4H51A

Crystal structure of a putative aspartate aminotransferase from leishmania major friedlin
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
401
structure length
397
Chain Sequence
MTTAERWQKIQAQAPDVIFDLAKRAAAAKGPKANLVIGAYRDEQGRPYPLRVVRKAEQLLLDMNLDYEYLPISGYQPFIDEAVKIIYGELENLVAVQTLSGTGAVSLGAKLLTRVFDAETTPIYLSDPTWPNHYGVVKAAGWKNICTYAYYDPKTVSLNFEGMKKDILAAPDGSVFILHQCAHNPTGVDPSQEQWNEIASLMLAKHHQVFFDSAYQGYASGSLDTDAYAARLFARRGIEVLLAQSFSNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRRTVYDELLRLQTPGSWEHVINQIGMFSFLGLSKAQCEYCQNHNIFITVSGRANMAGLTHETALMLAQTINDAVR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of aspartate aminotransferases from Trypanosoma brucei, Leishmania major and Giardia lamblia.
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords Aspartate aminotransferase
total genus 158
structure length 397
sequence length 401
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4h51A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4h51A01
1DJUA 2BYLA 2QLRA 1DGDA 1KL1A 5LH9A 2BI5A 3AOVA 4K2MA 4JEVA 1B5PA 1SFFA 2WK8A 3P6KA 2AY3A 3PDBA 2BIEA 3VK2A 4AO4A 2AY9A 3AEJC 4HF8A 5EUEA 1ASDA 3GZCA 2VMZA 1U08A 1AKBA 2AY1A 2BKWA 3EI6A 3LVLB 2GB3A 4XJMA 2Z9VA 2FQ6A 1KKPA 2VI9A 2EH6A 5EQCA 4IY7A 3DYDA 4Q75A 4H51A 4EB7A 1PMMA 1AAMA 2YKVA 1CL2A 1Z3ZA 1M7YA 2X5FA 5E5IA 2YOBA 1C7NA 1BQAA 1VJOA 2C44A 3DZZA 3W1IA 5DX5A 1S08A 2G6WA 1DGEA 4MKJA 5G4JA 1JG8A 1ZODA 1ECXA 2HP2A 5F9SA 3FFHA 3BWOA 4CBSA 1LW5A 4AOAA 1AMAA 2BI1A 1BQDA 4RJYA 4ZDOA 1DJ9A 1BJOA 1TASA 2YCNA 2VMXA 2YRIA 3DC1A 4OC9A 3WGCA 4RIZA 1W3UA 2YHKA 2W7FA 1T3IA 3JU7A 1SZUA 4KYOA 4OMAA 2R2NA 1IX7A 3DR4A 3FD0A 3MC6C 4KAMA 2YKUA 3AV7A 1LW4A 4PFFA 2VIAA 3DRDA 3RUYA 2DKBA 4M2JA 4A0RA 4WYCA 1KMKA 4E77A 4XAUA 1AKCA 2ZY2A 4M2KA 2OGEA 2Z20A 3B1DA 1BKGA 4RLGA 2W7HA 3ZRQA 3L8AA 3RCHA 1FG7A 3CQ6A 3UE8A 4JE5D 4GRXA 4DQ6A 1IJIA 3B1EA 1BS0A 2VIBA 1IUGA 2E7IA 4BA5A 1N31A 1AHFA 3A8UX 4ADDA 5G09A 2OQXA 3AENA 2HUUA 4WYEA 2EZ2A 1TOIA 2JJGA 3DODA 2VMSA 1G4XA 1GDEA 1V72A 2GMUA 3F0HA 3NU8A 5G4IA 1YJYA 3JZLA 4F4EA 3ASAA 3LWSA 2JJEA 4WB0B 4R8DA 1MDOA 1IBJA 2VGSA 3DXWA 4JEWA 1E5FA 2D7ZA 2CJHA 5G2QA 3TFTA 1PFFA 1ARSA 4RITA 3QGUA 2ZJGA 2YRRA 4BA4A 1E5EA 2AATA 3CAIA 3W1JA 2W8JA 2D65A 4UQVA 1YJSA 3F6TA 1D7RA 1J04A 1TOEA 4PIWA 2GMSA 4F5KA 8AATA 4A6RA 3NYTA 1OXPA 4ATPA 5EAVA 1D2FA 4ISYA 4N0BA 4ADEA 1Z7DA 1WKHA 2EPJA 3NU7A 3QN6A 4GE4A 1CL1A 1X28A 2VMQA 3BWNA 1BW0A 1CQ8A 1M32A 2R5EA 4Y0IA 1N8PA 4F5GA 5HXXA 1VEFA 3IHJA 1C4KA 1B9IA 4QGRA 1TOGA 5TF5A 5LHAA 3F9TA 3NYSA 1UU2A 4Y0DA 1GD9A 4GE7A 5E3KA 4IYOB 4F5FA 2VGWA 1JF9A 1N2TA 2X5DA 3DR7A 3HQTA 3WKRA 1C0NA 1ASNA 1YJZA 4RKDA 3GZDC 1GBNA 5JAYA 2XBNA 3DXVA 3WLXA 4B98A 4EU1A 4MKKA 4TN4A 1O62A 2E54A 3FKDA 3NX3A 4AZKA 3CQ5A 4EMYA 4BQ0A 3D6KA 1W7LA 1ASAA 2AY6A 3H7FA 5IWQA 4GDYA 1WYTB 1TATA 3PJ0A 3QBOA 2ZY3A 1GC4A 3R4TA 3BCAA 1AJSA 1M0QA 2VMVA 3K40A 2VMYA 4Q76A 3PDXA 2Z9XA 2VGUA 3EI5A 1M0NA 3I4JA 4A0GA 1EG5A 4WYDA 2VLFA 3L44A 3RBLA 3G0TA 1GC3A 1ARHA 2C7TA 2X3LA 4EFFA 4W1WA 3VK4A 3BN1A 1RV4A 1EQBA 5G2PA 3FQAA 2VMOA 2BI9A 2FN6A 3E2FA 3FFRA 1QZ9A 3MKJA 2V0YA 3NDNA 4IXSA 4UHNA 2PB0A 4JE5A 2BI2A 1AY4A 4ZAHA 2ZP7A 4F5HA 1VP4A 1WYUA 4R2NA 5M4BA 1P3WA 1AHXA 4A6UA 4ZDLA 4U2HA 4DGTA 4E3RA 2ZY5A 1QITA 1B5OA 1AICA 2E7UA 2F8JA 3PDBB 4MY5A 5E4ZA 4F5MA 4ZM4A 1LC7A 2QB2A 1PMOA 3EIAA 5EFSA 2YCPA 4F5JA 1YNUA 4JF0A 3GZDA 1DFOA 4JEZA 3GWPA 3BB8A 3ZZJA 1LC5A 2EGYA 3ELEA 2PO3A 3CQ4A 1W7NA 1QISA 2VMPA 3WKSA 3TQXA 4LW2A 4OT8A 1XI9A 3HBXA 3FQ7A 2YCTA 4UHOA 4A6TA 1ASBA 4ZWVA 2HOXA 5EAAA 3KGWA 3FZ7A 3G7QA 4U1TA 1J32A 3NRAA 2CSTA 3QI6A 3EZ1A 1MDZA 1AMQA 3FZ8A 4MQPA 2DOUA 1B9HA 1BT4A 1O61A 1ARGA 1RVYA 3EI9A 3MEBA 3JTXA 3RCHB 2CTZA 1AMSA 1WYVB 2AY4A 1ASCA 3FVXA 3MBBA 4FFCA 1CZCA 4P7YA 4OYTA 2FM1A 5F8VA 3PGYA 3ASBA 4LNLA 3AEOA 2D66A 3E77A 4IXZA 4RJ0A 4WXGA 5M49A 4RKCA 5FT5A 1H0CA 3TATA 4PFNA 1ARTA 1G7XA 4E3QA 3USFA 1SF2A 2Z67A 3M5UA 3A2BA 1B8GA 3E2ZA 3EI7A 5D95A 3PIUA 2R0TA 3WCOA 2W8WA 3MC6A 3PD6A 2OKJA 2ZC0A 1BJ4A 3H14A 4GE9A 3VK3A 4WLHA 3UAKA 1C9CA 3FTBA 1MLYA 2O7CA 4J5UA 1BJNA 4AZJA 2VGZA 4MQRA 3AATA 3OKSA 3FRKA 1ELUA 3K7YA 2HP1A 4GEBA 5BJ3A 2AY8A 4CVQA 2TPLA 2W8UA 2Z61A 1X0MA 2RFVA 1GCKA 1ASEA 2ZY4A 3BV0A 1JS6A 1XEYA 3AEJA 2QA3A 1Y4IA 4WYGA 3GBXA 2W7MA 1V2DA 2ZSLA 3AOWA 3LG0A 2D64A 3VAXA 1LC8A 1UKJA 2CH1A 4A0FA 4ITXA 4OBVA 2AY7A 1PG8A 1C7OA 1ELQA 4W91A 2GQNA 3E9KA 1RV3A 4OCAA 4IYOA 4CXRA 2W7GA 1GEWA 2O1BA 3FCRA 1W7MA 3BWNC 2CANA 3AEMA 2EZ1A 2AY2A 4CXQA 1GC0A 2AY5A 2VGVA 1GC2A 4LC3A 1KKJA 2FNUA 3A9ZA 4UOYA 2W7LA 2BIAA 2Z9WA 3KE3A 4RM1A 3NTJA 4XJPA 4JEYA 3WY7A 3LV2A 4MSOA 5M4DA 2HOZA 4AH3A 4JF1A 2C0RA 3WX9A 3ISLA 3PD6B 1QJ3A 2BWOA 3FVSA 4E1OA 4WP0A 1ZOBA 1D7UA 1WSTA 2WKAA 4OTLA 2W7EA 5DJ9A 4W1VA 5EIGA 3NYUA 2Z9UA 3FSLA 3B8XA 4TV7A 1CS1A 4ZWMA 3ECDA 2JJHA 3JWAA 1TPLA 3W1HA 4WB0A 1AMRA 4XJLA 2C81A 3CBFA 3LVMA 4HVKA 1MLZA 2HUIA 1JS3A 1YIYA 3DU4A 1IX8A 1CJ0A 2W7KA 3NUIA 5AX8A 1AY5A 4ZM3A 2CINA 3EIBA 2OGAA 2DGLA 4WYFA 3QM2A 2PB2A 2Q7WA 3OP7A 3I16A 1S0AA 4BMKA 1LS3A 1S06A 1UU1A 1ORDA 4KXKA 2HORA 4NOGA 3A9YA 4EB5A 1BJWA 1AHGA 1FG3A 1EJIA 1S07A 4FL0A 4GSAA 1SVVA 3PPLA 2JISA 2BYJA 3T32A 3GETA 2W7DA 4LW4A 4WBTA 1ZC9A 4IW7A 3ZRRA 2OATA 3R9AA 3AEPA 1SPAA 2BWPA 1QGNA 1AY8A 1OHVA 1TARA 2JGTA 3P1TA 3RI6A 3IF2A 1ASLA 2X8UA 3ACZA 2VLHA 4O6ZA 1FC4A 1H1CA 3LVKA 4F5IA 4RAEA 2VI8A 1RVUA 4K2IA 2CJGA 4J8LA 2QBTA 3HVYA 3QHXA 1X2AA 3A9XA 5EIGB 2BHXA 4A72A 4A0HA 5BJ4A 1TOJA 2VMUA 7AATA 5K8BA 2AEVA 1O4SA 4OBUA 1WYVA 3FDDA 2DGKA 2HOYA 4XJOA 1MAQA 2D5YA 1AX4A 2ZSMA 5EUNA 2JJFA 2HUFA 1V2EA 3RQ1A 3KKIA 1OHWA 3G8MA 1M6SA 1AIAA 2HZPA 1W23A 4WD2A 1CQ7A 3ZZKA 3FZ6A 1AHEA 4Y0HA 2WK7A 4A00A 2GSAA 1AJRA 4LNMA 1TOKA 3E6GA 3E2ZB 1G4VA 2BI3A 1D7SA 1I48A 5D5SA 1DTYA 3PA9A 3VP6A 3COGA 3II0A 4MQQA 4TMRA 5J8QA 3EUCA 3GSBA 3AENB 1SZKA 4ZASA 3GJUA 1IX6A 1MDXA 3PAAA 4ZSWA 1ARIA 4WXBA 4XEWA 4AO9A 1SZSA 3K28A 1I29A 2QMAA 1OXOA 1MGVA 4W8IA 1AKAA 1OATA 1WYTA 