5 A;  4E3R A;  2X3L A;  4F5G A;  4ZAH A;  1BJO A;  4A6R A;  3G0T A;  4OBU A;  3N4X A;  3GZD C;  2AY3 A;  4ADC A;  2EZ1 A;  4P3M A;  3DZZ A;  2Q7W A;  3LG0 A;  4XJP A;  1TPL A;  1XEY A;  1YJS A;  1GEX A;  4P7Y A;  3JWA A;  1V2D A;  1C0N A;  3JZL A;  2C44 A;  2DKB A;  1G4V A;  3F9T A;  5BJ3 A;  3JU7 A;  1Z7D A;  4A0R A;  4R8D A;  3EI5 A;  1M7Y A;  2C0R A;  3QPG A;  3LVL B;  2JG2 A;  2W7G A;  3LVK A;  2OQX A;  1YJY A;  3AOV A;  3MKJ A;  3P6K A;  3DYD A;  5E3K A;  5EIG B;  1TAR A;  1IJI A;  4H51 A;  1WYU A;  4GDY A;  1UU0 A;  4MSO A;  4RJ0 A;  3WCO A;  1ELQ A;  1RVU A;  3AEJ C;  4LW4 A;  1O4S A;  2R5C A;  2YKY A;  2E7I A;  3R9A A;  1RVY A;  3PD6 A;  4A0H A;  3E2Z B;  2R2N A;  1CS1 A;  2Z61 A;  2AY5 A;  3A9Y A;  3IHJ A;  4ADB A;  4AZJ A;  1YJZ A;  1GC0 A;  2VMQ A;  2DGK A;  1YIY A;  4TMR A;  3HVY A;  4BQ0 A;  2D5Y A;  3DXV A;  3FZ6 A;  4B98 A;  4F5H A;  3HDO A;  1LC7 A;  2AY7 A;  1I29 A;  2JJE A;  2QB3 A;  1FG3 A;  1MAP A;  5IWQ A;  2EPJ A;  3DC1 A;  4F5L A;  1B5O A;  5DB5 A;  4A0F A;  4UHO A;  1D7S A;  1LW4 A;  2AY4 A;  2ZSM A;  1GCK A;  4A0G A;  3VK3 A;  4AH3 A;  1U08 A;  3ELP A;  3EUC A;  4WB0 A;  3AEO A;  4BA5 A;  3EI8 A;  1QJ3 A;  2VGW A;  3GR9 A;  4WP0 A;  2OGA A;  2ZYJ A;  3LVM A;  1KMJ A;  3PA9 A;  5C6U A;  2Z9W A;  5BJ4 A;  3NUB A;  1SZK A;  1GC2 A;  2GMU A;  3AEM C;  5M4D A;  3FZ7 A;  1AMA A;  1WYT A;  3N5M A;  4JE5 A;  4Y0D A;  4DBC A;  2HP2 A;  3CQ6 A;  1WYU B;  3GWP A;  3GZD A;  2CJD A;  4TV7 A;  3RI6 A;  2VMO A;  4EFF A;  2VI9 A;  1IVR A;  2VYC A;  3BB8 A;  1W23 A;  2VMS A;  3QN6 A;  2DGL A;  4Q76 A;  4F5M A;  2QBT A;  4A6T A;  4GE7 A;  5E5I A;  3FDB A;  3OP7 A;  2HOY A;  4K2B A;  1TOJ A;  1AMR A;  4AOA A;  1OXO A;  3ELE A;  4ADE A;  4LNJ A;  1VEF A;  1S0A A;  1ASN A;  3VP6 A;  2X5F A;  7AAT A;  3GJU A;  3ASB A;  3W1I A;  2CAN A;  2JJG A;  3EZS A;  3AEP A;  3BC8 A;  3P1T A;  3I4J A;  2BWO A;  1DJU A;  2E7J A;  3WZF A;  3PJ0 A;  2DR1 A;  4IYO B;  4ATQ A;  2CFB A;  1AY5 A;  3ZRP A;  4RKD A;  2YRR A;  3HLM A;  1AHE A;  2ZY5 A;  1RV3 A;  1M0P A;  2CJG A;  3HT4 A;  2W7H A;  4ITG A;  3WKR A;  