4R5ZA

Crystal structure of rv3772 encoded aminotransferase
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
353
structure length
353
Chain Sequence
VTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCVQLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDKVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWRSDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Putative phenylalanine aminotransferase
publication title Crystal structures of Mycobacterium tuberculosis HspAT and ArAT reveal structural basis of their distinct substrate specificities
pubmed doi rcsb
source organism Mycobacterium tuberculosis h37rv
total genus 115
structure length 353
sequence length 353
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.-:
pdb deposition date 2014-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4r5zA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4r5zA01
1GC3A 2CJHA 4RAEA 4TV7A 1DKAA 3CQ5A 1M0OA 3E9KA 1VP4A 4WXBA 4N0WA 1PMMA 3NNKA 1ELQA 3QBOA 4OTLA 1AKAA 4ZSWA 1OXOA 2BKWA 4ZWVA 1DJ9A 4E77A 4OYTA 4XJOA 2VGZA 3MKJA 4ZM3A 2VMVA 3E2YA 4XK1A 2D61A 5EUEA 2ZYJA 2VMYA 4JEXA 3BB8A 2DKJA 3FQ7A 2VMOA 3BCAA 2EZ1A 1GEXA 4A6TA 1KL1A 4NOGA 3MADA 2ZSLA 4KYOA 1ARHA 3ELPA 4F5JA 1C7GA 3DRDA 1QIRA 4Q6RA 1T3IA 1XI9A 4E3RA 1OHVA 1CS1A 3E2ZA 4OMAA 3OKSA 4J8LA 1JF9A 1ZOBA 4OBVA 2CANA 2EH6A 1BKGA 1BJ4A 2O1BA 2ORDA 1OXPA 4RJ0A 5D5SA 1CQ7A 2BI5A 2GB3A 3I4JA 2BYLA 5EAVA 3UWCA 4AZJA 2WK9A 4WLHA 2HUIA 1M0QA 4E3QA 4ZM4A 1QGNA 4LNMA 1AKBA 3G0TA 3E2ZB 2DOUA 3CQ6A 1RVYA 3VK4A 2W8WA 3EZSA 4B98A 2VMXA 1C9CA 3HQTA 1V2FA 4R5ZA 2CTZA 4KAMA 2C0RA 4PVFA 1AICA 3K40A 2YKUA 1AHYA 2BWOA 2YCNA 3PIUA 2X3LA 2AEVA 2DGLA 2CJDA 2W8VA 4FL0A 4GE9A 5DJ1A 3FZ6A 3DXVA 1BQDA 1N2TA 2PB0A 2BIGA 3FFRA 2AY9A 2JJFA 1IAYA 2E7JA 3PAAA 2X8UA 1D7UA 3EUCA 2W7LA 2ZUKA 4JF1A 2VMTA 1QZ9A 2AY6A 2QMAA 3P6KA 2DGKA 2CB1A 4DQ6A 4ZLVA 1X2AA 3DXWA 4ATPA 2JJGA 3RUYA 3I16A 1CQ8A 3MAUA 1YNUA 3KKIA 1IBJA 3WLXA 3PDXA 1OATA 5M49A 1YAAA 2AY7A 2HUUA 1P3WA 1B9IA 1C0NA 1ASCA 4JEWA 3USFA 4CXRA 3RBLA 2YRIA 3EI9A 3FKDA 3FZ8A 1AMAA 2Z9XA 3FTBA 2OKKA 3CBFA 3B1DA 2E7UA 3RQ1A 4JEZA 1RVUA 4GEBA 3LVLB 2BI9A 5EIGB 1I43A 4GDYA 2QB2A 3HLMA 2DKBA 2Z1ZA 4XAUA 2BI1A 3D6KA 2VMRA 1RV3A 1CJ0A 2D7YA 2VMNA 3AOWA 5TF5A 3Q8NA 4A0HA 3MAFB 3HL2A 2C7TA 3QPGA 2D65A 4CVQA 1W23A 3LV2A 1SFFA 4IXZA 4PIWA 1BQAA 1AY5A 3ZZKA 2HZPA 1V72A 1LC7A 1AMSA 2R5EA 2VMQA 5LHAA 1LC8A 1ASMA 5D95A 2VIBA 2EGYA 1B5PA 1GCKA 5G2PA 4EFFA 1H0CA 1JS3A 1AAMA 4RKCA 1TASA 4LW2A 3BC8A 4F5GA 3II0A 2AY2A 3NYUA 3QN6A 5E5IA 4XQ2A 2BWNA 1W7LA 5AX8A 3ASAA 4AO9A 4O6ZA 4CBSA 1IVRA 3B8XA 3F0HA 2E7IA 2VGSA 3NRAA 1YJZA 5EFSA 1OHYA 3FQ8A 4A6UA 2BIAA 3M5UA 2W7IA 2AY3A 1DGDA 1IJIA 1DGEA 3A9XA 3DYDA 4A0RA 5M4DA 3A2BA 3E2FA 1MDOA 4RJYA 2R5CA 4BA4A 3VK2A 