2BWNA 3BC8A 3JW9A 5DB5A 2FNIA 3HDOA 2FYFA 3NUBA 4UHMA 2DGMA 5HDMA 3EZSA 3MADA 3UWCA 2QB3A 1V2FA 1KL2A 5FT6A 2VYCA 1WKGA 5FT4A 2D61A 3QPGA 5I92A 3TCMA 9AATA 1ASMA 1LK9A 2Z1YA 4MGRA 4P3MA 3WGBA 3AELA 3TFUA 4K2BA 3MAFA 3VOMA 4F5LA 4BHDA 5M46A 3N75A 2CY8A 1YIZA 2V1PA 2CB1A 3FDBA 3LY1A 3Q8NA 2W7JA 2Z1ZA 1IVRA 3E2YA 1B4XA 4ZLVA 1LKCA 3B46A 1AAWA 1DJEA 3LVJA 3KGXA 3MAUA 2R5CA 2AEUA 3BCBA 3MAFB 2OKKA 1BJOB 5G0AA 4XK1A 1ASGA 1UU0A 4ITGA 2ZUKA 1IAXA 1KMJA 2XH1A 4PVFA 4XQ2A 3GR9A 4W1XA 1G7WA 1CQ6A 2D7YA 3WZFA 4DBCA 2CJDA 4R5FA 3NNKA 1M0OA 2W8TA 2YKYA 3EI8A 4Q31A 1AIBA 1DKAA 2NMPA 4ADBA 1GEXA 1O69A 3HLMA 4Q6RA 2R5CB 2YKXA 2W7IA 3FQ8A 2W8VA 2VMRA 2E7JA 2WK9A 2JG2A 1C7GA 4M2MA 3AEMC 3JWBA 2O0RA 3FVUA 1I41A 5FT8A 4ADCA 1M4NA 4IX8A 1ASFA 4N0WA 4ZDPA 4CBRA 2BIGA 5EUDA 3BCXA 4ATQA 1IAYA 1AJSB 4WLJA 3WCNA 3B1CA 3ELPA 4JEXA 2CFBA 2EO5A 1AHYA 2ORDA 4IXOA 1S09A 2DR1A 1QIRA 4R5ZA 2VMNA 1X29A 2ZYJA 1MAPA 3RBFA 4WXFA 3ZRPA 2VMTA 1M0PA 4ZSYA 3BS8A 4I8AA 1YAAA 1YOOA 4L0OA 3N0LA 5DJ1A 2VGTA 1CZEA 5HHYA 4B9BA 2DKJA 1I43A 3HT4A 1D7VA 3HL2A 1GEYA 2CH2A 3ATHA 2D63A 1QJ5A 2VMWA 4LNJA 4WYAA 4W5KA 1OHYA 3N5MA 3I5TA 5C6UA 1WYUB 3HMUA
chains in the Genus database with same CATH superfamily
1DJUA 2BYLA 2QLRA 1DGDA 1KL1A 5LH9A 2BI5A 3AOVA 4K2MA 4JEVA 1B5PA 1SFFA 2WK8A 3P6KA 2AY3A 3PDBA 2BIEA 3VK2A 4AO4A 2AY9A 3AEJC 4HF8A 5EUEA 1ASDA 3GZCA 2VMZA 1U08A 1AKBA 2AY1A 2BKWA 3EI6A 3LVLB 2GB3A 4XJMA 2Z9VA 2FQ6A 1KKPA 2VI9A 2EH6A 5EQCA 4IY7A 3DYDA 4Q75A 4H51A 4EB7A 1PMMA 1AAMA 2YKVA 1CL2A 1Z3ZA 1M7YA 2X5FA 5E5IA 2YOBA 1C7NA 1BQAA 1VJOA 2C44A 3DZZA 3W1IA 5DX5A 1S08A 2G6WA 1DGEA 4MKJA 5G4JA 1JG8A 1ZODA 1ECXA 2HP2A 5F9SA 3FFHA 3BWOA 4CBSA 1LW5A 4AOAA 1AMAA 2BI1A 1BQDA 4RJYA 2QSRA 4ZDOA 1DJ9A 1BJOA 1TASA 2YCNA 2VMXA 2YRIA 3DC1A 4OC9A 3WGCA 4RIZA 1W3UA 2YHKA 2W7FA 1T3IA 3JU7A 1SZUA 5KTBA 4KYOA 4OMAA 2R2NA 1IX7A 3DR4A 3FD0A 3MC6C 4KAMA 2YKUA 3AV7A 1LW4A 4PFFA 2VIAA 3DRDA 3RUYA 2DKBA 4M2JA 4A0RA 3H9XA 4WYCA 1KMKA 4E77A 4XAUA 1AKCA 2ZY2A 4M2KA 2OGEA 2Z20A 3B1DA 1BKGA 4RLGA 2W7HA 3ZRQA 3L8AA 3RCHA 1FG7A 3CQ6A 3UE8A 4JE5D 4GRXA 4DQ6A 1IJIA 3B1EA 1BS0A 2VIBA 1IUGA 2E7IA 4BA5A 1N31A 1AHFA 3A8UX 4ADDA 5G09A 2OQXA 3AENA 2HUUA 4WYEA 2EZ2A 1TOIA 2JJGA 3DODA 2VMSA 1G4XA 1GDEA 1V72A 2GMUA 3F0HA 3NU8A 5G4IA 1YJYA 3JZLA 4F4EA 3ASAA 3LWSA 2JJEA 4WB0B 4R8DA 1MDOA 1IBJA 2VGSA 3DXWA 4JEWA 1E5FA 2D7ZA 2CJHA 5G2QA 3TFTA 1PFFA 1ARSA 4RITA 3QGUA 2ZJGA 2YRRA 4BA4A 1E5EA 2AATA 3CAIA 3W1JA 2W8JA 2D65A 4UQVA 1YJSA 3F6TA 1D7RA 1J04A 1TOEA 4PIWA 2GMSA 4F5KA 8AATA 4A6RA 3NYTA 1OXPA 4ATPA 5EAVA 1D2FA 4ISYA 4N0BA 4ADEA 1Z7DA 1WKHA 2EPJA 3NU7A 3QN6A 4GE4A 1CL1A 1X28A 2VMQA 3BWNA 1BW0A 1CQ8A 1M32A 2R5EA 4Y0IA 1N8PA 4F5GA 5HXXA 1VEFA 3IHJA 1C4KA 1B9IA 4QGRA 1TOGA 5TF5A 5LHAA 3F9TA 3NYSA 1UU2A 4Y0DA 1GD9A 4GE7A 5E3KA 4IYOB 4F5FA 2VGWA 1JF9A 1N2TA 2X5DA 2G7JA 3DR7A 3HQTA 3WKRA 1C0NA 1ASNA 1YJZA 4RKDA 3GZDC 1GBNA 5JAYA 2XBNA 3DXVA 3WLXA 4B98A 4EU1A 4MKKA 4TN4A 1O62A 2E54A 3FKDA 3NX3A 4AZKA 3CQ5A 4EMYA 4BQ0A 3D6KA 1W7LA 1ASAA 2AY6A 3H7FA 5IWQA 4GDYA 1WYTB 1TATA 3PJ0A 3QBOA 2ZY3A 1GC4A 3R4TA 3BCAA 1AJSA 1M0QA 2VMVA 3K40A 2VMYA 4Q76A 3PDXA 2Z9XA 2VGUA 3EI5A 1M0NA 3I4JA 4A0GA 1EG5A 4WYDA 2VLFA 3L44A 3RBLA 3G0TA 1GC3A 1ARHA 2C7TA 2X3LA 4EFFA 4W1WA 3VK4A 3BN1A 1RV4A 1EQBA 5G2PA 3FQAA 2VMOA 2BI9A 2FN6A 3E2FA 3FFRA 1QZ9A 3MKJA 2V0YA 3NDNA 4IXSA 4UHNA 2PB0A 4JE5A 2BI2A 1AY4A 4ZAHA 2ZP7A 4F5HA 1VP4A 1WYUA 4R2NA 5M4BA 1P3WA 1AHXA 4A6UA 4ZDLA 4U2HA 4DGTA 4E3RA 2ZY5A 1KAFA 1QITA 1B5OA 1AICA 2E7UA 2F8JA 3PDBB 4MY5A 5E4ZA 4F5MA 4ZM4A 1LC7A 2QB2A 1PMOA 3EIAA 5EFSA 2YCPA 4F5JA 1YNUA 4JF0A 3GZDA 1DFOA 4JEZA 3GWPA 3BB8A 3ZZJA 1LC5A 2EGYA 3ELEA 2PO3A 3CQ4A 1W7NA 1QISA 2VMPA 3WKSA 3TQXA 4LW2A 4OT8A 1XI9A 3HBXA 3FQ7A 2YCTA 4UHOA 4A6TA 1ASBA 4ZWVA 2HOXA 5EAAA 3KGWA 3FZ7A 3G7QA 4U1TA 1J32A 3NRAA 2CSTA 3QI6A 3EZ1A 1MDZA 1AMQA 3FZ8A 4MQPA 2DOUA 1B9HA 1BT4A 1O61A 1ARGA 1RVYA 3EI9A 3MEBA 3JTXA 3RCHB 2CTZA 1AMSA 1WYVB 2AY4A 1ASCA 3FVXA 3MBBA 4FFCA 1CZCA 4P7YA 4OYTA 2FM1A 5F8VA 3PGYA 3ASBA 4LNLA 3AEOA 2D66A 3E77A 4IXZA 4RJ0A 4WXGA 5M49A 4RKCA 5FT5A 1H0CA 3TATA 4PFNA 1ARTA 1G7XA 4E3QA 3USFA 1SF2A 2Z67A 3M5UA 3A2BA 1B8GA 4H63Q 3E2ZA 3EI7A 5D95A 3PIUA 2R0TA 3WCOA 2W8WA 3MC6A 3PD6A 2OKJA 2ZC0A 1BJ4A 3H14A 4GE9A 3VK3A 4WLHA 3UAKA 1C9CA 3FTBA 1MLYA 2O7CA 4J5UA 1BJNA 4AZJA 2VGZA 4MQRA 3AATA 3OKSA 3FRKA 1ELUA 3K7YA 2HP1A 4GEBA 5BJ3A 2AY8A 4CVQA 2TPLA 2W8UA 2Z61A 1X0MA 2RFVA 1GCKA 1ASEA 2ZY4A 3BV0A 1JS6A 1XEYA 3AEJA 2QA3A 1Y4IA 4WYGA 3GBXA 2W7MA 1V2DA 2ZSLA 3AOWA 3LG0A 2D64A 3VAXA 1LC8A 1UKJA 2CH1A 4A0FA 4ITXA 4OBVA 2AY7A 1PG8A 1C7OA 1ELQA 4W91A 2GQNA 3E9KA 1RV3A 4OCAA 4IYOA 4CXRA 2W7GA 2A1VA 1GEWA 2O1BA 3FCRA 1W7MA 3BWNC 2CANA 3AEMA 2EZ1A 2AY2A 4CXQA 1GC0A 2AY5A 2VGVA 1GC2A 4LC3A 1KKJA 2FNUA 3A9ZA 4UOYA 2W7LA 2BIAA 2Z9WA 3KE3A 4RM1A 3NTJA 4XJPA 4JEYA 3WY7A 3LV2A 4MSOA 5M4DA 2HOZA 4AH3A 4JF1A 2C0RA 3WX9A 3ISLA 3PD6B 1QJ3A 2BWOA 3FVSA 4E1OA 4WP0A 1ZOBA 3N4RA 1D7UA 1WSTA 2WKAA 4OTLA 2W7EA 5DJ9A 4W1VA 5EIGA 3NYUA 2Z9UA 3FSLA 3B8XA 4TV7A 1CS1A 4ZWMA 3ECDA 2JJHA 3JWAA 1TPLA 3W1HA 4WB0A 1AMRA 4XJLA 3N4SA 2C81A 3CBFA 3LVMA 4HVKA 1MLZA 2HUIA 1JS3A 1YIYA 3DU4A 1IX8A 1CJ0A 2W7KA 3NUIA 5AX8A 1AY5A 4ZM3A 2CINA 3EIBA 2OGAA 2DGLA 4WYFA 3QM2A 2PB2A 2Q7WA 3OP7A 3I16A 1S0AA 4BMKA 1LS3A 2FKIA 1S06A 1UU1A 1ORDA 4KXKA 2HORA 4NOGA 3A9YA 4EB5A 1BJWA 1AHGA 1FG3A 1EJIA 1S07A 4FL0A 4GSAA 1SVVA 3PPLA 2JISA 2BYJA 3T32A 3GETA 2W7DA 4LW4A 4WBTA 1ZC9A 4IW7A 3ZRRA 2OATA 3R9AA 3AEPA 1SPAA 2BWPA 1QGNA 1AY8A 1OHVA 1TARA 2JGTA 3P1TA 3RI6A 3IF2A 1ASLA 2X8UA 3ACZA 2VLHA 4O6ZA 1FC4A 1H1CA 3LVKA 4F5IA 4RAEA 2VI8A 1RVUA 4K2IA 2CJGA 4J8LA 2QBTA 3HVYA 3QHXA 1X2AA 3A9XA 5EIGB 2BHXA 4A72A 4A0HA 5BJ4A 1TOJA 2VMUA 7AATA 5K8BA 2AEVA 1O4SA 4OBUA 1WYVA 3FDDA 2DGKA 2HOYA 4XJOA 1MAQA 2D5YA 1AX4A 2ZSMA 5EUNA 2JJFA 2HUFA 1V2EA 3N7NA 3RQ1A 3KKIA 1OHWA 3G8MA 1M6SA 1AIAA 2HZPA 1W23A 4WD2A 1CQ7A 3ZZKA 3FZ6A 1AHEA 4Y0HA 2WK7A 