2E7U A;  3MAD A;  3MC6 C;  4ATP A;  4N0W A;  3MAU A;  1Z3Z A;  1CQ8 A;  4RIT A;  3TFT A;  4WYG A;  3AAT A;  3K28 A;  3PDX A;  1G4X A;  2JJF A;  4UHM A;  2W7I A;  3N4S A;  2OAT A;  4A6U A;  5HDM A;  1AKA A;  2VMV A;  4W1W A;  1BJO B;  4MKK A;  4PIW A;  1W3U A;  3NTJ A;  1AAW A;  4RM1 A;  2GQN A;  1G7X A;  1I41 A;  1BS0 A;  3G8M A;  4AO9 A;  1BQD A;  2WB6 A;  3N75 A;  4CBS A;  3FQ8 A;  1H1C A;  2HZP A;  3CQ4 A;  5HHY A;  3RUY A;  4ZSW A;  1AX4 A;  1WKG A;  2HOX A;  1PG8 A;  1M4N A;  2GMS A;  1SPA A;  4RAE A;  4A00 A;  2D65 A;  4W91 A;  2D64 A;  4RKC A;  1N8P A;  2RFV A;  4XQ2 A;  3ZZK A;  1XI9 A;  1GC3 A;  2Z9U A;  4RIZ A;  4E77 A;  2QA3 A;  1AHX A;  4GEB A;  3FSL A;  3BS8 A;  4Q31 A;  3WLX A;  5M49 A;  3D6K A;  3MBB A;  2ZC0 A;  2DKJ A;  1YAA A;  2QSR A;  2ORD A;  3N4R A;  1W7M A;  3NU8 A;  2V1P A;  3ZZJ A;  4ZDL A;  1C7O A;  4E1O A;  3HL2 A;  1LC8 A;  1S08 A;  2W7D A;  4IXO A;  2D61 A;  2DGM A;  2BWN A;  1PMM A;  4UHN A;  2HUU A;  2FNU A;  2YHK A;  2GB3 A;  4Q75 A;  1B9I A;  4MQR A;  1TOI A;  2W7L A;  4ZDP A;  4W5K A;  4WYF A;  2VMX A;  1IX8 A;  2VI8 A;  4GE9 A;  4OT8 A;  5EAV A;  1J04 A;  1BJ4 A;  4F5J A;  4EMY A;  3QHX A;  1S07 A;  2AAT A;  2AY1 A;  2DOU A;  1DFO A;  1AY4 A;  3RBF A;  1JS6 A;  2YKX A;  4BHD A;  2VMU A;  5FT5 A;  2D7Y A;  2R5C B;  1OHY A;  3UE8 A;  2CTZ A;  4M2K A;  2O1B A;  2D7Z A;  2OGE A;  2ZSL A;  1TAT A;  3A2B A;  1ARG A;  1CL2 A;  5FT6 A;  1ARI A;  1AKB A;  4HVK A;  3RCH A;  1WYT B;  1MDX A;  3WKS A;  3CQ5 A;  1QIT A;  1SZU A;  2JJH A;  2A1V A;  1X2A A;  3NYT A;  2W7M A;  4ZWV A;  3DU4 A;  1ORD A;  4IXS A;  4ZAS A;  4JEZ A;  5D95 A;  5G4I A;  1AHY A;  2BHX A;  5J8Q A;  3E2Y A;  3T32 A;  1G7W A;  2TPL A;  3LWS A;  1KKJ A;  2W8U A;  1EQB A;  3EI9 A;  3FCR A;  4XEW A;  1MLY A;  4GRX A;  4AZK A;  3ZRR A;  2PB2 A;  4OMA A;  5EAA A;  1UKJ A;  2YRI A;  1ASL A;  1CZC A;  2JIS A;  1WYV A;  2KFP A;  3NYS A;  2Z1Y A;  2VMY A;  3USF A;  4KAM A;  4M2M A;  4MKJ A;  5E4Z A;  1AJS B;  1OAT A;  3BN1 A;  2GSA A;  4A72 A;  2FKI A;  4OCA A;  3TQX A;  3BWN C;  2AY2 A;  4R5F A;  5HXX A;  1TOK A;  