5G4IA 3AEMC 1ARIA 1W3UA 2Z9WA 2Z9UA 3BWNA 4A72A 1FC4A 4IY7A 4TN4A 4P7YA 3EI7A 1MAQA 3VP6A 1D2FA 3EI5A 2QA3A 2W7HA 2GSAA 3TFUA 3OP7A 3WGBA 3FDBA 2Z9VA 4F5FA 4ZAHA 3AOVA 2XH1A 3UAKA 4JEVA 4F5KA 2R5CB 5M4BA 1W7MA 2D5YA 2Z61A 4AH3A 1O61A 3G8MA 5FT5A 3GBXA 2EPJA 2GMSA 5I92A 4WYGA 3CQ4A 3EIAA 9AATA 3BS8A 3FD0A 3A9YA 3PPLA 4WYDA 8AATA 4WXFA 3QM2A 2HORA 2ZY3A 3KGWA 1RV4A 4RLGA 3JW9A 3N75A 4IXOA 3TFTA 2C81A 1YJYA 2W7DA 2VMZA 3QHXA 3HVYA 2W7JA 4F5IA 5BJ4A 1E5EA 3MC6C 4RIZA 1X29A 1SVVA 3JWBA 4ZASA 2Z20A 2RFVA 1ORDA 1M32A 1ELUA 2VGTA 3AENB 1S0AA 2JJHA 2ZJGA 3E6GA 4WYFA 1LKCA 3PD6B 4K2IA 4W1VA 3HBXA 3L44A 3MBBA 2W8UA 3NX3A 4KXKA 2O7CA 4AO4A 5K8BA 4Q31A 4DGTA 4ADBA 1AIAA 4ZSYA 4EB7A 4Y0DA 3UE8A 1MDZA 3BN1A 3DR7A 1YIYA 4JF0A 2WKAA 1AAWA 1SZSA 1PMOA 1QITA 4OBUA 1QJ3A 5HHYA 4ADDA 1AHXA 2AEUA 1TPLA 2VGVA 3QI6A 5C6UA 2DGMA 1IX8A 2D66A 5G0AA 5IWQA 4LC3A 2X5DA 2R0TA 3DC1A 1EQBA 4U2HA 2ZY2A 1BT4A 2AATA 4ADEA 2OKJA 1KL2A 1WKGA 2DR1A 1YIZA 2VI9A 4ZWMA 3NDNA 1TOIA 2YCPA 3BCXA 4EB5A 1ASFA 3DU4A 5EAAA 1S06A 1X28A 5G4JA 3DZZA 4J5UA 4BQ0A 3A9ZA 2OGAA 1O4SA 3IF2A 5EIGA 1X0MA 1YJSA 3ZZJA 4ZDLA 1I29A 1V2EA 1ASEA 3G7QA 3ASBA 3HDOA 1C7OA 2Q7WA 2YKVA 2YOBA 2WK7A 4B9BA 2AY1A 1J04A 3MAFA 1BJNA 1FG3A 1WYTA 3TQXA 4MY5A 4ATQA 2FNIA 3RCHB 2QB3A 7AATA 4LNLA 4WB0A 1KKPA 4GE7A 4GSAA 3COGA 5BJ3A 1DFOA 3LVJA 4MKKA 2BYJA 3N5MA 3QGUA 2JGTA 1SZKA 3PGYA 1AHGA 1H1CA 4W8IA 4Y0HA 2VMUA 2HP2A 1WYTB 1KMKA 1SF2A 1ZODA 4U1TA 1W7NA 4F4EA 4ADCA 1JG8A 3EZ1A 2VLFA 1CL1A 2FYFA 4WB0B 3ZRQA 1N31A 4AOAA 2VI8A 1D7RA 3FVUA 4Q75A 2YCTA 4K2BA 5EQCA 2CY8A 5EUDA 4A0FA 1AIBA 1TATA 1GEWA 2W8JA 3HMUA 4W5KA 4E1OA 3DODA 4JEYA 4MQPA 4MQQA 4Y0IA 3WZFA 3ELEA 5DJ9A 3EIBA 5F8VA 4P3MA 3BWOA 5J8QA 3KGXA 1PG8A 4WBTA 4IYOA 4BHDA 3FVXA 4W1XA 5F9SA 1BJOB 3I5TA 1UKJA 3VAXA 1IX7A 2NMPA 5EUNA 1WYVB 4WYEA 3GSBA 1EG5A 4CXQA 2QBTA 3JZLA 4RM1A 3R9AA 3FFHA 1ARTA 1E5FA 4IYOB 1S08A 2ZSMA 1GEYA 2WK8A 5DB5A 1ARGA 2CH1A 2FQ6A 2HP1A 3ISLA 3WCOA 4AZKA 3FSLA 4L0OA 4WLJA 1ARSA 3MEBA 4BA5A 3AEPA 1BS0A 1KMJA 5DX5A 2XBNA 2C44A 4UOYA 1ASBA 2V0YA 4OC9A 1AX4A 4WYAA 4ISYA 2CINA 4R8DA 1TOEA 1S09A 3W1JA 1B5OA 4IXSA 2VIAA 1WYUA 2AY8A 3AENA 5G2QA 5HDMA 5FT8A 1B9HA 1G4VA 3NUBA 1I41A 3NU7A 3PD6A 4ZDPA 4GRXA 2PO3A 1VEFA 1LC5A 1LW5A 3WKRA 4XJMA 2W8TA 2D64A 2O0RA 1AKCA 3FVSA 4MSOA 4OCAA 1ASLA 3NTJA 1C4KA 3NUIA 4XJLA 4CBRA 4GE4A 1WYUB 3GZCA 4A00A 1B8GA 1CL2A 2JISA 3KE3A 1M0PA 2YKXA 4TMRA 1G7WA 1MDXA 1IX6A 2JJEA 1FG7A 1XEYA 1AMQA 3FZ7A 2EO5A 2HOYA 3PDBA 1LW4A 1U08A 1C7NA 5E4ZA 1PFFA 1ASAA 1DTYA 1MLZA 4MGRA 1SZUA 3EI6A 4M2KA 1G4XA 1M0NA 3GR9A 5G09A 3K28A 1ASDA 2OGEA 1B4XA 3LVMA 3F6TA 3VOMA 4WXGA 2BIEA 2VMPA 4H51A 2HOZA 3B1CA 4WP0A 3PDBB 1N8PA 3WGCA 4W1WA 2BI3A 2VGWA 2VGUA 2OQXA 2PB2A 1GC2A 1I48A 2X5FA 3ZRRA 1ECXA 1DJUA 4ITGA 3AEOA 3BWNC 