4A00A 2GSAA 1AJRA 4LNMA 1TOKA 3E6GA 3E2ZB 1G4VA 2BI3A 1D7SA 1I48A 5D5SA 1DTYA 3PA9A 3VP6A 3COGA 3II0A 4MQQA 4TMRA 5J8QA 3EUCA 3GSBA 3AENB 2WB6A 1SZKA 4ZASA 3GJUA 1IX6A 1MDXA 3PAAA 4ZSWA 1ARIA 4WXBA 4XEWA 4AO9A 1SZSA 3K28A 1I29A 2QMAA 1OXOA 1MGVA 4W8IA 1AKAA 1OATA 1WYTA 2BWNA 3BC8A 3JW9A 5DB5A 2FNIA 3HDOA 2FYFA 3NUBA 4UHMA 2DGMA 5HDMA 3EZSA 3MADA 3UWCA 2QB3A 1V2FA 3N4XA 1KL2A 5FT6A 2VYCA 1WKGA 5FT4A 2D61A 3QPGA 5I92A 3TCMA 9AATA 1ASMA 1LK9A 2Z1YA 4MGRA 4P3MA 3WGBA 3AELA 3TFUA 4K2BA 3MAFA 3VOMA 4F5LA 4BHDA 5M46A 3N75A 2CY8A 1YIZA 2V1PA 2CB1A 3FDBA 3LY1A 3Q8NA 2W7JA 2Z1ZA 1IVRA 3E2YA 1B4XA 4ZLVA 1LKCA 3B46A 1AAWA 1DJEA 3LVJA 3KGXA 3MAUA 2R5CA 2AEUA 3BCBA 3MAFB 2OKKA 1BJOB 5G0AA 4XK1A 1ASGA 1UU0A 4ITGA 2ZUKA 2EYQA 1IAXA 1KMJA 2XH1A 4PVFA 4XQ2A 3GR9A 4W1XA 1G7WA 1CQ6A 2D7YA 3WZFA 4DBCA 2CJDA 4R5FA 3NNKA 1M0OA 2W8TA 2YKYA 3EI8A 4Q31A 1AIBA 1DKAA 2NMPA 4ADBA 1GEXA 1O69A 3HLMA 4Q6RA 2R5CB 2YKXA 2W7IA 2KFPA 3FQ8A 2W8VA 2VMRA 2E7JA 2WK9A 2JG2A 1C7GA 4M2MA 3AEMC 3JWBA 2O0RA 3FVUA 1I41A 5FT8A 4ADCA 1M4NA 4IX8A 1ASFA 4N0WA 4ZDPA 4CBRA 2BIGA 5EUDA 3BCXA 4ATQA 1IAYA 1AJSB 4WLJA 3WCNA 3B1CA 3ELPA 4JEXA 2CFBA 2EO5A 1AHYA 2ORDA 4IXOA 1S09A 2DR1A 1QIRA 4R5ZA 2VMNA 1X29A 2ZYJA 1MAPA 3RBFA 4WXFA 3ZRPA 2VMTA 1M0PA 4ZSYA 3BS8A 4I8AA 1YAAA 1YOOA 4L0OA 3N0LA 5DJ1A 2VGTA 1CZEA 5HHYA 4B9BA 2DKJA 1I43A 3HT4A 1D7VA 4K05A 3HL2A 1GEYA 2CH2A 3ATHA 2D63A 1QJ5A 2VMWA 4LNJA 4WYAA 4W5KA 1OHYA 3N5MA 3I5TA 5C6UA 1WYUB 3HMUA
chains in the Genus database with same CATH topology
1DJUA 2BYLA 2QLRA 1DGDA 1KL1A 5LH9A 2BI5A 3AOVA 4K2MA 4JEVA 1B5PA 1SFFA 2WK8A 3P6KA 2AY3A 3PDBA 2BIEA 3VK2A 4AO4A 2AY9A 3AEJC 4HF8A 5EUEA 1ASDA 3GZCA 2VMZA 1U08A 1AKBA 2AY1A 2BKWA 3EI6A 3LVLB 2GB3A 4XJMA 2Z9VA 2FQ6A 1KKPA 2VI9A 2EH6A 5EQCA 4IY7A 3DYDA 4Q75A 4H51A 4EB7A 1PMMA 1AAMA 2YKVA 1CL2A 1Z3ZA 1M7YA 2X5FA 5E5IA 2YOBA 1C7NA 1BQAA 1VJOA 2C44A 3DZZA 3W1IA 5DX5A 1S08A 2G6WA 1DGEA 4MKJA 5G4JA 1JG8A 1ZODA 1ECXA 2HP2A 5F9SA 3FFHA 3BWOA 4CBSA 1LW5A 4AOAA 1AMAA 2BI1A 1BQDA 4RJYA 2QSRA 4ZDOA 1DJ9A 1BJOA 1TASA 2YCNA 2VMXA 2YRIA 3DC1A 4OC9A 3WGCA 4RIZA 1W3UA 2YHKA 2W7FA 1T3IA 3JU7A 1SZUA 5KTBA 4KYOA 4OMAA 2R2NA 1IX7A 3DR4A 3FD0A 3MC6C 4KAMA 2YKUA 3AV7A 1LW4A 4PFFA 2VIAA 3DRDA 3RUYA 2DKBA 4M2JA 4A0RA 3H9XA 4WYCA 1KMKA 4E77A 4XAUA 1AKCA 2ZY2A 4M2KA 2OGEA 2Z20A 3B1DA 1BKGA 4RLGA 2W7HA 3ZRQA 3L8AA 3RCHA 1FG7A 3CQ6A 3UE8A 4JE5D 4GRXA 4DQ6A 1IJIA 3B1EA 1BS0A 2VIBA 1IUGA 2E7IA 4BA5A 1N31A 1AHFA 3A8UX 4ADDA 5G09A 2OQXA 3AENA 2HUUA 4WYEA 2EZ2A 1TOIA 2JJGA 3DODA 2VMSA 1G4XA 1GDEA 1V72A 2GMUA 3F0HA 3NU8A 5G4IA 1YJYA 3JZLA 4F4EA 3ASAA 3LWSA 2JJEA 4WB0B 4R8DA 1MDOA 1IBJA 2VGSA 3DXWA 4JEWA 1E5FA 2D7ZA 2CJHA 5G2QA 3TFTA 1PFFA 1ARSA 4RITA 3QGUA 2ZJGA 2YRRA 4BA4A 1E5EA 2AATA 3CAIA 3W1JA 2W8JA 2D65A 4UQVA 1YJSA 3F6TA 1D7RA 1J04A 1TOEA 4PIWA 2GMSA 4F5KA 8AATA 4A6RA 3NYTA 1OXPA 4ATPA 5EAVA 1D2FA 4ISYA 4N0BA 4ADEA 1Z7DA 1WKHA 2EPJA 3NU7A 3QN6A 4GE4A 1CL1A 1X28A 2VMQA 3BWNA 1BW0A 1CQ8A 1M32A 2R5EA 4Y0IA 1N8PA 4F5GA 5HXXA 1VEFA 3IHJA 1C4KA 1B9IA 4QGRA 1TOGA 5TF5A 5LHAA 3F9TA 3NYSA 1UU2A 4Y0DA 1GD9A 4GE7A 5E3KA 4IYOB 4F5FA 2VGWA 1JF9A 1N2TA 2X5DA 2G7JA 3DR7A 3HQTA 3WKRA 1C0NA 1ASNA 1YJZA 4RKDA 3GZDC 1GBNA 5JAYA 2XBNA 3DXVA 3WLXA 4B98A 4EU1A 4MKKA 4TN4A 1O62A 2E54A 3FKDA 3NX3A 4AZKA 3CQ5A 4EMYA 4BQ0A 3D6KA 1W7LA 1ASAA 2AY6A 3H7FA 5IWQA 4GDYA 1WYTB 1TATA 3PJ0A 3QBOA 2ZY3A 1GC4A 3R4TA 3BCAA 1AJSA 1M0QA 2VMVA 3K40A 2VMYA 4Q76A 3PDXA 2Z9XA 2VGUA 3EI5A 1M0NA 3I4JA 4A0GA 1EG5A 4WYDA 2VLFA 3L44A 3RBLA 3G0TA 1GC3A 1ARHA 2C7TA 2X3LA 4EFFA 4W1WA 3VK4A 3BN1A 1RV4A 1EQBA 5G2PA 3FQAA 2VMOA 2BI9A 2FN6A 3E2FA 3FFRA 1QZ9A 3MKJA 2V0YA 3NDNA 4IXSA 4UHNA 2PB0A 4JE5A 2BI2A 1AY4A 4ZAHA 2ZP7A 4F5HA 1VP4A 1WYUA 4R2NA 5M4BA 1P3WA 1AHXA 4A6UA 4ZDLA 4U2HA 4DGTA 4E3RA 2ZY5A 1QITA 1B5OA 1AICA 2E7UA 2F8JA 3PDBB 4MY5A 5E4ZA 4F5MA 4ZM4A 1LC7A 2QB2A 1PMOA 3EIAA 5EFSA 2YCPA 4F5JA 1YNUA 4JF0A 3GZDA 1DFOA 4JEZA 3GWPA 3BB8A 3ZZJA 1LC5A 2EGYA 3ELEA 2PO3A 3CQ4A 1W7NA 1QISA 2VMPA 3WKSA 3TQXA 4LW2A 4OT8A 1XI9A 3HBXA 3FQ7A 2YCTA 4UHOA 4A6TA 1ASBA 4ZWVA 2HOXA 5EAAA 3KGWA 3FZ7A 3G7QA 4U1TA 1J32A 3NRAA 2CSTA 3QI6A 3EZ1A 1MDZA 1AMQA 3FZ8A 4MQPA 2DOUA 1B9HA 1BT4A 1O61A 1ARGA 1RVYA 3EI9A 3MEBA 3JTXA 3RCHB 2CTZA 1AMSA 1WYVB 2AY4A 1ASCA 3FVXA 3MBBA 4FFCA 1CZCA 4P7YA 4OYTA 2FM1A 5F8VA 3PGYA 3ASBA 4LNLA 3AEOA 2D66A 3E77A 4IXZA 4RJ0A 4WXGA 5M49A 4RKCA 5FT5A 1H0CA 3TATA 4PFNA 1ARTA 1G7XA 4E3QA 3USFA 1SF2A 2Z67A 3M5UA 3A2BA 1B8GA 4H63Q 3E2ZA 3EI7A 5D95A 3PIUA 2R0TA 3WCOA 2W8WA 3MC6A 3PD6A 2OKJA 2ZC0A 1BJ4A 3H14A 4GE9A 3VK3A 4WLHA 3UAKA 1C9CA 3FTBA 1MLYA 2O7CA 4J5UA 1BJNA 4AZJA 2VGZA 4MQRA 3AATA 3OKSA 3FRKA 1ELUA 3K7YA 2HP1A 4GEBA 5BJ3A 2AY8A 4CVQA 2TPLA 2W8UA 2Z61A 1X0MA 2RFVA 1GCKA 1ASEA 2ZY4A 3BV0A 1JS6A 1XEYA 3AEJA 2QA3A 1Y4IA 4WYGA 3GBXA 2W7MA 1V2DA 2ZSLA 3AOWA 3LG0A 2D64A 3VAXA 1LC8A 1UKJA 2CH1A 4A0FA 4ITXA 4OBVA 2AY7A 1PG8A 1C7OA 1ELQA 4W91A 2GQNA 3E9KA 1RV3A 4OCAA 4IYOA 4CXRA 2W7GA 2A1VA 1GEWA 2O1BA 3FCRA 1W7MA 3BWNC 2CANA 3AEMA 2EZ1A 2AY2A 4CXQA 1GC0A 2AY5A 2VGVA 1GC2A 4LC3A 1KKJA 2FNUA 3A9ZA 4UOYA 2W7LA 2BIAA 2Z9WA 3KE3A 4RM1A 3NTJA 4XJPA 4JEYA 3WY7A 3LV2A 4MSOA 5M4DA 2HOZA 4AH3A 4JF1A 2C0RA 3WX9A 3ISLA 3PD6B 1QJ3A 2BWOA 3FVSA 4E1OA 4WP0A 1ZOBA 3N4RA 1D7UA 1WSTA 2WKAA 4OTLA 2W7EA 5DJ9A 4W1VA 5EIGA 3NYUA 2Z9UA 3FSLA 3B8XA 4TV7A 1CS1A 4ZWMA 3ECDA 2JJHA 3JWAA 1TPLA 3W1HA 4WB0A 1AMRA 4XJLA 3N4SA 2C81A 3CBFA 3LVMA 4HVKA 1MLZA 2HUIA 1JS3A 1YIYA 3DU4A 1IX8A 1CJ0A 2W7KA 3NUIA 5AX8A 1AY5A 4ZM3A 2CINA 3EIBA 2OGAA 2DGLA 4WYFA 3QM2A 2PB2A 2Q7WA 3OP7A 3I16A 1S0AA 4BMKA 1LS3A 2FKIA 1S06A 1UU1A 1ORDA 4KXKA 2HORA 4NOGA 3A9YA 4EB5A 1BJWA 1AHGA 1FG3A 1EJIA 1S07A 4FL0A 4GSAA 1SVVA 3PPLA 2JISA 2BYJA 3T32A 3GETA 2W7DA 4LW4A 4WBTA 1ZC9A 4IW7A 3ZRRA 2OATA 3R9AA 3AEPA 1SPAA 2BWPA 1QGNA 1AY8A 1OHVA 1TARA 2JGTA 3P1TA 3RI6A 3IF2A 1ASLA 2X8UA 3ACZA 2VLHA 4O6ZA 1FC4A 1H1CA 3LVKA 4F5IA 4RAEA 2VI8A 1RVUA 4K2IA 