1IBJ A;  2BI2 A;  3FTB A;  4XK1 A;  1AKC A;  1ZOD A;  2VGT A;  3E6G A;  5JAY A;  3EI6 A;  5G09 A;  3CBF A;  3UAK A;  1AY8 A;  3JW9 A;  3Q8N A;  3F0H A;  4OTL A;  1DKA A;  3ISL A;  1T3I A;  2O0R A;  2BWP A;  1OHW A;  1D7U A;  1SF2 A;  1V72 A;  3KGW A;  1I43 A;  1PMO A;  2VMP A;  3H7F A;  3FRK A;  3I16 A;  4XJL A;  3VOM A;  5M4B A;  2EYQ A;  3DR7 A;  3WX9 A;  1CJ0 A;  1KL1 A;  2FNI A;  4ISY A;  1JG8 A;  1MAQ A;  2VGZ A;  1IUG A;  1N2T A;  3JTX A;  4JF1 A;  2R5E A;  1ART A;  2VGV A;  3MAF B;  2BI9 A;  2AEV A;  1M32 A;  1LKC A;  3NRA A;  1GEW A;  1V2F A;  1H0C A;  5EUE A;  3VAX A;  2YCP A;  3FFR A;  5LHA A;  4WXF A;  2AY9 A;  1LC5 A;  4JEV A;  4QGR A;  1AIA A;  4K2M A;  4CBR A;  4EB5 A;  1ASA A;  2CIN A;  1TOG A;  3FD0 A;  3BV0 A;  4MQQ A;  2VLH A;  3BWO A;  1IAY A;  2VIB A;  2VIA A;  1YOO A;  4FL0 A;  2CY8 A;  3N0L A;  5EFS A;  4ZDO A;  1GEY A;  1AIC A;  1ASG A;  2ZY3 A;  4ZWM A;  4F5K A;  2W7E A;  3MAF A;  1O61 A;  1QGN A;  1SFF A;  2BIE A;  4ADD A;  4ZM4 A;  2VMW A;  5DX5 A;  4F4E A;  2W8W A;  4W1X A;  3FVS A;  5KTB A;  3NX3 A;  3AEM A;  3L44 A;  5FT4 A;  1BW0 A;  1AMS A;  2W8J A;  2Z67 A;  3AOW A;  4XJM A;  1I48 A;  3NUI A;  3ASA A;  4WYC A;  3W1H A;  1D7V A;  3B1C A;  2VMR A;  1AMQ A;  4M2J A;  2ZUK A;  3ZRQ A; 
#chains in the Genus database with same CATH homology
 2VGU A;  4WLJ A;  4KYO A;  5D5S A;  4DGT A;  5G0A A;  1JS3 A;  2HOR A;  2W7K A;  2HOZ A;  2O7C A;  1J32 A;  4WYE A;  2OKK A;  3F6T A;  3VK2 A;  1Y4I A;  3PPL A;  4H63 Q;  2Z9X A;  4LC3 A;  1E5E A;  2ZP7 A;  1BKG A;  1W7N A;  1WKH A;  3K7Y A;  1ELU A;  5FT8 A;  5EUN A;  4B9B A;  2XBN A;  1GD9 A;  1QZ9 A;  8AAT A;  3TFU A;  2BI3 A;  2VMZ A;  4R5Z A;  1IX7 A;  2EGY A;  3AEJ A;  3M5U A;  2CST A;  1GBN A;  1DGD A;  1S06 A;  4CXR A;  3AEN B;  1KKP A;  3AEL A;  2PB0 A;  3EZ1 A;  2G7J A;  4GSA A;  2D66 A;  3LV2 A;  3FVU A;  4PFN A;  4Q6R A;  4PVF A;  3WGC A;  2BIA A;  4IXZ A;  1GC4 A;  4FFC A;  2WKA A;  3R4T A;  2X5D A;  3B46 A;  3NDN A;  1AJS A;  3GET A;  3OKS A;  1EJI A;  4LNM A;  4LNL A;  1LW5 A;  3RQ1 A;  3UWC A;  4EB7 A;  3G7Q A;  3PGY