3WY7A 3GZDA 4MQRA 3R4TA 4HVKA 1S07A 2CH2A 2W7FA 2BHXA 2D63A 2YHKA 3JWAA 2E54A 2BWPA 5HXXA 3DR4A 1TOKA 4M2JA 1ASNA 3AEJA 1GC4A 2CSTA 4A6RA 3VK3A 3LVKA 1O62A 4Q76A 1DJEA 4F5MA 1EJIA 1M7YA 2AY5A 4HF8A 1AY4A 2EZ2A 4ITXA 1Y4IA 3W1HA 4FFCA 2HUFA 3GETA 1ZC9A 1WKHA 1MLYA 3FQAA 4M2MA 4W91A 2GMUA 2W7EA 5FT4A 3AATA 4ZDOA 3ECDA 1Z3ZA 3RCHA 1GD9A 2ZY5A 2YKYA 3K7YA 2YRRA 3NYTA 2TPLA 1CZCA 4UHOA 1LK9A 3NU8A 1D7VA 1UU1A 2JG2A 3F9TA 4RITA 5JAYA 2FM1A 3RBFA 3JU7A 2F8JA 2HOXA 2V1PA 1AJRA 3P1TA 3JTXA 2ZC0A 3FDDA 4N0BA 3TCMA 4OT8A 1QJ5A 1M4NA 3TATA 4R2NA 3RI6A 3T32A 3BV0A 1MAPA 2VLHA 3IHJA 4DBCA 1IAXA 2QLRA 3GWPA 1D7SA 2ZY4A 2AY4A 1LS3A 1TOJA 1MGVA 1OHWA 4A0GA 1ASGA 2FN6A 2GQNA 1AHFA 1BW0A 1QISA 2CFBA 4UHNA 4LNJA 4UQVA 3AEMA 3ZRPA 1CZEA 3AELA 4PFFA 1BJOA 4JE5A 4WD2A 2VMWA 3H14A 4RKDA 1AY8A 2BI2A 5M46A 1TOGA 1YOOA 2CJGA 3GZDC 1WYVA 5E3KA 3WX9A 4BMKA 4JE5D 2W7MA 3NYSA 3LY1A 3LWSA 4LW4A 3B46A 1VJOA 4F5LA 1J32A 3AEJC 1Z7DA 2VMSA 4IX8A 4K2MA 2Z67A 4WYCA 1WSTA 2Z1YA 3ATHA 4QGRA 2OATA 4MKJA 3CAIA 4EMYA 3PJ0A 4R5FA 1IUGA 1CQ6A 3ACZA 2G6WA 3EI8A 1AMRA 1SPAA 3MC6A 5FT6A 1V2DA 2D7ZA 1GBNA 3L8AA 1AHEA 1GC0A 1M6SA 4F5HA 2VYCA 1AJSA 4IW7A 3AV7A 4XJPA 3BCBA 1UU0A 3A8UX 2W7KA 1GDEA 3FCRA 4PFNA 3B1EA 4UHMA 3PA9A 3WKSA 1UU2A 3E77A 2W7GA 1KKJA 1JS6A 3H7FA 2FNUA 3WCNA 1BJWA 4XEWA 4EU1A 1TARA 3LG0A 1AJSB 3W1IA 3FRKA 3N0LA 3HT4A 1G7XA 4I8AA 5LH9A 2ZP7A 1O69A 3GJUA 2R2NA
chains in the Genus database with same CATH superfamily
1GC3A 2CJHA 4RAEA 4TV7A 1DKAA 3CQ5A 1M0OA 3E9KA 1VP4A 4WXBA 4N0WA 1PMMA 3NNKA 1ELQA 3QBOA 4OTLA 1AKAA 4ZSWA 1OXOA 2BKWA 4ZWVA 1DJ9A 4E77A 4OYTA 4XJOA 2VGZA 3MKJA 4ZM3A 2VMVA 3E2YA 4XK1A 2D61A 5EUEA 2ZYJA 2VMYA 4JEXA 3BB8A 2DKJA 3FQ7A 2VMOA 3BCAA 2EZ1A 1GEXA 4A6TA 1KL1A 4NOGA 3MADA 2ZSLA 4KYOA 1ARHA 3ELPA 4F5JA 1C7GA 3DRDA 1QIRA 4Q6RA 1T3IA 1XI9A 4E3RA 1OHVA 1CS1A 3E2ZA 4OMAA 3OKSA 4J8LA 1JF9A 1ZOBA 4OBVA 2CANA 2EH6A 1BKGA 1BJ4A 2O1BA 2ORDA 1OXPA 4RJ0A 5D5SA 1CQ7A 2BI5A 2GB3A 3I4JA 2BYLA 5EAVA 3UWCA 4AZJA 2WK9A 4WLHA 2HUIA 1M0QA 4E3QA 4ZM4A 1QGNA 4LNMA 1AKBA 3G0TA 3E2ZB 2DOUA 3CQ6A 1RVYA 3VK4A 2W8WA 3EZSA 4B98A 2VMXA 1C9CA 3HQTA 1V2FA 4R5ZA 2CTZA 4KAMA 2C0RA 4PVFA 1AICA 3K40A 2YKUA 1AHYA 2BWOA 2YCNA 3PIUA 2X3LA 2AEVA 2DGLA 2CJDA 2W8VA 4FL0A 4GE9A 5DJ1A 3FZ6A 3DXVA 1BQDA 1N2TA 2PB0A 2BIGA 3FFRA 2AY9A 2JJFA 1IAYA 2E7JA 3PAAA 2X8UA 1D7UA 3EUCA 2W7LA 2ZUKA 4JF1A 2VMTA 1QZ9A 2AY6A 2QMAA 3P6KA 2DGKA 2CB1A 4DQ6A 3N4RA 4ZLVA 1X2AA 3DXWA 4ATPA 2JJGA 3RUYA 3I16A 1CQ8A 3MAUA 1YNUA 3KKIA 1IBJA 3WLXA 3PDXA 1OATA 5M49A 1YAAA 2AY7A 2HUUA 1P3WA 1B9IA 1C0NA 1ASCA 4JEWA 3USFA 4CXRA 3RBLA 2YRIA 3EI9A 3FKDA 3FZ8A 1AMAA 2Z9XA 3FTBA 2OKKA 3CBFA 3B1DA 2E7UA 3RQ1A 4JEZA 1RVUA 4GEBA 3LVLB 2BI9A 5EIGB 2WB6A 1I43A 4GDYA 2QB2A 3HLMA 2EYQA 2DKBA 2Z1ZA 4XAUA 2BI1A 3D6KA 