2CJGA 4J8LA 2QBTA 3HVYA 3QHXA 1X2AA 3A9XA 5EIGB 2BHXA 4A72A 4A0HA 5BJ4A 1TOJA 2VMUA 7AATA 5K8BA 2AEVA 1O4SA 4OBUA 1WYVA 3FDDA 2DGKA 2HOYA 4XJOA 1MAQA 2D5YA 1AX4A 2ZSMA 5EUNA 2JJFA 2HUFA 1V2EA 3N7NA 3RQ1A 3KKIA 1OHWA 3G8MA 1M6SA 1AIAA 2HZPA 1W23A 4WD2A 1CQ7A 3ZZKA 3FZ6A 1AHEA 4Y0HA 2WK7A 4A00A 2GSAA 1AJRA 4LNMA 1TOKA 3E6GA 3E2ZB 1G4VA 2BI3A 1D7SA 1I48A 5D5SA 1DTYA 3PA9A 3VP6A 3COGA 3II0A 4MQQA 4TMRA 5J8QA 3EUCA 3GSBA 3AENB 2WB6A 1SZKA 4ZASA 3GJUA 1IX6A 1MDXA 3PAAA 4ZSWA 1ARIA 4WXBA 4XEWA 4AO9A 1SZSA 3K28A 1I29A 2QMAA 1OXOA 1MGVA 4W8IA 1AKAA 1OATA 1WYTA 2BWNA 3BC8A 3JW9A 5DB5A 2FNIA 3HDOA 2FYFA 3NUBA 4UHMA 2DGMA 5HDMA 3EZSA 3MADA 3UWCA 2QB3A 1V2FA 3N4XA 1KL2A 5FT6A 2VYCA 1WKGA 5FT4A 2D61A 3QPGA 5I92A 3TCMA 9AATA 1ASMA 1LK9A 2Z1YA 4MGRA 4P3MA 3WGBA 3AELA 3TFUA 4K2BA 3MAFA 3VOMA 4F5LA 4BHDA 5M46A 3N75A 2CY8A 1YIZA 2V1PA 2CB1A 3FDBA 3LY1A 3Q8NA 2W7JA 2Z1ZA 1IVRA 3E2YA 1B4XA 4ZLVA 1LKCA 3B46A 1AAWA 1DJEA 3LVJA 3KGXA 3MAUA 2R5CA 2AEUA 3BCBA 3MAFB 2OKKA 1BJOB 5G0AA 4XK1A 1ASGA 1UU0A 4ITGA 2ZUKA 2EYQA 1IAXA 1KMJA 2XH1A 4PVFA 4XQ2A 3GR9A 4W1XA 1G7WA 1CQ6A 2D7YA 3WZFA 4DBCA 2CJDA 4R5FA 3NNKA 1M0OA 2W8TA 2YKYA 3EI8A 4Q31A 1AIBA 1DKAA 2NMPA 4ADBA 1GEXA 1O69A 3HLMA 4Q6RA 2R5CB 2YKXA 2W7IA 2KFPA 3FQ8A 2W8VA 2VMRA 2E7JA 2WK9A 2JG2A 1C7GA 4M2MA 3AEMC 3JWBA 2O0RA 3FVUA 1I41A 5FT8A 4ADCA 1M4NA 4IX8A 1ASFA 4N0WA 4ZDPA 4CBRA 2BIGA 5EUDA 3BCXA 4ATQA 1IAYA 1AJSB 4WLJA 3WCNA 3B1CA 3ELPA 4JEXA 2CFBA 2EO5A 1AHYA 2ORDA 4IXOA 1S09A 2DR1A 1QIRA 4R5ZA 2VMNA 1X29A 2ZYJA 1MAPA 3RBFA 4WXFA 3ZRPA 2VMTA 1M0PA 4ZSYA 3BS8A 4I8AA 1YAAA 1YOOA 4L0OA 3N0LA 5DJ1A 2VGTA 1CZEA 5HHYA 4B9BA 2DKJA 1I43A 3HT4A 1D7VA 4K05A 3HL2A 1GEYA 2CH2A 3ATHA 2D63A 1QJ5A 2VMWA 4LNJA 4WYAA 4W5KA 1OHYA 3N5MA 3I5TA 5C6UA 1WYUB 3HMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJU A;  2BYL A;  2QLR A;  1DGD A;  1KL1 A;  5LH9 A;  2BI5 A;  3AOV A;  4K2M A;  4JEV A;  1B5P A;  1SFF A;  2WK8 A;  3P6K A;  2AY3 A;  3PDB A;  2BIE A;  3VK2 A;  4AO4 A;  2AY9 A;  3AEJ C;  4HF8 A;  5EUE A;  1ASD A;  3GZC A;  2VMZ A;  1U08 A;  1AKB A;  2AY1 A;  2BKW A;  3EI6 A;  3LVL B;  2GB3 A;  4XJM A;  2Z9V A;  2FQ6 A;  1KKP A;  2VI9 A;  2EH6 A;  5EQC A;  4IY7 A;  3DYD A;  4Q75 A;  4H51 A;  4EB7 A;  1PMM A;  1AAM A;  2YKV A;  1CL2 A;  1Z3Z A;  1M7Y A;  2X5F A;  5E5I A;  2YOB A;  1C7N A;  1BQA A;  1VJO A;  2C44 A;  3DZZ A;  3W1I A;  5DX5 A;  1S08 A;  2G6W A;  1DGE A;  4MKJ A;  5G4J A;  1JG8 A;  1ZOD A;  1ECX A;  2HP2 A;  5F9S A;  3FFH A;  3BWO A;  4CBS A;  1LW5 A;  4AOA A;  1AMA A;  2BI1 A;  1BQD A;  4RJY A;  4ZDO A;  1DJ9 A;  1BJO A;  1TAS A;  2YCN A;  2VMX A;  2YRI A;  3DC1 A;  4OC9 A;  3WGC A;  4RIZ A;  1W3U A;  2YHK A;  2W7F A;  1T3I A;  3JU7 A;  1SZU A;  4KYO A;  4OMA A;  2R2N A;  1IX7 A;  3DR4 A;  3FD0 A;  3MC6 C;  4KAM A;  2YKU A;  3AV7 A;  1LW4 A;  4PFF A;  2VIA A;  3DRD A;  3RUY A;  2DKB A;  4M2J A;  4A0R A;  4WYC A;  1KMK A;  4E77 A;  4XAU A;  1AKC A;  2ZY2 A;  4M2K A;  2OGE A;  2Z20 A;  3B1D A;  1BKG A;  4RLG A;  2W7H A;  3ZRQ A;  3L8A A;  3RCH A;  1FG7 A;  3CQ6 A;  3UE8 A;  4JE5 D;  4GRX A;  4DQ6 A;  1IJI A;  3B1E A;  1BS0 A;  2VIB A;  1IUG A;  2E7I A;  4BA5 A;  1N31 A;  1AHF A;  3A8U X;  4ADD A;  5G09 A;  2OQX A;  3AEN A;  2HUU A;  4WYE A;  2EZ2 A;  1TOI A;  2JJG A;  3DOD A;  2VMS A;  1G4X A;  1GDE A;  1V72 A;  2GMU A;  3F0H A;  3NU8 A;  5G4I A;  1YJY A;  3JZL A;  4F4E A;  3ASA A;  3LWS A;  2JJE A;  4WB0 B;  4R8D A;  1MDO A;  1IBJ A;  2VGS A;  3DXW A;  4JEW A;  1E5F A;  2D7Z A;  2CJH A;  5G2Q A;  3TFT A;  1PFF A;  1ARS A;  4RIT A;  3QGU A;  2ZJG A;  2YRR A;  4BA4 A;  1E5E A;  2AAT A;  3CAI A;  3W1J A;  2W8J A;  2D65 A;  4UQV A;  1YJS A;  3F6T A;  1D7R A;  1J04 A;  1TOE A;  4PIW A;  2GMS A;  4F5K A;  8AAT A;  4A6R A;  3NYT A;  1OXP A;  4ATP A;  5EAV A;  1D2F A;  4ISY A;  4N0B A;  4ADE A;  1Z7D A;  1WKH A;  2EPJ A;  3NU7 A;  3QN6 A;  4GE4 A;  1CL1 A;  1X28 A;  2VMQ A;  3BWN A;  1BW0 A;  1CQ8 A;  1M32 A;  2R5E A;  4Y0I A;  1N8P A;  4F5G A;  5HXX A;  1VEF A;  3IHJ A;  1C4K A;  1B9I A;  4QGR A;  1TOG A;  5TF5 A;  5LHA A;  3F9T A;  3NYS A;  1UU2 A;  4Y0D A;  1GD9 A;  4GE7 A;  5E3K A;  4IYO B;  4F5F A;  2VGW A;  1JF9 A;  1N2T A;  2X5D A;  3DR7 A;  3HQT A;  3WKR A;  1C0N A;  1ASN A;  1YJZ A;  4RKD A;  3GZD C;  1GBN A;  5JAY A;  2XBN A;  3DXV A;  3WLX A;  4B98 A;  4EU1 A;  4MKK A;  4TN4 A;  1O62 A;  2E54 A;  3FKD A;  3NX3 A;  4AZK A;  3CQ5 A;  4EMY A;  4BQ0 A;  3D6K A;  1W7L A;  1ASA A;  2AY6 A;  3H7F A;  5IWQ A;  4GDY A;  1WYT B;  1TAT A;  3PJ0 A;  3QBO A;  2ZY3 A;  1GC4 A;  3R4T A;  3BCA A;  1AJS A;  1M0Q A;  2VMV A;  3K40 A;  2VMY A;  4Q76 A;  3PDX A;  2Z9X A;  2VGU A;  3EI5 A;  1M0N A;  3I4J A;  4A0G A;  1EG5 A;  4WYD A;  2VLF A;  3L44 A;  3RBL A;  3G0T A;  1GC3 A;  1ARH A;  2C7T A;  2X3L A;  4EFF A;  4W1W A;  3VK4 A;  3BN1 A;  1RV4 A;  1EQB A;  5G2P A;  3FQA A;  2VMO A;  2BI9 A;  2FN6 A;  3E2F A;  3FFR A;  1QZ9 A;  3MKJ A;  2V0Y A;  3NDN A;  4IXS A;  4UHN A;  2PB0 A;  4JE5 A;  2BI2 A;  1AY4 A;  4ZAH A;  2ZP7 A;  4F5H A;  1VP4 A;  1WYU A;  4R2N A;  5M4B A;  1P3W A;  1AHX A;  4A6U A;  4ZDL A;  4U2H A;  4DGT A;  4E3R A;  2ZY5 A;  1QIT A;  1B5O A;  1AIC A;  2E7U A;  2F8J A;  3PDB B;  4MY5 A;  5E4Z A;  4F5M A;  4ZM4 A;  1LC7 A;  2QB2 A;  1PMO A;  3EIA A;  5EFS A;  2YCP A;  4F5J A;  1YNU A;  4JF0 A;  3GZD A;  1DFO A;  4JEZ A;  3GWP A;  3BB8 A;  3ZZJ A;  1LC5 A;  2EGY A;  3ELE A;  2PO3 A;  3CQ4 A;  1W7N A;  1QIS A;  2VMP A;  3WKS A;  3TQX A;  4LW2 A;  4OT8 A;  1XI9 A;  3HBX A;  3FQ7 A;  2YCT A;  4UHO A;  4A6T A;  1ASB A;  4ZWV A;  2HOX A;  5EAA A;  3KGW A;  3FZ7 A;  3G7Q A;  4U1T A;  1J32 A;  3NRA A;  2CST A;  3QI6 A;  3EZ1 A;  1MDZ A;  1AMQ A;  3FZ8 A;  4MQP A;  2DOU A;  1B9H A;  1BT4 A;  1O61 A;  1ARG A;  1RVY A;  3EI9 A;  3MEB A;  3JTX A;  3RCH B;  2CTZ A;  1AMS A;  1WYV B;  2AY4 A;  1ASC A;  3FVX A;  3MBB A;  4FFC A;  1CZC