A;  9AAT A;  2ZJG A;  2YKU A;  1ECX A;  4JF0 A;  1C4K A;  1LS3 A;  3AEN A;  4WLH A;  3WCN A;  2BI5 A;  3AV7 A;  2BI1 A;  4L0O A;  1DJE A;  5EQC A;  3BWN A;  1P3W A;  5K8B A;  1GDE A;  5EIG A;  3HBX A;  1C7G A;  3WY7 A;  4ZM3 A;  3LVJ A;  1CZE A;  2EO5 A;  4WD2 A;  4RJY A;  3QM2 A;  4K2I A;  4OBV A;  4MQP A;  1AAM A;  2BKW A;  2Z9V A;  4WYA A;  4ZLV A;  3RBL A;  2VMT A;  3B8X A;  3TCM A;  4I8A A;  2CH2 A;  5I92 A;  3A9X A;  4AO4 A;  4F5I A;  2XH1 A;  1B5P A;  3E77 A;  2G6W A;  5DJ1 A;  3QI6 A;  4PFF A;  1UU2 A;  1M0Q A;  1ASF A;  1PFF A;  3II0 A;  4OC9 A;  1ARS A;  2E54 A;  3EIB A;  3LY1 A;  2C7T A;  4IY7 A;  3DR4 A;  3HMU A;  2F8J A;  5G2Q A;  1X29 A;  4ITX A;  1MLZ A;  1ASB A;  1OHV A;  1X28 A;  3FQA A;  2CH1 A;  1WYV B;  3QGU A;  4F5F A;  1W7L A;  3I5T A;  4E3Q A;  1ZC9 A;  2X8U A;  3BCA A;  2VGS A;  2AY6 A;  2W7J A;  1M0O A;  3B1E A;  3B1D A;  4O6Z A;  3BCX A;  1MGV A;  2W8T A;  3E2F A;  3KE3 A;  3VK4 A;  2BYL A;  3TAT A;  3N7N A;  2ZY2 A;  3MC6 A;  1ASC A;  2FN6 A;  4KXK A;  1FC4 A;  1AJR A;  3EIA A;  3JWB A;  4XAU A;  4Y0H A;  2CJH A;  1AIB A;  2FQ6 A;  2QMA A;  3H9X A;  4EU1 A;  1ASM A;  1IX6 A;  3MEB A;  1AHF A;  3NYU A;  2EZ2 A;  3GZC A;  4JEY A;  1QIS A;  2VLF A;  3E2Z A;  3BCB A;  1O69 A;  2Z1Z A;  2D63 A;  3ATH A;  3FFH A;  4W8I A;  5LH9 A;  2EH6 A;  4K05 A;  4UOY A;  3QBO A;  4IW7 A;  4U1T A;  2R0T A;  5F9S A;  4WXG A;  4CXQ A;  1QJ5 A;  2NMP A;  3ACZ A;  2BYJ A;  1BJN A;  3H14 A;  3KKI A;  3E9K A;  1VJO A;  3FZ8 A;  1C9C A;  1LK9 A;  1UU1 A;  3GSB A;  2HUF A;  2HP1 A;  2HUI A;  1B4X A;  4BMK A;  1ASD A;  4WB0 B;  1ASE A;  2YCN A;  2W8V A;  3WGB A;  1BJW A;  1WST A;  4XJO A;  1V2E A;  3FVX A;  4DQ6 A;  3PDB B;  4TN4 A;  4J5U A;  3A8U X;  4RLG A;  2YOB A;  1AHG A;  1QIR A;  3DOD A;  1MDO A;  5AX8 A;  2C81 A;  3IF2 A;  1KMK A;  1ZOB A;  1IAX A;  3FDD A;  1C7N A;  5DJ9 A;  3COG A;  2JGT A;  4LW2 A;  4OYT A;  1YNU A;  1D7R A;  4W1V A;  1CQ6 A;  3DRD A;  2QLR A;  1EG5 A;  3W1J A;  1D2F A;  4BA4 A;  1DJ9 A;  2Z20 A;  3FKD A;  1N31 A;  3PAA A;  2ZY4 A;  4N0B A;  1B9H A;  4GE4 A;  1E5F A;  