2VMRA 1RV3A 1CJ0A 2D7YA 2VMNA 3AOWA 5TF5A 3Q8NA 4A0HA 3MAFB 3HL2A 2C7TA 3QPGA 2D65A 4CVQA 1W23A 3LV2A 1SFFA 4IXZA 4PIWA 1BQAA 1AY5A 3ZZKA 2HZPA 1V72A 1LC7A 1AMSA 2R5EA 2VMQA 5LHAA 1LC8A 1ASMA 5D95A 3N7NA 2VIBA 2EGYA 1B5PA 1GCKA 5G2PA 4EFFA 1H0CA 1JS3A 1AAMA 4RKCA 1TASA 4LW2A 3BC8A 4F5GA 3II0A 2AY2A 3NYUA 3QN6A 5E5IA 4XQ2A 2BWNA 1W7LA 5AX8A 3ASAA 4AO9A 4O6ZA 4CBSA 1IVRA 3B8XA 3F0HA 2E7IA 2VGSA 3NRAA 1YJZA 5EFSA 1OHYA 3FQ8A 4A6UA 2BIAA 3M5UA 2W7IA 2AY3A 1DGDA 1IJIA 1DGEA 3A9XA 3DYDA 4A0RA 5M4DA 3A2BA 3E2FA 1MDOA 4RJYA 2R5CA 4BA4A 2KFPA 3VK2A 5G4IA 3AEMC 1ARIA 1W3UA 2Z9WA 2Z9UA 3BWNA 4A72A 1FC4A 4IY7A 4TN4A 4P7YA 3EI7A 1MAQA 3VP6A 1D2FA 3EI5A 2QA3A 2W7HA 2GSAA 3TFUA 3OP7A 3WGBA 3FDBA 2Z9VA 4F5FA 4ZAHA 3AOVA 2XH1A 3UAKA 4JEVA 4F5KA 2R5CB 5M4BA 1W7MA 2D5YA 2Z61A 4AH3A 1O61A 3G8MA 5FT5A 3GBXA 2EPJA 2GMSA 5I92A 4WYGA 3CQ4A 3EIAA 9AATA 3BS8A 3FD0A 3A9YA 3PPLA 4WYDA 8AATA 4WXFA 3QM2A 2HORA 2QSRA 3KGWA 1RV4A 2ZY3A 4RLGA 3JW9A 3N75A 4IXOA 3TFTA 2C81A 1YJYA 2W7DA 2VMZA 3QHXA 3HVYA 2W7JA 4F5IA 5BJ4A 1E5EA 3MC6C 4RIZA 1X29A 2A1VA 1SVVA 3JWBA 4ZASA 2Z20A 2RFVA 1ORDA 1M32A 1ELUA 2VGTA 3AENB 1S0AA 2JJHA 2ZJGA 3E6GA 4WYFA 1LKCA 3PD6B 4K2IA 4W1VA 3HBXA 3L44A 3MBBA 2W8UA 3NX3A 4KXKA 2O7CA 4AO4A 5K8BA 4Q31A 4DGTA 4ADBA 1AIAA 4ZSYA 4EB7A 4Y0DA 3UE8A 1MDZA 3BN1A 3DR7A 1YIYA 4JF0A 2WKAA 1AAWA 1SZSA 1PMOA 1QITA 4OBUA 1QJ3A 5HHYA 4ADDA 1AHXA 2AEUA 1TPLA 2VGVA 3QI6A 5C6UA 2DGMA 1IX8A 2D66A 5G0AA 5IWQA 4LC3A 2X5DA 2R0TA 3DC1A 1EQBA 4U2HA 2ZY2A 1BT4A 2AATA 4ADEA 2OKJA 1KL2A 1WKGA 2DR1A 1YIZA 2VI9A 4ZWMA 3NDNA 1TOIA 2YCPA 3BCXA 4EB5A 1ASFA 3DU4A 5EAAA 1S06A 1X28A 5G4JA 3DZZA 4J5UA 4BQ0A 3A9ZA 2OGAA 1O4SA 3IF2A 5EIGA 1X0MA 1YJSA 3ZZJA 4ZDLA 1I29A 1V2EA 1ASEA 3G7QA 3ASBA 3HDOA 1C7OA 2Q7WA 2YKVA 2YOBA 2WK7A 4B9BA 2AY1A 1J04A 3MAFA 1BJNA 1FG3A 4K05A 1WYTA 3TQXA 4MY5A 4ATQA 2FNIA 3RCHB 2QB3A 7AATA 4LNLA 4WB0A 1KKPA 4GE7A 4GSAA 3COGA 5BJ3A 1DFOA 3LVJA 4MKKA 2BYJA 3N5MA 3QGUA 2JGTA 1SZKA 3PGYA 1AHGA 1H1CA 4W8IA 4Y0HA 2VMUA 2HP2A 1WYTB 1KMKA 1SF2A 1ZODA 4U1TA 1W7NA 4F4EA 4ADCA 1JG8A 3EZ1A 2VLFA 1CL1A 2FYFA 4WB0B 3ZRQA 1N31A 4AOAA 2VI8A 1D7RA 3FVUA 4Q75A 2YCTA 4K2BA 5EQCA 2CY8A 5EUDA 4A0FA 1AIBA 1TATA 1GEWA 2W8JA 3HMUA 4W5KA 4E1OA 3DODA 4JEYA 4MQPA 4MQQA 4Y0IA 3WZFA 3ELEA 5DJ9A 3EIBA 5F8VA 4P3MA 3BWOA 5J8QA 3KGXA 1PG8A 4WBTA 4IYOA 4BHDA 3FVXA 4W1XA 5F9SA 1BJOB 3I5TA 1UKJA 3VAXA 1IX7A 2NMPA 5EUNA 1WYVB 4WYEA 3GSBA 1EG5A 4CXQA 2QBTA 3JZLA 4RM1A 3R9AA 3FFHA 1ARTA 1E5FA 4IYOB 1S08A 2ZSMA 1GEYA 2WK8A 5DB5A 1ARGA 2CH1A 2FQ6A 2HP1A 3ISLA 3WCOA 4AZKA 3FSLA 4L0OA 4WLJA 1ARSA 3MEBA 4BA5A 3AEPA 5KTBA 1BS0A 1KMJA 5DX5A 2XBNA 2C44A 4UOYA 1ASBA 2V0YA 4OC9A 1AX4A 4WYAA 4ISYA 2CINA 4R8DA 1TOEA 1S09A 3W1JA 1B5OA 4IXSA 2VIAA 1WYUA 2AY8A 3AENA 5G2QA 5HDMA 5FT8A 1B9HA 1G4VA 