A;  4P7Y A;  4OYT A;  2FM1 A;  5F8V A;  3PGY A;  3ASB A;  4LNL A;  3AEO A;  2D66 A;  3E77 A;  4IXZ A;  4RJ0 A;  4WXG A;  5M49 A;  4RKC A;  5FT5 A;  1H0C A;  3TAT A;  4PFN A;  1ART A;  1G7X A;  4E3Q A;  3USF A;  1SF2 A;  2Z67 A;  3M5U A;  3A2B A;  1B8G A;  3E2Z A;  3EI7 A;  5D95 A;  3PIU A;  2R0T A;  3WCO A;  2W8W A;  3MC6 A;  3PD6 A;  2OKJ A;  2ZC0 A;  1BJ4 A;  3H14 A;  4GE9 A;  3VK3 A;  4WLH A;  3UAK A;  1C9C A;  3FTB A;  1MLY A;  2O7C A;  4J5U A;  1BJN A;  4AZJ A;  2VGZ A;  4MQR A;  3AAT A;  3OKS A;  3FRK A;  1ELU A;  3K7Y A;  2HP1 A;  4GEB A;  5BJ3 A;  2AY8 A;  4CVQ A;  2TPL A;  2W8U A;  2Z61 A;  1X0M A;  2RFV A;  1GCK A;  1ASE A;  2ZY4 A;  3BV0 A;  1JS6 A;  1XEY A;  3AEJ A;  2QA3 A;  1Y4I A;  4WYG A;  3GBX A;  2W7M A;  1V2D A;  2ZSL A;  3AOW A;  3LG0 A;  2D64 A;  3VAX A;  1LC8 A;  1UKJ A;  2CH1 A;  4A0F A;  4ITX A;  4OBV A;  2AY7 A;  1PG8 A;  1C7O A;  1ELQ A;  4W91 A;  2GQN A;  3E9K A;  1RV3 A;  4OCA A;  4IYO A;  4CXR A;  2W7G A;  1GEW A;  2O1B A;  3FCR A;  1W7M A;  3BWN C;  2CAN A;  3AEM A;  2EZ1 A;  2AY2 A;  4CXQ A;  1GC0 A;  2AY5 A;  2VGV A;  1GC2 A;  4LC3 A;  1KKJ A;  2FNU A;  3A9Z A;  4UOY A;  2W7L A;  2BIA A;  2Z9W A;  3KE3 A;  4RM1 A;  3NTJ A;  4XJP A;  4JEY A;  3WY7 A;  3LV2 A;  4MSO A;  5M4D A;  2HOZ A;  4AH3 A;  4JF1 A;  2C0R A;  3WX9 A;  3ISL A;  3PD6 B;  1QJ3 A;  2BWO A;  3FVS A;  4E1O A;  4WP0 A;  1ZOB A;  1D7U A;  1WST A;  2WKA A;  4OTL A;  2W7E A;  5DJ9 A;  4W1V A;  5EIG A;  3NYU A;  2Z9U A;  3FSL A;  3B8X A;  4TV7 A;  1CS1 A;  4ZWM A;  3ECD A;  2JJH A;  3JWA A;  1TPL A;  3W1H A;  4WB0 A;  1AMR A;  4XJL A;  2C81 A;  3CBF A;  3LVM A;  4HVK A;  1MLZ A;  2HUI A;  1JS3 A;  1YIY A;  3DU4 A;  1IX8 A;  1CJ0 A;  2W7K A;  3NUI A;  5AX8 A;  1AY5 A;  4ZM3 A;  2CIN A;  3EIB A;  2OGA A;  2DGL A;  4WYF A;  3QM2 A;  2PB2 A;  2Q7W A;  3OP7 A;  3I16 A;  1S0A A;  4BMK A;  1LS3 A;  1S06 A;  1UU1 A;  1ORD A;  4KXK A;  2HOR A;  4NOG A;  3A9Y A;  4EB5 A;  1BJW A;  1AHG A;  1FG3 A;  1EJI A;  1S07 A;  4FL0 A;  4GSA A;  1SVV A;  3PPL A;  2JIS A;  2BYJ A;  3T32 A;  3GET A;  2W7D A;  4LW4 A;  4WBT A;  1ZC9 A;  4IW7 A;  3ZRR A;  2OAT A;  3R9A A;  3AEP A;  1SPA A;  2BWP A;  1QGN A;  1AY8 A;  1OHV A;  1TAR A;  2JGT A;  3P1T A;  3RI6 A;  3IF2 A;  1ASL A;  2X8U A;  3ACZ A;  2VLH A;  4O6Z A;  1FC4 A;  1H1C A;  3LVK A;  4F5I A;  4RAE A;  2VI8 A;  1RVU A;  4K2I A;  2CJG A;  4J8L A;  2QBT A;  3HVY A;  3QHX A;  1X2A A;  3A9X A;  5EIG B;  2BHX A;  4A72 A;  4A0H A;  5BJ4 A;  1TOJ A;  2VMU A;  7AAT A;  5K8B A;  2AEV A;  1O4S A;  4OBU A;  1WYV A;  3FDD A;  2DGK A;  2HOY A;  4XJO A;  1MAQ A;  2D5Y A;  1AX4 A;  2ZSM A;  5EUN A;  2JJF A;  2HUF A;  1V2E A;  3RQ1 A;  3KKI A;  1OHW A;  3G8M A;  1M6S A;  1AIA A;  2HZP A;  1W23 A;  4WD2 A;  1CQ7 A;  3ZZK A;  3FZ6 A;  1AHE A;  4Y0H A;  2WK7 A;  4A00 A;  2GSA A;  1AJR A;  4LNM A;  1TOK A;  3E6G A;  3E2Z B;  1G4V A;  2BI3 A;  1D7S A;  1I48 A;  5D5S A;  1DTY A;  3PA9 A;  3VP6 A;  3COG A;  3II0 A;  4MQQ A;  4TMR A;  5J8Q A;  3EUC A;  3GSB A;  3AEN B;  1SZK A;  4ZAS A;  3GJU A;  1IX6 A;  1MDX A;  3PAA A;  4ZSW A;  1ARI A;  4WXB A;  4XEW A;  4AO9 A;  1SZS A;  3K28 A;  1I29 A;  2QMA A;  1OXO A;  1MGV A;  4W8I A;  1AKA A;  1OAT A;  1WYT A;  2BWN A;  3BC8 A;  3JW9 A;  5DB5 A;  2FNI A;  3HDO A;  2FYF A;  3NUB A;  4UHM A;  2DGM A;  5HDM A;  3EZS A;  3MAD A;  3UWC A;  2QB3 A;  1V2F A;  1KL2 A;  5FT6 A;  2VYC A;  1WKG A;  5FT4 A;  2D61 A;  3QPG A;  5I92 A;  3TCM A;  9AAT A;  1ASM A;  1LK9 A;  2Z1Y A;  4MGR A;  4P3M A;  3WGB A;  3AEL A;  3TFU A;  4K2B A;  3MAF A;  3VOM A;  4F5L A;  4BHD A;  5M46 A;  3N75 A;  2CY8 A;  1YIZ A;  2V1P A;  2CB1 A;  3FDB A;  3LY1 A;  3Q8N A;  2W7J A;  2Z1Z A;  1IVR A;  3E2Y A;  1B4X A;  4ZLV A;  1LKC A;  3B46 A;  1AAW A;  1DJE A;  3LVJ A;  3KGX A;  3MAU A;  2R5C A;  2AEU A;  3BCB A;  3MAF B;  2OKK A;  1BJO B;  5G0A A;  4XK1 A;  1ASG A;  1UU0 A;  4ITG A;  2ZUK A;  1IAX A;  1KMJ A;  2XH1 A;  4PVF A;  4XQ2 A;  3GR9 A;  4W1X A;  1G7W A;  1CQ6 A;  2D7Y A;  3WZF A;  4DBC A;  2CJD A;  4R5F A;  3NNK A;  1M0O A;  2W8T A;  2YKY A;  3EI8 A;  4Q31 A;  1AIB A;  1DKA A;  2NMP A;  4ADB A;  1GEX A;  1O69 A;  3HLM A;  4Q6R A;  2R5C B;  2YKX A;  2W7I A;  3FQ8 A;  2W8V A;  2VMR A;  2E7J A;  2WK9 A;  2JG2 A;  1C7G A;  4M2M A;  3AEM C;  3JWB A;  2O0R A;  3FVU A;  1I41 A;  5FT8 A;  4ADC A;  1M4N A;  4IX8 A;  1ASF A;  4N0W A;  4ZDP A;  4CBR A;  2BIG A;  5EUD A;  3BCX A;  4ATQ A;  1IAY A;  1AJS B;  4WLJ A;  3WCN A;  3B1C A;  3ELP A;  4JEX A;  2CFB A;  2EO5 A;  1AHY A;  2ORD A;  4IXO A;  1S09 A;  2DR1 A;  1QIR A;  4R5Z A;  2VMN A;  1X29 A;  2ZYJ A;  1MAP A;  3RBF A;  4WXF A;  3ZRP A;  2VMT A;  1M0P A;  4ZSY A;  3BS8 A;  4I8A A;  1YAA A;  1YOO A;  4L0O A;  3N0L A;  5DJ1 A;  2VGT A;  1CZE A;  5HHY A;  4B9B A;  2DKJ A;  1I43 A;  3HT4 A;  1D7V A;  3HL2 A;  1GEY A;  2CH2 A;  3ATH A;  2D63 A;  1QJ5 A;  2VMW A;  4LNJ A;  4WYA A;  4W5K A;  1OHY A;  3N5M A;  3I5T A;  5C6U A;  1WYU B;  3HMU A; 
#chains in the Genus database with same CATH topology