1KL2 A;  2WK7 A;  2WK9 A;  1BT4 A;  3GBX A;  3PD6 B;  4HF8 A;  4JEX A;  1M6S A;  4U2H A;  3KGX A;  1SZS A;  3RCH B;  5G2P A;  2FM1 A;  1JF9 A;  5G4J A;  2QB2 A;  3ECD A;  2V0Y A;  3NU7 A;  1TOE A;  1VP4 A;  1X0M A;  3L8A A;  3FQ7 A;  2CB1 A;  1SVV A;  1FG7 A;  1RV4 A;  1YIZ A;  2PO3 A;  1BQA A;  4ZSY A;  3K40 A;  4MGR A;  4IYO A;  4WBT A;  5M46 A;  4R2N A;  4NOG A;  4WXB A;  2AEU A;  1TAS A;  2FYF A;  1O62 A;  3CAI A;  3NNK A;  2YCT A;  4J8L A;  4MY5 A;  4CVQ A;  2YKV A;  2VMN A;  1DTY A;  2W7F A;  3EI7 A;  4JEW A;  3HQT A;  3PDB A;  3PIU A;  1B8G A;  1OXP A;  1S09 A;  4IX8 A;  5EUD A;  1MDZ A;  4WYD A;  5F8V A;  1M0N A;  4Y0I A;  4JE5 D;  1DGE A;  3DXW A;  4UQV A;  1ARH A;  2AY8 A;  2BIG A;  2OKJ A;  1CL1 A;  1CQ7 A;  2WK8 A;  3A9Z A;  5TF5 A;  4E3R A;  2X3L A;  4F5G A;  4ZAH A;  1BJO A;  4A6R A;  3G0T A;  4OBU A;  3N4X A;  3GZD C;  2AY3 A;  4ADC A;  2EZ1 A;  4P3M A;  3DZZ A;  2Q7W A;  3LG0 A;  4XJP A;  1TPL A;  1XEY A;  1YJS A;  1GEX A;  4P7Y A;  3JWA A;  1V2D A;  1C0N A;  3JZL A;  2C44 A;  2DKB A;  1G4V A;  3F9T A;  5BJ3 A;  3JU7 A;  1Z7D A;  4A0R A;  4R8D A;  3EI5 A;  1M7Y A;  2C0R A;  3QPG A;  3LVL B;  2JG2 A;  2W7G A;  3LVK A;  2OQX A;  1YJY A;  3AOV A;  3MKJ A;  3P6K A;  3DYD A;  5E3K A;  5EIG B;  1TAR A;  1IJI A;  4H51 A;  1WYU A;  4GDY A;  1UU0 A;  4MSO A;  4RJ0 A;  3WCO A;  1ELQ A;  1RVU A;  3AEJ C;  4LW4 A;  1O4S A;  2R5C A;  2YKY A;  2E7I A;  3R9A A;  1RVY A;  3PD6 A;  4A0H A;  3E2Z B;  2R2N A;  1CS1 A;  2Z61 A;  2AY5 A;  3A9Y A;  3IHJ A;  4ADB A;  4AZJ A;  1YJZ A;  1GC0 A;  2VMQ A;  2DGK A;  1YIY A;  4TMR A;  3HVY A;  4BQ0 A;  2D5Y A;  3DXV A;  3FZ6 A;  4B98 A;  4F5H A;  3HDO A;  1LC7 A;  2AY7 A;  1I29 A;  2JJE A;  2QB3 A;  1FG3 A;  1MAP A;  5IWQ A;  2EPJ A;  3DC1 A;  4F5L A;  1B5O A;  5DB5 A;  4A0F A;  4UHO A;  1D7S A;  1LW4 A;  2AY4 A;  2ZSM A;  1GCK A;  4A0G A;  3VK3 A;  4AH3 A;  1U08 A;  3ELP A;  3EUC A;  4WB0 A;  3AEO A;  4BA5 A;  3EI8 A;  1QJ3 A;  2VGW A;  3GR9 A;  4WP0 A;  2OGA A;  2ZYJ A;  3LVM A;  1KMJ A;  3PA9 A;  5C6U A;  2Z9W A;  5BJ4 A;  3NUB A;  1SZK A;  1GC2 A;  2GMU A;  