3NUBA 1I41A 3NU7A 3PD6A 4ZDPA 4GRXA 2PO3A 1VEFA 1LC5A 1LW5A 3WKRA 4XJMA 2W8TA 2D64A 2O0RA 1AKCA 3FVSA 4MSOA 4OCAA 1ASLA 3NTJA 1C4KA 3NUIA 4XJLA 4CBRA 4GE4A 1WYUB 3GZCA 4A00A 1B8GA 1CL2A 2JISA 3KE3A 1M0PA 2YKXA 4TMRA 1G7WA 1MDXA 1IX6A 2JJEA 1FG7A 1XEYA 1AMQA 3FZ7A 2EO5A 2HOYA 3PDBA 1LW4A 1U08A 1C7NA 5E4ZA 1PFFA 1ASAA 1DTYA 1MLZA 4MGRA 1SZUA 3EI6A 4M2KA 1G4XA 1M0NA 3GR9A 5G09A 3K28A 1ASDA 2OGEA 1B4XA 3LVMA 3F6TA 3VOMA 4WXGA 2BIEA 2VMPA 4H51A 2HOZA 3B1CA 4WP0A 3PDBB 1N8PA 3WGCA 4W1WA 2BI3A 2VGWA 2VGUA 2OQXA 2PB2A 1GC2A 1I48A 2X5FA 3ZRRA 1ECXA 1DJUA 4ITGA 3AEOA 3BWNC 3WY7A 3GZDA 4MQRA 3R4TA 4HVKA 1S07A 2CH2A 2W7FA 2BHXA 2D63A 2YHKA 3JWAA 2E54A 2BWPA 5HXXA 3DR4A 1TOKA 4M2JA 1ASNA 3AEJA 1GC4A 2CSTA 4A6RA 3VK3A 3LVKA 1O62A 4Q76A 1DJEA 4F5MA 1EJIA 1M7YA 2AY5A 4HF8A 1AY4A 2G7JA 2EZ2A 4ITXA 1Y4IA 3W1HA 4FFCA 2HUFA 3GETA 1ZC9A 1WKHA 1MLYA 3FQAA 4M2MA 4W91A 2GMUA 2W7EA 5FT4A 3AATA 4ZDOA 3ECDA 1Z3ZA 3RCHA 3H9XA 1GD9A 1KAFA 2ZY5A 2YKYA 3K7YA 2YRRA 3NYTA 2TPLA 1CZCA 4UHOA 1LK9A 3NU8A 1D7VA 1UU1A 2JG2A 3F9TA 4RITA 5JAYA 2FKIA 2FM1A 3RBFA 3JU7A 2F8JA 2HOXA 2V1PA 1AJRA 3P1TA 3JTXA 2ZC0A 3FDDA 3N4XA 4N0BA 3TCMA 4OT8A 1QJ5A 1M4NA 3TATA 4R2NA 3RI6A 3T32A 3BV0A 1MAPA 2VLHA 3IHJA 4DBCA 1IAXA 2QLRA 3GWPA 1D7SA 2ZY4A 2AY4A 1LS3A 1TOJA 1MGVA 1OHWA 4A0GA 1ASGA 2FN6A 2GQNA 1AHFA 1BW0A 1QISA 2CFBA 4UHNA 4LNJA 4UQVA 3AEMA 3ZRPA 1CZEA 3AELA 4PFFA 1BJOA 4JE5A 4WD2A 2VMWA 3H14A 4RKDA 1AY8A 2BI2A 5M46A 1TOGA 1YOOA 2CJGA 3GZDC 1WYVA 5E3KA 3WX9A 4BMKA 4JE5D 2W7MA 3NYSA 3LY1A 3LWSA 4LW4A 3B46A 1VJOA 4F5LA 1J32A 3AEJC 1Z7DA 2VMSA 4IX8A 3N4SA 4K2MA 2Z67A 4WYCA 1WSTA 4H63Q 2Z1YA 3ATHA 4QGRA 2OATA 4MKJA 3CAIA 4EMYA 3PJ0A 4R5FA 1IUGA 1CQ6A 3ACZA 2G6WA 3EI8A 1AMRA 1SPAA 3MC6A 5FT6A 1V2DA 2D7ZA 1GBNA 3L8AA 1AHEA 1GC0A 1M6SA 4F5HA 2VYCA 1AJSA 4IW7A 3AV7A 4XJPA 3BCBA 1UU0A 3A8UX 2W7KA 1GDEA 3FCRA 4PFNA 3B1EA 4UHMA 3PA9A 3WKSA 1UU2A 3E77A 2W7GA 1KKJA 1JS6A 3H7FA 2FNUA 3WCNA 1BJWA 4XEWA 4EU1A 1TARA 3LG0A 1AJSB 3W1IA 3FRKA 3N0LA 3HT4A 1G7XA 4I8AA 5LH9A 2ZP7A 1O69A 3GJUA 2R2NA
chains in the Genus database with same CATH topology
1GC3A 2CJHA 4RAEA 4TV7A 1DKAA 3CQ5A 1M0OA 3E9KA 1VP4A 4WXBA 4N0WA 1PMMA 3NNKA 1ELQA 3QBOA 4OTLA 1AKAA 4ZSWA 1OXOA 2BKWA 4ZWVA 1DJ9A 4E77A 4OYTA 4XJOA 2VGZA 3MKJA 4ZM3A 2VMVA 3E2YA 4XK1A 2D61A 5EUEA 2ZYJA 2VMYA 4JEXA 3BB8A 2DKJA 3FQ7A 2VMOA 3BCAA 2EZ1A 1GEXA 4A6TA 1KL1A 4NOGA 3MADA 2ZSLA 4KYOA 1ARHA 3ELPA 4F5JA 1C7GA 3DRDA 1QIRA 4Q6RA 1T3IA 1XI9A 4E3RA 1OHVA 1CS1A 3E2ZA 4OMAA 3OKSA 4J8LA 1JF9A 1ZOBA 4OBVA 2CANA 2EH6A 1BKGA 1BJ4A 2O1BA 2ORDA 1OXPA 4RJ0A 5D5SA 1CQ7A 2BI5A 2GB3A 3I4JA 2BYLA 5EAVA 3UWCA 4AZJA 2WK9A 4WLHA 2HUIA 1M0QA 4E3QA 4ZM4A 1QGNA 4LNMA 1AKBA 3G0TA 3E2ZB 2DOUA 3CQ6A 1RVYA 3VK4A 2W8WA 3EZSA 4B98A 2VMXA 1C9CA 3HQTA 1V2FA 4R5ZA 2CTZA 