 1DJU A;  2BYL A;  2QLR A;  1DGD A;  1KL1 A;  5LH9 A;  2BI5 A;  3AOV A;  4K2M A;  4JEV A;  1B5P A;  1SFF A;  2WK8 A;  3P6K A;  2AY3 A;  3PDB A;  2BIE A;  3VK2 A;  4AO4 A;  2AY9 A;  3AEJ C;  4HF8 A;  5EUE A;  1ASD A;  3GZC A;  2VMZ A;  1U08 A;  1AKB A;  2AY1 A;  2BKW A;  3EI6 A;  3LVL B;  2GB3 A;  4XJM A;  2Z9V A;  2FQ6 A;  1KKP A;  2VI9 A;  2EH6 A;  5EQC A;  4IY7 A;  3DYD A;  4Q75 A;  4H51 A;  4EB7 A;  1PMM A;  1AAM A;  2YKV A;  1CL2 A;  1Z3Z A;  1M7Y A;  2X5F A;  5E5I A;  2YOB A;  1C7N A;  1BQA A;  1VJO A;  2C44 A;  3DZZ A;  3W1I A;  5DX5 A;  1S08 A;  2G6W A;  1DGE A;  4MKJ A;  5G4J A;  1JG8 A;  1ZOD A;  1ECX A;  2HP2 A;  5F9S A;  3FFH A;  3BWO A;  4CBS A;  1LW5 A;  4AOA A;  1AMA A;  2BI1 A;  1BQD A;  4RJY A;  2QSR A;  4ZDO A;  1DJ9 A;  1BJO A;  1TAS A;  2YCN A;  2VMX A;  2YRI A;  3DC1 A;  4OC9 A;  3WGC A;  4RIZ A;  1W3U A;  2YHK A;  2W7F A;  1T3I A;  3JU7 A;  1SZU A;  5KTB A;  4KYO A;  4OMA A;  2R2N A;  1IX7 A;  3DR4 A;  3FD0 A;  3MC6 C;  4KAM A;  2YKU A;  3AV7 A;  1LW4 A;  4PFF A;  2VIA A;  3DRD A;  3RUY A;  2DKB A;  4M2J A;  4A0R A;  3H9X A;  4WYC A;  1KMK A;  4E77 A;  4XAU A;  1AKC A;  2ZY2 A;  4M2K A;  2OGE A;  2Z20 A;  3B1D A;  1BKG A;  4RLG A;  2W7H A;  3ZRQ A;  3L8A A;  3RCH A;  1FG7 A;  3CQ6 A;  3UE8 A;  4JE5 D;  4GRX A;  4DQ6 A;  1IJI A;  3B1E A;  1BS0 A;  2VIB A;  1IUG A;  2E7I A;  4BA5 A;  1N31 A;  1AHF A;  3A8U X;  4ADD A;  5G09 A;  2OQX A;  3AEN A;  2HUU A;  4WYE A;  2EZ2 A;  1TOI A;  2JJG A;  3DOD A;  2VMS A;  1G4X A;  1GDE A;  1V72 A;  2GMU A;  3F0H A;  3NU8 A;  5G4I A;  1YJY A;  3JZL A;  4F4E A;  3ASA A;  3LWS A;  2JJE A;  4WB0 B;  4R8D A;  1MDO A;  1IBJ A;  2VGS A;  3DXW A;  4JEW A;  1E5F A;  2D7Z A;  2CJH A;  5G2Q A;  3TFT A;  1PFF A;  1ARS A;  4RIT A;  3QGU A;  2ZJG A;  2YRR A;  4BA4 A;  1E5E A;  2AAT A;  3CAI A;  3W1J A;  2W8J A;  2D65 A;  4UQV A;  1YJS A;  3F6T A;  1D7R A;  1J04 A;  1TOE A;  4PIW A;  2GMS A;  4F5K A;  8AAT A;  4A6R A;  3NYT A;  1OXP A;  4ATP A;  5EAV A;  1D2F A;  4ISY A;  4N0B A;  4ADE A;  1Z7D A;  1WKH A;  2EPJ A;  3NU7 A;  3QN6 A;  4GE4 A;  1CL1 A;  1X28 A;  2VMQ A;  3BWN A;  1BW0 A;  1CQ8 A;  1M32 A;  2R5E A;  4Y0I A;  1N8P A;  4F5G A;  5HXX A;  1VEF A;  3IHJ A;  1C4K A;  1B9I A;  4QGR A;  1TOG A;  5TF5 A;  5LHA A;  3F9T A;  3NYS A;  1UU2 A;  4Y0D A;  1GD9 A;  4GE7 A;  5E3K A;  4IYO B;  4F5F A;  2VGW A;  1JF9 A;  1N2T A;  2X5D A;  2G7J A;  3DR7 A;  3HQT A;  3WKR A;  1C0N A;  1ASN A;  1YJZ A;  4RKD A;  3GZD C;  1GBN A;  5JAY A;  2XBN A;  3DXV A;  3WLX A;  4B98 A;  4EU1 A;  4MKK A;  4TN4 A;  1O62 A;  2E54 A;  3FKD A;  3NX3 A;  4AZK A;  3CQ5 A;  4EMY A;  4BQ0 A;  3D6K A;  1W7L A;  1ASA A;  2AY6 A;  3H7F A;  5IWQ A;  4GDY A;  1WYT B;  1TAT A;  3PJ0 A;  3QBO A;  2ZY3 A;  1GC4 A;  3R4T A;  3BCA A;  1AJS A;  1M0Q A;  2VMV A;  3K40 A;  2VMY A;  4Q76 A;  3PDX A;  2Z9X A;  2VGU A;  3EI5 A;  1M0N A;  3I4J A;  4A0G A;  1EG5 A;  4WYD A;  2VLF A;  3L44 A;  3RBL A;  3G0T A;  1GC3 A;  1ARH A;  2C7T A;  2X3L A;  4EFF A;  4W1W A;  3VK4 A;  3BN1 A;  1RV4 A;  1EQB A;  5G2P A;  3FQA A;  2VMO A;  2BI9 A;  2FN6 A;  3E2F A;  3FFR A;  1QZ9 A;  3MKJ A;  2V0Y A;  3NDN A;  4IXS A;  4UHN A;  2PB0 A;  4JE5 A;  2BI2 A;  1AY4 A;  4ZAH A;  2ZP7 A;  4F5H A;  1VP4 A;  1WYU A;  4R2N A;  5M4B A;  1P3W A;  1AHX A;  4A6U A;  4ZDL A;  4U2H A;  4DGT A;  4E3R A;  2ZY5 A;  1KAF A;  1QIT A;  1B5O A;  1AIC A;  2E7U A;  2F8J A;  3PDB B;  4MY5 A;  5E4Z A;  4F5M A;  4ZM4 A;  1LC7 A;  2QB2 A;  1PMO A;  3EIA A;  5EFS A;  2YCP A;  4F5J A;  1YNU A;  4JF0 A;  3GZD A;  1DFO A;  4JEZ A;  3GWP A;  3BB8 A;  3ZZJ A;  1LC5 A;  2EGY A;  3ELE A;  2PO3 A;  3CQ4 A;  1W7N A;  1QIS A;  2VMP A;  3WKS A;  3TQX A;  4LW2 A;  4OT8 A;  1XI9 A;  3HBX A;  3FQ7 A;  2YCT A;  4UHO A;  4A6T A;  1ASB A;  4ZWV A;  2HOX A;  5EAA A;  3KGW A;  3FZ7 A;  3G7Q A;  4U1T A;  1J32 A;  3NRA A;  2CST A;  3QI6 A;  3EZ1 A;  1MDZ A;  1AMQ A;  3FZ8 A;  4MQP A;  2DOU A;  1B9H A;  1BT4 A;  1O61 A;  1ARG A;  1RVY A;  3EI9 A;  3MEB A;  3JTX A;  3RCH B;  2CTZ A;  1AMS A;  1WYV B;  2AY4 A;  1ASC A;  3FVX A;  3MBB A;  4FFC A;  1CZC A;  4P7Y A;  4OYT A;  2FM1 A;  5F8V A;  3PGY A;  3ASB A;  4LNL A;  3AEO A;  2D66 A;  3E77 A;  4IXZ A;  4RJ0 A;  4WXG A;  5M49 A;  4RKC A;  5FT5 A;  1H0C A;  3TAT A;  4PFN A;  1ART A;  1G7X A;  4E3Q A;  3USF A;  1SF2 A;  2Z67 A;  3M5U A;  3A2B A;  1B8G A;  4H63 Q;  3E2Z A;  3EI7 A;  5D95 A;  3PIU A;  2R0T A;  3WCO A;  2W8W A;  3MC6 A;  3PD6 A;  2OKJ A;  2ZC0 A;  1BJ4 A;  3H14 A;  4GE9 A;  3VK3 A;  4WLH A;  3UAK A;  1C9C A;  3FTB A;  1MLY A;  2O7C A;  4J5U A;  1BJN A;  4AZJ A;  2VGZ A;  4MQR A;  3AAT A;  3OKS A;  3FRK A;  1ELU A;  3K7Y A;  2HP1 A;  4GEB A;  5BJ3 A;  2AY8 A;  4CVQ A;  2TPL A;  2W8U A;  2Z61 A;  1X0M A;  2RFV A;  1GCK A;  1ASE A;  2ZY4 A;  3BV0 A;  1JS6 A;  1XEY A;  3AEJ A;  2QA3 A;  1Y4I A;  4WYG A;  3GBX A;  2W7M A;  1V2D A;  2ZSL A;  3AOW A;  3LG0 A;  2D64 A;  3VAX A;  1LC8 A;  1UKJ A;  2CH1 A;  4A0F A;  4ITX A;  4OBV A;  2AY7 A;  1PG8 A;  1C7O A;  1ELQ A;  4W91 A;  2GQN A;  3E9K A;  1RV3 A;  4OCA A;  4IYO A;  4CXR A;  2W7G A;  2A1V A;  1GEW A;  2O1B A;  3FCR A;  1W7M A;  3BWN C;  2CAN A;  3AEM A;  2EZ1 A;  2AY2 A;  4CXQ A;  1GC0 A;  2AY5 A;  2VGV A;  1GC2 A;  4LC3 A;  1KKJ A;  2FNU A;  3A9Z A;  4UOY A;  2W7L A;  2BIA A;  2Z9W A;  3KE3 A;  4RM1 A;  3NTJ A;  4XJP A;  4JEY A;  3WY7 A;  3LV2 A;  4MSO A;  5M4D A;  2HOZ A;  4AH3 A;  4JF1 A;  2C0R A;  3WX9 A;  3ISL A;  3PD6 B;  1QJ3 A;  2BWO A;  3FVS A;  4E1O A;  4WP0 A;  1ZOB A;  3N4R A;  1D7U A;  1WST A;  2WKA A;  4OTL A;  2W7E A;  5DJ9 A;  4W1V A;  5EIG A;  3NYU A;  2Z9U A;  3FSL A;  3B8X A;  4TV7 A;  1CS1 A;  4ZWM A;  3ECD A;  2JJH A;  3JWA A;  1TPL A;  3W1H A;  4WB0 A;  1AMR A;  4XJL A;  3N4S A;  2C81 A;  3CBF A;  3LVM A;  4HVK A;  1MLZ A;  2HUI A;  1JS3 A;  1YIY A;  3DU4 A;  1IX8 A;  1CJ0 A;  2W7K A;  3NUI A;  5AX8 A;  1AY5 A;  4ZM3 A;  2CIN A;  3EIB A;  2OGA A;  2DGL A;  4WYF A;  3QM2 A;  2PB2 A;  2Q7W A;  3OP7 A;  3I16 A;  1S0A A;  4BMK A;  1LS3 A;  2FKI A;  1S06 A;  1UU1 A;  1ORD A;  4KXK A;  2HOR A;  4NOG A;  3A9Y A;  4EB5 A;  1BJW A;  1AHG A;  1FG3 A;  1EJI A;  1S07 A;  4FL0 A;  4GSA A;  1SVV A;  3PPL A;  2JIS A;  2BYJ A;  3T32 A;  3GET A;  2W7D A;  4LW4 A;  4WBT A;  1ZC9 A;  4IW7 A;  3ZRR A;  2OAT A;  3R9A A;  3AEP A;  1SPA A;  2BWP A;  1QGN A;  1AY8 A;  1OHV A;  1TAR A;  2JGT A;  3P1T A;  3RI6 A;  3IF2 A;  1ASL A;  2X8U A;  3ACZ A;  2VLH A;  4O6Z A;  1FC4 A;  1H1C A;  3LVK A;  4F5I A;  4RAE A;  2VI8 A;  1RVU A;  4K2I A;  2CJG A;  4J8L A;  2QBT A;  3HVY A;  3QHX A;  1X2A A;  3A9X A;  5EIG B;  2BHX A;  4A72 A;  4A0H A;  5BJ4 A;  1TOJ A;  2VMU A;  7AAT A;  5K8B A;  2AEV A;  1O4S A;  4OBU A;  1WYV