3AEM C;  5M4D A;  3FZ7 A;  1AMA A;  1WYT A;  3N5M A;  4JE5 A;  4Y0D A;  4DBC A;  2HP2 A;  3CQ6 A;  1WYU B;  3GWP A;  3GZD A;  2CJD A;  4TV7 A;  3RI6 A;  2VMO A;  4EFF A;  2VI9 A;  1IVR A;  2VYC A;  3BB8 A;  1W23 A;  2VMS A;  3QN6 A;  2DGL A;  4Q76 A;  4F5M A;  2QBT A;  4A6T A;  4GE7 A;  5E5I A;  3FDB A;  3OP7 A;  2HOY A;  4K2B A;  1TOJ A;  1AMR A;  4AOA A;  1OXO A;  3ELE A;  4ADE A;  4LNJ A;  1VEF A;  1S0A A;  1ASN A;  3VP6 A;  2X5F A;  7AAT A;  3GJU A;  3ASB A;  3W1I A;  2CAN A;  2JJG A;  3EZS A;  3AEP A;  3BC8 A;  3P1T A;  3I4J A;  2BWO A;  1DJU A;  2E7J A;  3WZF A;  3PJ0 A;  2DR1 A;  4IYO B;  4ATQ A;  2CFB A;  1AY5 A;  3ZRP A;  4RKD A;  2YRR A;  3HLM A;  1AHE A;  2ZY5 A;  1RV3 A;  1M0P A;  2CJG A;  3HT4 A;  2W7H A;  4ITG A;  3WKR A;  2E7U A;  3MAD A;  3MC6 C;  4ATP A;  4N0W A;  3MAU A;  1Z3Z A;  1CQ8 A;  4RIT A;  3TFT A;  4WYG A;  3AAT A;  3K28 A;  3PDX A;  1G4X A;  2JJF A;  4UHM A;  2W7I A;  3N4S A;  2OAT A;  4A6U A;  5HDM A;  1AKA A;  2VMV A;  4W1W A;  1BJO B;  4MKK A;  4PIW A;  1W3U A;  3NTJ A;  1AAW A;  4RM1 A;  2GQN A;  1G7X A;  1I41 A;  1BS0 A;  3G8M A;  4AO9 A;  1BQD A;  2WB6 A;  3N75 A;  4CBS A;  3FQ8 A;  1H1C A;  2HZP A;  3CQ4 A;  5HHY A;  3RUY A;  4ZSW A;  1AX4 A;  1WKG A;  2HOX A;  1PG8 A;  1M4N A;  2GMS A;  1SPA A;  4RAE A;  4A00 A;  2D65 A;  4W91 A;  2D64 A;  4RKC A;  1N8P A;  2RFV A;  4XQ2 A;  3ZZK A;  1XI9 A;  1GC3 A;  2Z9U A;  4RIZ A;  4E77 A;  2QA3 A;  1AHX A;  4GEB A;  3FSL A;  3BS8 A;  4Q31 A;  3WLX A;  5M49 A;  3D6K A;  3MBB A;  2ZC0 A;  2DKJ A;  1YAA A;  2QSR A;  2ORD A;  3N4R A;  1W7M A;  3NU8 A;  2V1P A;  3ZZJ A;  4ZDL A;  1C7O A;  4E1O A;  3HL2 A;  1LC8 A;  1S08 A;  2W7D A;  4IXO A;  2D61 A;  2DGM A;  2BWN A;  1PMM A;  4UHN A;  2HUU A;  2FNU A;  2YHK A;  2GB3 A;  4Q75 A;  1B9I A;  4MQR A;  1TOI A;  2W7L A;  4ZDP A;  4W5K A;  4WYF A;  2VMX A;  1IX8 A;  2VI8 A;  4GE9 A;  4OT8 A;  5EAV A;  1J04 A;  1BJ4 A;  4F5J A;  4EMY A;  3QHX A;  1S07 A;  2AAT A;  2AY1 A;  2DOU A;  1DFO A;  1AY4 A;  3RBF A;  1JS6 A;  2YKX A;  4BHD A;  2VMU A;  5FT5 A;  2D7Y A;  2R5C B;  1OHY A;  3UE8 A;  