4KAMA 2C0RA 4PVFA 1AICA 3K40A 2YKUA 1AHYA 2BWOA 2YCNA 3PIUA 2X3LA 2AEVA 2DGLA 2CJDA 2W8VA 4FL0A 4GE9A 5DJ1A 3FZ6A 3DXVA 1BQDA 1N2TA 2PB0A 2BIGA 3FFRA 2AY9A 2JJFA 1IAYA 2E7JA 3PAAA 2X8UA 1D7UA 3EUCA 2W7LA 2ZUKA 4JF1A 2VMTA 1QZ9A 2AY6A 2QMAA 3P6KA 2DGKA 2CB1A 4DQ6A 3N4RA 4ZLVA 1X2AA 3DXWA 4ATPA 2JJGA 3RUYA 3I16A 1CQ8A 3MAUA 1YNUA 3KKIA 1IBJA 3WLXA 3PDXA 1OATA 5M49A 1YAAA 2AY7A 2HUUA 1P3WA 1B9IA 1C0NA 1ASCA 4JEWA 3USFA 4CXRA 3RBLA 2YRIA 3EI9A 3FKDA 3FZ8A 1AMAA 2Z9XA 3FTBA 2OKKA 3CBFA 3B1DA 2E7UA 3RQ1A 4JEZA 1RVUA 4GEBA 3LVLB 2BI9A 5EIGB 2WB6A 1I43A 4GDYA 2QB2A 3HLMA 2EYQA 2DKBA 2Z1ZA 4XAUA 2BI1A 3D6KA 2VMRA 1RV3A 1CJ0A 2D7YA 2VMNA 3AOWA 5TF5A 3Q8NA 4A0HA 3MAFB 3HL2A 2C7TA 3QPGA 2D65A 4CVQA 1W23A 3LV2A 1SFFA 4IXZA 4PIWA 1BQAA 1AY5A 3ZZKA 2HZPA 1V72A 1LC7A 1AMSA 2R5EA 2VMQA 5LHAA 1LC8A 1ASMA 5D95A 3N7NA 2VIBA 2EGYA 1B5PA 1GCKA 5G2PA 4EFFA 1H0CA 1JS3A 1AAMA 4RKCA 1TASA 4LW2A 3BC8A 4F5GA 3II0A 2AY2A 3NYUA 3QN6A 5E5IA 4XQ2A 2BWNA 1W7LA 5AX8A 3ASAA 4AO9A 4O6ZA 4CBSA 1IVRA 3B8XA 3F0HA 2E7IA 2VGSA 3NRAA 1YJZA 5EFSA 1OHYA 3FQ8A 4A6UA 2BIAA 3M5UA 2W7IA 2AY3A 1DGDA 1IJIA 1DGEA 3A9XA 3DYDA 4A0RA 5M4DA 3A2BA 3E2FA 1MDOA 4RJYA 2R5CA 4BA4A 2KFPA 3VK2A 5G4IA 3AEMC 1ARIA 1W3UA 2Z9WA 2Z9UA 3BWNA 4A72A 1FC4A 4IY7A 4TN4A 4P7YA 3EI7A 1MAQA 3VP6A 1D2FA 3EI5A 2QA3A 2W7HA 2GSAA 3TFUA 3OP7A 3WGBA 3FDBA 2Z9VA 4F5FA 4ZAHA 3AOVA 2XH1A 3UAKA 4JEVA 4F5KA 2R5CB 5M4BA 1W7MA 2D5YA 2Z61A 4AH3A 1O61A 3G8MA 5FT5A 3GBXA 2EPJA 2GMSA 5I92A 4WYGA 3CQ4A 3EIAA 9AATA 3BS8A 3FD0A 3A9YA 3PPLA 4WYDA 8AATA 4WXFA 3QM2A 2HORA 2QSRA 3KGWA 1RV4A 2ZY3A 4RLGA 3JW9A 3N75A 4IXOA 3TFTA 2C81A 1YJYA 2W7DA 2VMZA 3QHXA 3HVYA 2W7JA 4F5IA 5BJ4A 1E5EA 3MC6C 4RIZA 1X29A 2A1VA 1SVVA 3JWBA 4ZASA 2Z20A 2RFVA 1ORDA 1M32A 1ELUA 2VGTA 3AENB 1S0AA 2JJHA 2ZJGA 3E6GA 4WYFA 1LKCA 3PD6B 4K2IA 4W1VA 3HBXA 3L44A 3MBBA 2W8UA 3NX3A 4KXKA 2O7CA 4AO4A 5K8BA 4Q31A 4DGTA 4ADBA 1AIAA 4ZSYA 4EB7A 4Y0DA 3UE8A 1MDZA 3BN1A 3DR7A 1YIYA 4JF0A 2WKAA 1AAWA 1SZSA 1PMOA 1QITA 4OBUA 1QJ3A 5HHYA 4ADDA 1AHXA 2AEUA 1TPLA 2VGVA 3QI6A 5C6UA 2DGMA 1IX8A 2D66A 5G0AA 5IWQA 4LC3A 2X5DA 2R0TA 3DC1A 1EQBA 4U2HA 2ZY2A 1BT4A 2AATA 4ADEA 2OKJA 1KL2A 1WKGA 2DR1A 1YIZA 2VI9A 4ZWMA 3NDNA 1TOIA 2YCPA 3BCXA 4EB5A 1ASFA 3DU4A 5EAAA 1S06A 1X28A 5G4JA 3DZZA 4J5UA 4BQ0A 3A9ZA 2OGAA 1O4SA 3IF2A 5EIGA 1X0MA 1YJSA 3ZZJA 4ZDLA 1I29A 1V2EA 1ASEA 3G7QA 3ASBA 3HDOA 1C7OA 2Q7WA 2YKVA 2YOBA 2WK7A 4B9BA 2AY1A 1J04A 3MAFA 1BJNA 1FG3A 4K05A 1WYTA 3TQXA 4MY5A 4ATQA 2FNIA 3RCHB 2QB3A 7AATA 4LNLA 4WB0A 1KKPA 4GE7A 4GSAA 3COGA 5BJ3A 1DFOA 3LVJA 4MKKA 2BYJA 3N5MA 3QGUA 2JGTA 1SZKA 3PGYA 1AHGA 1H1CA 4W8IA 4Y0HA 2VMUA 2HP2A 1WYTB 1KMKA 1SF2A 1ZODA 4U1TA 1W7NA 4F4EA 4ADCA 1JG8A 3EZ1A 2VLFA 1CL1A 2FYFA 4WB0B 3ZRQA 1N31A 4AOAA 2VI8A 1D7RA 3FVUA 4Q75A 2YCTA 