A;  3FDD A;  2DGK A;  2HOY A;  4XJO A;  1MAQ A;  2D5Y A;  1AX4 A;  2ZSM A;  5EUN A;  2JJF A;  2HUF A;  1V2E A;  3N7N A;  3RQ1 A;  3KKI A;  1OHW A;  3G8M A;  1M6S A;  1AIA A;  2HZP A;  1W23 A;  4WD2 A;  1CQ7 A;  3ZZK A;  3FZ6 A;  1AHE A;  4Y0H A;  2WK7 A;  4A00 A;  2GSA A;  1AJR A;  4LNM A;  1TOK A;  3E6G A;  3E2Z B;  1G4V A;  2BI3 A;  1D7S A;  1I48 A;  5D5S A;  1DTY A;  3PA9 A;  3VP6 A;  3COG A;  3II0 A;  4MQQ A;  4TMR A;  5J8Q A;  3EUC A;  3GSB A;  3AEN B;  2WB6 A;  1SZK A;  4ZAS A;  3GJU A;  1IX6 A;  1MDX A;  3PAA A;  4ZSW A;  1ARI A;  4WXB A;  4XEW A;  4AO9 A;  1SZS A;  3K28 A;  1I29 A;  2QMA A;  1OXO A;  1MGV A;  4W8I A;  1AKA A;  1OAT A;  1WYT A;  2BWN A;  3BC8 A;  3JW9 A;  5DB5 A;  2FNI A;  3HDO A;  2FYF A;  3NUB A;  4UHM A;  2DGM A;  5HDM A;  3EZS A;  3MAD A;  3UWC A;  2QB3 A;  1V2F A;  3N4X A;  1KL2 A;  5FT6 A;  2VYC A;  1WKG A;  5FT4 A;  2D61 A;  3QPG A;  5I92 A;  3TCM A;  9AAT A;  1ASM A;  1LK9 A;  2Z1Y A;  4MGR A;  4P3M A;  3WGB A;  3AEL A;  3TFU A;  4K2B A;  3MAF A;  3VOM A;  4F5L A;  4BHD A;  5M46 A;  3N75 A;  2CY8 A;  1YIZ A;  2V1P A;  2CB1 A;  3FDB A;  3LY1 A;  3Q8N A;  2W7J A;  2Z1Z A;  1IVR A;  3E2Y A;  1B4X A;  4ZLV A;  1LKC A;  3B46 A;  1AAW A;  1DJE A;  3LVJ A;  3KGX A;  3MAU A;  2R5C A;  2AEU A;  3BCB A;  3MAF B;  2OKK A;  1BJO B;  5G0A A;  4XK1 A;  1ASG A;  1UU0 A;  4ITG A;  2ZUK A;  2EYQ A;  1IAX A;  1KMJ A;  2XH1 A;  4PVF A;  4XQ2 A;  3GR9 A;  4W1X A;  1G7W A;  1CQ6 A;  2D7Y A;  3WZF A;  4DBC A;  2CJD A;  4R5F A;  3NNK A;  1M0O A;  2W8T A;  2YKY A;  3EI8 A;  4Q31 A;  1AIB A;  1DKA A;  2NMP A;  4ADB A;  1GEX A;  1O69 A;  3HLM A;  4Q6R A;  2R5C B;  2YKX A;  2W7I A;  2KFP A;  3FQ8 A;  2W8V A;  2VMR A;  2E7J A;  2WK9 A;  2JG2 A;  1C7G A;  4M2M A;  3AEM C;  3JWB A;  2O0R A;  3FVU A;  1I41 A;  5FT8 A;  4ADC A;  1M4N A;  4IX8 A;  1ASF A;  4N0W A;  4ZDP A;  4CBR A;  2BIG A;  5EUD A;  3BCX A;  4ATQ A;  1IAY A;  1AJS B;  4WLJ A;  3WCN A;  3B1C A;  3ELP A;  4JEX A;  2CFB A;  2EO5 A;  1AHY A;  2ORD A;  4IXO A;  1S09 A;  2DR1 A;  1QIR A;  4R5Z A;  2VMN A;  1X29 A;  2ZYJ A;  1MAP A;  3RBF A;  4WXF A;  3ZRP A;  2VMT A;  1M0P A;  4ZSY A;  3BS8 A;  4I8A A;  1YAA A;  1YOO A;  4L0O A;  3N0L A;  5DJ1 A;  2VGT A;  1CZE A;  5HHY A;  4B9B A;  2DKJ A;  1I43 A;  3HT4 A;  1D7V A;  4K05 A;  3HL2 A;  1GEY A;  2CH2 A;  3ATH A;  2D63 A;  1QJ5 A;  2VMW A;  4LNJ A;  4WYA A;  4W5K A;  1OHY A;  3N5M A;  3I5T A;  5C6U A;  1WYU B;  3HMU A; 
#chains in the Genus database with same CATH homology
 1DJU A;  2BYL A;  2QLR A;  1DGD A;  1KL1 A;  5LH9 A;  2BI5 A;  3AOV A;  4K2M A;  4JEV A;  1B5P A;  1SFF A;  2WK8 A;  3P6K A;  2AY3 A;  3PDB A;  2BIE A;  3VK2 A;  4AO4 A;  2AY9 A;  3AEJ C;  4HF8 A;  5EUE A;  1ASD A;  3GZC A;  2VMZ A;  1U08 A;  1AKB A;  2AY1 A;  2BKW A;  3EI6 A;  3LVL B;  2GB3 A;  4XJM A;  2Z9V A;  2FQ6 A;  1KKP A;  2VI9 A;  2EH6 A;  5EQC A;  4IY7 A;  3DYD A;  4Q75 A;  4H51 A;  4EB7 A;  1PMM A;  1AAM A;  2YKV A;  1CL2 A;  1Z3Z A;  1M7Y A;  2X5F A;  5E5I A;  2YOB A;  1C7N A;  1BQA A;  1VJO A;  2C44 A;  3DZZ A;  3W1I A;  5DX5 A;  1S08 A;  2G6W A;  1DGE A;  4MKJ A;  5G4J A;  1JG8 A;  1ZOD A;  1ECX A;  2HP2 A;  5F9S A;  3FFH A;  3BWO A;  4CBS A;  1LW5 A;  4AOA A;  1AMA A;  2BI1 A;  1BQD A;  4RJY A;  2QSR A;  4ZDO A;  1DJ9 A;  1BJO A;  1TAS A;  2YCN A;  2VMX A;  2YRI A;  3DC1 A;  4OC9 A;  3WGC A;  4RIZ A;  1W3U A;  2YHK A;  2W7F A;  1T3I A;  3JU7 A;  1SZU A;  5KTB A;  4KYO A;  4OMA A;  2R2N A;  1IX7 A;  3DR4 A;  3FD0 A;  3MC6 C;  4KAM A;  2YKU A;  3AV7 A;  1LW4 A;  4PFF A;  2VIA A;  3DRD A;  3RUY A;  2DKB A;  4M2J A;  4A0R A;  3H9X A;  4WYC A;  1KMK A;  4E77 A;  4XAU A;  1AKC A;  2ZY2 A;  4M2K A;  2OGE A;  2Z20 A;  3B1D A;  1BKG A;  4RLG A;  2W7H A;  3ZRQ A;  3L8A A;  3RCH A;  1FG7 A;  3CQ6 A;  3UE8 A;  4JE5 D;  4GRX A;  4DQ6 A;  1IJI A;  3B1E A;  1BS0 A;  2VIB A;  1IUG A;  2E7I A;  4BA5 A;  1N31 A;  1AHF A;  3A8U X;  4ADD A;  5G09 A;  2OQX A;  3AEN A;  2HUU A;  4WYE A;  2EZ2 A;  1TOI A;  2JJG A;  3DOD A;  2VMS A;  1G4X A;  1GDE A;  1V72 A;  2GMU A;  3F0H A;  3NU8 A;  5G4I A;  1YJY A;  3JZL A;  4F4E A;  3ASA A;  3LWS A;  2JJE A;  4WB0 B;  4R8D A;  1MDO A;  1IBJ A;  2VGS A;  3DXW A;  4JEW A;  1E5F A;  2D7Z A;  2CJH A;  5G2Q A;  3TFT A;  1PFF A;  1ARS A;  4RIT A;  3QGU A;  2ZJG A;  2YRR A;  4BA4 A;  1E5E A;  2AAT A;  3CAI A;  3W1J A;  2W8J A;  2D65 A;  4UQV A;  1YJS A;  3F6T A;  1D7R A;  1J04 A;  1TOE A;  4PIW A;  2GMS A;  4F5K A;  8AAT A;  4A6R A;  3NYT A;  1OXP A;  4ATP A;  5EAV A;  1D2F A;  4ISY A;  4N0B A;  4ADE A;  1Z7D A;  1WKH A;  2EPJ A;  3NU7 A;  3QN6 A;  4GE4 A;  1CL1 A;  1X28 A;  2VMQ A;  3BWN A;  1BW0 A;  1CQ8 A;  1M32 A;  2R5E A;  4Y0I A;  1N8P A;  4F5G A;  5HXX A;  1VEF A;  3IHJ A;  1C4K A;  1B9I A;  4QGR A;  1TOG A;  5TF5 A;  5LHA A;  3F9T A;  3NYS A;  1UU2 A;  4Y0D A;  1GD9 A;  4GE7 A;  5E3K A;  4IYO B;  4F5F A;  2VGW A;  1JF9 A;  1N2T A;  2X5D A;  2G7J A;  3DR7 A;  3HQT A;  3WKR A;  1C0N A;  1ASN A;  1YJZ A;  4RKD A;  3GZD C;  1GBN A;  5JAY A;  2XBN A;  3DXV A;  3WLX A;  4B98 A;  4EU1 A;  4MKK A;  4TN4 A;  1O62 A;  2E54 A;  3FKD A;  3NX3 A;  4AZK A;  3CQ5 A;  4EMY A;  4BQ0 A;  3D6K A;  1W7L A;  1ASA A;  2AY6 A;  3H7F A;  5IWQ A;  4GDY A;  1WYT B;  1TAT A;  3PJ0 A;  3QBO A;  2ZY3 A;  1GC4 A;  3R4T A;  3BCA A;  1AJS A;  1M0Q A;  2VMV A;  3K40 A;  2VMY A;  4Q76 A;  3PDX A;  2Z9X A;  2VGU A;  3EI5 A;  1M0N A;  3I4J A;  4A0G A;  1EG5 A;  4WYD A;  2VLF A;  3L44 A;  3RBL A;  3G0T A;  1GC3 A;  1ARH A;  2C7T A;  2X3L A;  4EFF A;  4W1W A;  3VK4 A;  3BN1 A;  1RV4 A;  1EQB A;  5G2P A;  3FQA A;  2VMO A;  2BI9 A;  2FN6 A;  3E2F A;  3FFR A;  1QZ9 A;  3MKJ A;  2V0Y A;  3NDN A;  4IXS A;  4UHN A;  2PB0 A;  4JE5 A;  2BI2 A;  1AY4 A;  4ZAH A;  2ZP7 A;  4F5H A;  1VP4 A;  1WYU A;  4R2N A;  5M4B A;  1P3W A;  1AHX A;  4A6U A;  4ZDL A;  4U2H A;  4DGT A;  4E3R A;  