2CTZ A;  4M2K A;  2O1B A;  2D7Z A;  2OGE A;  2ZSL A;  1TAT A;  3A2B A;  1ARG A;  1CL2 A;  5FT6 A;  1ARI A;  1AKB A;  4HVK A;  3RCH A;  1WYT B;  1MDX A;  3WKS A;  3CQ5 A;  1QIT A;  1SZU A;  2JJH A;  2A1V A;  1X2A A;  3NYT A;  2W7M A;  4ZWV A;  3DU4 A;  1ORD A;  4IXS A;  4ZAS A;  4JEZ A;  5D95 A;  5G4I A;  1AHY A;  2BHX A;  5J8Q A;  3E2Y A;  3T32 A;  1G7W A;  2TPL A;  3LWS A;  1KKJ A;  2W8U A;  1EQB A;  3EI9 A;  3FCR A;  4XEW A;  1MLY A;  4GRX A;  4AZK A;  3ZRR A;  2PB2 A;  4OMA A;  5EAA A;  1UKJ A;  2YRI A;  1ASL A;  1CZC A;  2JIS A;  1WYV A;  2KFP A;  3NYS A;  2Z1Y A;  2VMY A;  3USF A;  4KAM A;  4M2M A;  4MKJ A;  5E4Z A;  1AJS B;  1OAT A;  3BN1 A;  2GSA A;  4A72 A;  2FKI A;  4OCA A;  3TQX A;  3BWN C;  2AY2 A;  4R5F A;  5HXX A;  1TOK A;  1IBJ A;  2BI2 A;  3FTB A;  4XK1 A;  1AKC A;  1ZOD A;  2VGT A;  3E6G A;  5JAY A;  3EI6 A;  5G09 A;  3CBF A;  3UAK A;  1AY8 A;  3JW9 A;  3Q8N A;  3F0H A;  4OTL A;  1DKA A;  3ISL A;  1T3I A;  2O0R A;  2BWP A;  1OHW A;  1D7U A;  1SF2 A;  1V72 A;  3KGW A;  1I43 A;  1PMO A;  2VMP A;  3H7F A;  3FRK A;  3I16 A;  4XJL A;  3VOM A;  5M4B A;  2EYQ A;  3DR7 A;  3WX9 A;  1CJ0 A;  1KL1 A;  2FNI A;  4ISY A;  1JG8 A;  1MAQ A;  2VGZ A;  1IUG A;  1N2T A;  3JTX A;  4JF1 A;  2R5E A;  1ART A;  2VGV A;  3MAF B;  2BI9 A;  2AEV A;  1M32 A;  1LKC A;  3NRA A;  1GEW A;  1V2F A;  1H0C A;  5EUE A;  3VAX A;  2YCP A;  3FFR A;  5LHA A;  4WXF A;  2AY9 A;  1LC5 A;  4JEV A;  4QGR A;  1AIA A;  4K2M A;  4CBR A;  4EB5 A;  1ASA A;  2CIN A;  1TOG A;  3FD0 A;  3BV0 A;  4MQQ A;  2VLH A;  3BWO A;  1IAY A;  2VIB A;  2VIA A;  1YOO A;  4FL0 A;  2CY8 A;  3N0L A;  5EFS A;  4ZDO A;  1GEY A;  1AIC A;  1ASG A;  2ZY3 A;  4ZWM A;  4F5K A;  2W7E A;  3MAF A;  1O61 A;  1QGN A;  1SFF A;  2BIE A;  4ADD A;  4ZM4 A;  2VMW A;  5DX5 A;  4F4E A;  2W8W A;  4W1X A;  3FVS A;  5KTB A;  3NX3 A;  3AEM A;  3L44 A;  5FT4 A;  1BW0 A;  1AMS A;  2W8J A;  2Z67 A;  3AOW A;  4XJM A;  1I48 A;  3NUI A;  3ASA A;  4WYC A;  3W1H A;  1D7V A;  3B1C A;  2VMR A;  1AMQ A;  4M2J A;  2ZUK A;  3ZRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...