4K2BA 5EQCA 2CY8A 5EUDA 4A0FA 1AIBA 1TATA 1GEWA 2W8JA 3HMUA 4W5KA 4E1OA 3DODA 4JEYA 4MQPA 4MQQA 4Y0IA 3WZFA 3ELEA 5DJ9A 3EIBA 5F8VA 4P3MA 3BWOA 5J8QA 3KGXA 1PG8A 4WBTA 4IYOA 4BHDA 3FVXA 4W1XA 5F9SA 1BJOB 3I5TA 1UKJA 3VAXA 1IX7A 2NMPA 5EUNA 1WYVB 4WYEA 3GSBA 1EG5A 4CXQA 2QBTA 3JZLA 4RM1A 3R9AA 3FFHA 1ARTA 1E5FA 4IYOB 1S08A 2ZSMA 1GEYA 2WK8A 5DB5A 1ARGA 2CH1A 2FQ6A 2HP1A 3ISLA 3WCOA 4AZKA 3FSLA 4L0OA 4WLJA 1ARSA 3MEBA 4BA5A 3AEPA 5KTBA 1BS0A 1KMJA 5DX5A 2XBNA 2C44A 4UOYA 1ASBA 2V0YA 4OC9A 1AX4A 4WYAA 4ISYA 2CINA 4R8DA 1TOEA 1S09A 3W1JA 1B5OA 4IXSA 2VIAA 1WYUA 2AY8A 3AENA 5G2QA 5HDMA 5FT8A 1B9HA 1G4VA 3NUBA 1I41A 3NU7A 3PD6A 4ZDPA 4GRXA 2PO3A 1VEFA 1LC5A 1LW5A 3WKRA 4XJMA 2W8TA 2D64A 2O0RA 1AKCA 3FVSA 4MSOA 4OCAA 1ASLA 3NTJA 1C4KA 3NUIA 4XJLA 4CBRA 4GE4A 1WYUB 3GZCA 4A00A 1B8GA 1CL2A 2JISA 3KE3A 1M0PA 2YKXA 4TMRA 1G7WA 1MDXA 1IX6A 2JJEA 1FG7A 1XEYA 1AMQA 3FZ7A 2EO5A 2HOYA 3PDBA 1LW4A 1U08A 1C7NA 5E4ZA 1PFFA 1ASAA 1DTYA 1MLZA 4MGRA 1SZUA 3EI6A 4M2KA 1G4XA 1M0NA 3GR9A 5G09A 3K28A 1ASDA 2OGEA 1B4XA 3LVMA 3F6TA 3VOMA 4WXGA 2BIEA 2VMPA 4H51A 2HOZA 3B1CA 4WP0A 3PDBB 1N8PA 3WGCA 4W1WA 2BI3A 2VGWA 2VGUA 2OQXA 2PB2A 1GC2A 1I48A 2X5FA 3ZRRA 1ECXA 1DJUA 4ITGA 3AEOA 3BWNC 3WY7A 3GZDA 4MQRA 3R4TA 4HVKA 1S07A 2CH2A 2W7FA 2BHXA 2D63A 2YHKA 3JWAA 2E54A 2BWPA 5HXXA 3DR4A 1TOKA 4M2JA 1ASNA 3AEJA 1GC4A 2CSTA 4A6RA 3VK3A 3LVKA 1O62A 4Q76A 1DJEA 4F5MA 1EJIA 1M7YA 2AY5A 4HF8A 1AY4A 2G7JA 2EZ2A 4ITXA 1Y4IA 3W1HA 4FFCA 2HUFA 3GETA 1ZC9A 1WKHA 1MLYA 3FQAA 4M2MA 4W91A 2GMUA 2W7EA 5FT4A 3AATA 4ZDOA 3ECDA 1Z3ZA 3RCHA 3H9XA 1GD9A 2ZY5A 2YKYA 3K7YA 2YRRA 3NYTA 2TPLA 1CZCA 4UHOA 1LK9A 3NU8A 1D7VA 1UU1A 2JG2A 3F9TA 4RITA 5JAYA 2FKIA 2FM1A 3RBFA 3JU7A 2F8JA 2HOXA 2V1PA 1AJRA 3P1TA 3JTXA 2ZC0A 3FDDA 3N4XA 4N0BA 3TCMA 4OT8A 1QJ5A 1M4NA 3TATA 4R2NA 3RI6A 3T32A 3BV0A 1MAPA 2VLHA 3IHJA 4DBCA 1IAXA 2QLRA 3GWPA 1D7SA 2ZY4A 2AY4A 1LS3A 1TOJA 1MGVA 1OHWA 4A0GA 1ASGA 2FN6A 2GQNA 1AHFA 1BW0A 1QISA 2CFBA 4UHNA 4LNJA 4UQVA 3AEMA 3ZRPA 1CZEA 3AELA 4PFFA 1BJOA 4JE5A 4WD2A 2VMWA 3H14A 4RKDA 1AY8A 2BI2A 5M46A 1TOGA 1YOOA 2CJGA 3GZDC 1WYVA 5E3KA 3WX9A 4BMKA 4JE5D 2W7MA 3NYSA 3LY1A 3LWSA 4LW4A 3B46A 1VJOA 4F5LA 1J32A 3AEJC 1Z7DA 2VMSA 4IX8A 3N4SA 4K2MA 2Z67A 4WYCA 1WSTA 4H63Q 2Z1YA 3ATHA 4QGRA 2OATA 4MKJA 3CAIA 4EMYA 3PJ0A 4R5FA 1IUGA 1CQ6A 3ACZA 2G6WA 3EI8A 1AMRA 1SPAA 3MC6A 5FT6A 1V2DA 2D7ZA 1GBNA 3L8AA 1AHEA 1GC0A 1M6SA 4F5HA 2VYCA 1AJSA 4IW7A 3AV7A 4XJPA 3BCBA 1UU0A 3A8UX 2W7KA 1GDEA 3FCRA 4PFNA 3B1EA 4UHMA 3PA9A 3WKSA 1UU2A 3E77A 2W7GA 1KKJA 1JS6A 3H7FA 2FNUA 3WCNA 1BJWA 4XEWA 4EU1A 1TARA 3LG0A 1AJSB 3W1IA 3FRKA 3N0LA 3HT4A 1G7XA 4I8AA 5LH9A 2ZP7A 1O69A 3GJUA 2R2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC3 A;  2CJH A;  4RAE A;  4TV7 A;  1DKA A;  3CQ5 A;  