2ZY5 A;  1QIT A;  1B5O A;  1AIC A;  2E7U A;  2F8J A;  3PDB B;  4MY5 A;  5E4Z A;  4F5M A;  4ZM4 A;  1LC7 A;  2QB2 A;  1PMO A;  3EIA A;  5EFS A;  2YCP A;  4F5J A;  1YNU A;  4JF0 A;  3GZD A;  1DFO A;  4JEZ A;  3GWP A;  3BB8 A;  3ZZJ A;  1LC5 A;  2EGY A;  3ELE A;  2PO3 A;  3CQ4 A;  1W7N A;  1QIS A;  2VMP A;  3WKS A;  3TQX A;  4LW2 A;  4OT8 A;  1XI9 A;  3HBX A;  3FQ7 A;  2YCT A;  4UHO A;  4A6T A;  1ASB A;  4ZWV A;  2HOX A;  5EAA A;  3KGW A;  3FZ7 A;  3G7Q A;  4U1T A;  1J32 A;  3NRA A;  2CST A;  3QI6 A;  3EZ1 A;  1MDZ A;  1AMQ A;  3FZ8 A;  4MQP A;  2DOU A;  1B9H A;  1BT4 A;  1O61 A;  1ARG A;  1RVY A;  3EI9 A;  3MEB A;  3JTX A;  3RCH B;  2CTZ A;  1AMS A;  1WYV B;  2AY4 A;  1ASC A;  3FVX A;  3MBB A;  4FFC A;  1CZC A;  4P7Y A;  4OYT A;  2FM1 A;  5F8V A;  3PGY A;  3ASB A;  4LNL A;  3AEO A;  2D66 A;  3E77 A;  4IXZ A;  4RJ0 A;  4WXG A;  5M49 A;  4RKC A;  5FT5 A;  1H0C A;  3TAT A;  4PFN A;  1ART A;  1G7X A;  4E3Q A;  3USF A;  1SF2 A;  2Z67 A;  3M5U A;  3A2B A;  1B8G A;  4H63 Q;  3E2Z A;  3EI7 A;  5D95 A;  3PIU A;  2R0T A;  3WCO A;  2W8W A;  3MC6 A;  3PD6 A;  2OKJ A;  2ZC0 A;  1BJ4 A;  3H14 A;  4GE9 A;  3VK3 A;  4WLH A;  3UAK A;  1C9C A;  3FTB A;  1MLY A;  2O7C A;  4J5U A;  1BJN A;  4AZJ A;  2VGZ A;  4MQR A;  3AAT A;  3OKS A;  3FRK A;  1ELU A;  3K7Y A;  2HP1 A;  4GEB A;  5BJ3 A;  2AY8 A;  4CVQ A;  2TPL A;  2W8U A;  2Z61 A;  1X0M A;  2RFV A;  1GCK A;  1ASE A;  2ZY4 A;  3BV0 A;  1JS6 A;  1XEY A;  3AEJ A;  2QA3 A;  1Y4I A;  4WYG A;  3GBX A;  2W7M A;  1V2D A;  2ZSL A;  3AOW A;  3LG0 A;  2D64 A;  3VAX A;  1LC8 A;  1UKJ A;  2CH1 A;  4A0F A;  4ITX A;  4OBV A;  2AY7 A;  1PG8 A;  1C7O A;  1ELQ A;  4W91 A;  2GQN A;  3E9K A;  1RV3 A;  4OCA A;  4IYO A;  4CXR A;  2W7G A;  2A1V A;  1GEW A;  2O1B A;  3FCR A;  1W7M A;  3BWN C;  2CAN A;  3AEM A;  2EZ1 A;  2AY2 A;  4CXQ A;  1GC0 A;  2AY5 A;  2VGV A;  1GC2 A;  4LC3 A;  1KKJ A;  2FNU A;  3A9Z A;  4UOY A;  2W7L A;  2BIA A;  2Z9W A;  3KE3 A;  4RM1 A;  3NTJ A;  4XJP A;  4JEY A;  3WY7 A;  3LV2 A;  4MSO A;  5M4D A;  2HOZ A;  4AH3 A;  4JF1 A;  2C0R A;  3WX9 A;  3ISL A;  3PD6 B;  1QJ3 A;  2BWO A;  3FVS A;  4E1O A;  4WP0 A;  1ZOB A;  3N4R A;  1D7U A;  1WST A;  2WKA A;  4OTL A;  2W7E A;  5DJ9 A;  4W1V A;  5EIG A;  3NYU A;  2Z9U A;  3FSL A;  3B8X A;  4TV7 A;  1CS1 A;  4ZWM A;  3ECD A;  2JJH A;  3JWA A;  1TPL A;  3W1H A;  4WB0 A;  1AMR A;  4XJL A;  3N4S A;  2C81 A;  3CBF A;  3LVM A;  4HVK A;  1MLZ A;  2HUI A;  1JS3 A;  1YIY A;  3DU4 A;  1IX8 A;  1CJ0 A;  2W7K A;  3NUI A;  5AX8 A;  1AY5 A;  4ZM3 A;  2CIN A;  3EIB A;  2OGA A;  2DGL A;  4WYF A;  3QM2 A;  2PB2 A;  2Q7W A;  3OP7 A;  3I16 A;  1S0A A;  4BMK A;  1LS3 A;  2FKI A;  1S06 A;  1UU1 A;  1ORD A;  4KXK A;  2HOR A;  4NOG A;  3A9Y A;  4EB5 A;  1BJW A;  1AHG A;  1FG3 A;  1EJI A;  1S07 A;  4FL0 A;  4GSA A;  1SVV A;  3PPL A;  2JIS A;  2BYJ A;  3T32 A;  3GET A;  2W7D A;  4LW4 A;  4WBT A;  1ZC9 A;  4IW7 A;  3ZRR A;  2OAT A;  3R9A A;  3AEP A;  1SPA A;  2BWP A;  1QGN A;  1AY8 A;  1OHV A;  1TAR A;  2JGT A;  3P1T A;  3RI6 A;  3IF2 A;  1ASL A;  2X8U A;  3ACZ A;  2VLH A;  4O6Z A;  1FC4 A;  1H1C A;  3LVK A;  4F5I A;  4RAE A;  2VI8 A;  1RVU A;  4K2I A;  2CJG A;  4J8L A;  2QBT A;  3HVY A;  3QHX A;  1X2A A;  3A9X A;  5EIG B;  2BHX A;  4A72 A;  4A0H A;  5BJ4 A;  1TOJ A;  2VMU A;  7AAT A;  5K8B A;  2AEV A;  1O4S A;  4OBU A;  1WYV A;  3FDD A;  2DGK A;  2HOY A;  4XJO A;  1MAQ A;  2D5Y A;  1AX4 A;  2ZSM A;  5EUN A;  2JJF A;  2HUF A;  1V2E A;  3N7N A;  3RQ1 A;  3KKI A;  1OHW A;  3G8M A;  1M6S A;  1AIA A;  2HZP A;  1W23 A;  4WD2 A;  1CQ7 A;  3ZZK A;  3FZ6 A;  1AHE A;  4Y0H A;  2WK7 A;  4A00 A;  2GSA A;  1AJR A;  4LNM A;  1TOK A;  3E6G A;  3E2Z B;  1G4V A;  2BI3 A;  1D7S A;  1I48 A;  5D5S A;  1DTY A;  3PA9 A;  3VP6 A;  3COG A;  3II0 A;  4MQQ A;  4TMR A;  5J8Q A;  3EUC A;  3GSB A;  3AEN B;  2WB6 A;  1SZK A;  4ZAS A;  3GJU A;  1IX6 A;  1MDX A;  3PAA A;  4ZSW A;  1ARI A;  4WXB A;  4XEW A;  4AO9 A;  1SZS A;  3K28 A;  1I29 A;  2QMA A;  1OXO A;  1MGV A;  4W8I A;  1AKA A;  1OAT A;  1WYT A;  2BWN A;  3BC8 A;  3JW9 A;  5DB5 A;  2FNI A;  3HDO A;  2FYF A;  3NUB A;  4UHM A;  2DGM A;  5HDM A;  3EZS A;  3MAD A;  3UWC A;  2QB3 A;  1V2F A;  3N4X A;  1KL2 A;  5FT6 A;  2VYC A;  1WKG A;  5FT4 A;  2D61 A;  3QPG A;  5I92 A;  3TCM A;  9AAT A;  1ASM A;  1LK9 A;  2Z1Y A;  4MGR A;  4P3M A;  3WGB A;  3AEL A;  3TFU A;  4K2B A;  3MAF A;  3VOM A;  4F5L A;  4BHD A;  5M46 A;  3N75 A;  2CY8 A;  1YIZ A;  2V1P A;  2CB1 A;  3FDB A;  3LY1 A;  3Q8N A;  2W7J A;  2Z1Z A;  1IVR A;  3E2Y A;  1B4X A;  4ZLV A;  1LKC A;  3B46 A;  1AAW A;  1DJE A;  3LVJ A;  3KGX A;  3MAU A;  2R5C A;  2AEU A;  3BCB A;  3MAF B;  2OKK A;  1BJO B;  5G0A A;  4XK1 A;  1ASG A;  1UU0 A;  4ITG A;  2ZUK A;  2EYQ A;  1IAX A;  1KMJ A;  2XH1 A;  4PVF A;  4XQ2 A;  3GR9 A;  4W1X A;  1G7W A;  1CQ6 A;  2D7Y A;  3WZF A;  4DBC A;  2CJD A;  4R5F A;  3NNK A;  1M0O A;  2W8T A;  2YKY A;  3EI8 A;  4Q31 A;  1AIB A;  1DKA A;  2NMP A;  4ADB A;  1GEX A;  1O69 A;  3HLM A;  4Q6R A;  2R5C B;  2YKX A;  2W7I A;  2KFP A;  3FQ8 A;  2W8V A;  2VMR A;  2E7J A;  2WK9 A;  2JG2 A;  1C7G A;  4M2M A;  3AEM C;  3JWB A;  2O0R A;  3FVU A;  1I41 A;  5FT8 A;  4ADC A;  1M4N A;  4IX8 A;  1ASF A;  4N0W A;  4ZDP A;  4CBR A;  2BIG A;  5EUD A;  3BCX A;  4ATQ A;  1IAY A;  1AJS B;  4WLJ A;  3WCN A;  3B1C A;  3ELP A;  4JEX A;  2CFB A;  2EO5 A;  1AHY A;  2ORD A;  4IXO A;  1S09 A;  2DR1 A;  1QIR A;  4R5Z A;  2VMN A;  1X29 A;  2ZYJ A;  1MAP A;  3RBF A;  4WXF A;  3ZRP A;  2VMT A;  1M0P A;  4ZSY A;  3BS8 A;  4I8A A;  1YAA A;  1YOO A;  4L0O A;  3N0L A;  5DJ1 A;  2VGT A;  1CZE A;  5HHY A;  4B9B A;  2DKJ A;  1I43 A;  3HT4 A;  1D7V A;  4K05 A;  3HL2 A;  1GEY A;  2CH2 A;  3ATH A;  2D63 A;  1QJ5 A;  2VMW A;  4LNJ A;  4WYA A;  4W5K A;  1OHY A;  3N5M A;  3I5T A;  5C6U A;  1WYU B;  3HMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...