1M0O A;  3E9K A;  1VP4 A;  4WXB A;  4N0W A;  1PMM A;  3NNK A;  1ELQ A;  3QBO A;  4OTL A;  1AKA A;  4ZSW A;  1OXO A;  2BKW A;  4ZWV A;  1DJ9 A;  4E77 A;  4OYT A;  4XJO A;  2VGZ A;  3MKJ A;  4ZM3 A;  2VMV A;  3E2Y A;  4XK1 A;  2D61 A;  5EUE A;  2ZYJ A;  2VMY A;  4JEX A;  3BB8 A;  2DKJ A;  3FQ7 A;  2VMO A;  3BCA A;  2EZ1 A;  1GEX A;  4A6T A;  1KL1 A;  4NOG A;  3MAD A;  2ZSL A;  4KYO A;  1ARH A;  3ELP A;  4F5J A;  1C7G A;  3DRD A;  1QIR A;  4Q6R A;  1T3I A;  1XI9 A;  4E3R A;  1OHV A;  1CS1 A;  3E2Z A;  4OMA A;  3OKS A;  4J8L A;  1JF9 A;  1ZOB A;  4OBV A;  2CAN A;  2EH6 A;  1BKG A;  1BJ4 A;  2O1B A;  2ORD A;  1OXP A;  4RJ0 A;  5D5S A;  1CQ7 A;  2BI5 A;  2GB3 A;  3I4J A;  2BYL A;  5EAV A;  3UWC A;  4AZJ A;  2WK9 A;  4WLH A;  2HUI A;  1M0Q A;  4E3Q A;  4ZM4 A;  1QGN A;  4LNM A;  1AKB A;  3G0T A;  3E2Z B;  2DOU A;  3CQ6 A;  1RVY A;  3VK4 A;  2W8W A;  3EZS A;  4B98 A;  2VMX A;  1C9C A;  3HQT A;  1V2F A;  4R5Z A;  2CTZ A;  4KAM A;  2C0R A;  4PVF A;  1AIC A;  3K40 A;  2YKU A;  1AHY A;  2BWO A;  2YCN A;  3PIU A;  2X3L A;  2AEV A;  2DGL A;  2CJD A;  2W8V A;  4FL0 A;  4GE9 A;  5DJ1 A;  3FZ6 A;  3DXV A;  1BQD A;  1N2T A;  2PB0 A;  2BIG A;  3FFR A;  2AY9 A;  2JJF A;  1IAY A;  2E7J A;  3PAA A;  2X8U A;  1D7U A;  3EUC A;  2W7L A;  2ZUK A;  4JF1 A;  2VMT A;  1QZ9 A;  2AY6 A;  2QMA A;  3P6K A;  2DGK A;  2CB1 A;  4DQ6 A;  4ZLV A;  1X2A A;  3DXW A;  4ATP A;  2JJG A;  3RUY A;  3I16 A;  1CQ8 A;  3MAU A;  1YNU A;  3KKI A;  1IBJ A;  3WLX A;  3PDX A;  1OAT A;  5M49 A;  1YAA A;  2AY7 A;  2HUU A;  1P3W A;  1B9I A;  1C0N A;  1ASC A;  4JEW A;  3USF A;  4CXR A;  3RBL A;  2YRI A;  3EI9 A;  3FKD A;  3FZ8 A;  1AMA A;  2Z9X A;  3FTB A;  2OKK A;  3CBF A;  3B1D A;  2E7U A;  3RQ1 A;  4JEZ A;  1RVU A;  4GEB A;  3LVL B;  2BI9 A;  5EIG B;  1I43 A;  4GDY A;  2QB2 A;  3HLM A;  2DKB A;  2Z1Z A;  4XAU A;  2BI1 A;  3D6K A;  2VMR A;  1RV3 A;  1CJ0 A;  2D7Y A;  2VMN A;  3AOW A;  5TF5 A;  3Q8N A;  4A0H A;  3MAF B;  3HL2 A;  2C7T A;  3QPG A;  2D65 A;  4CVQ A;  1W23 A;  3LV2 A;  1SFF A;  4IXZ A;  4PIW A;  1BQA A;  1AY5 A;  3ZZK A;  2HZP A;  1V72 A;  1LC7 A;  1AMS A;  2R5E A;  2VMQ A;  5LHA A;  1LC8 A;  1ASM A;  5D95 A;  2VIB A;  2EGY A;  1B5P A;  1GCK A;  5G2P A;  4EFF A;  1H0C A;  1JS3 A;  1AAM A;  4RKC A;  1TAS A;  4LW2 A;  3BC8 A;  4F5G A;  3II0 A;  2AY2 A;  3NYU A;  3QN6 A;  5E5I A;  4XQ2 A;  2BWN A;  1W7L A;  5AX8 A;  3ASA A;  4AO9 A;  4O6Z A;  4CBS A;  1IVR A;  3B8X A;  3F0H A;  2E7I A;  2VGS A;  3NRA A;  1YJZ A;  5EFS A;  1OHY A;  3FQ8 A;  4A6U A;  2BIA A;  3M5U A;  2W7I A;  2AY3 A;  1DGD A;  1IJI A;  1DGE A;  3A9X A;  3DYD A;  4A0R A;  5M4D A;  3A2B A;  3E2F A;  1MDO A;  4RJY A;  2R5C A;  4BA4 A;  3VK2 A;  5G4I A;  3AEM C;  1ARI A;  1W3U A;  2Z9W A;  2Z9U A;  3BWN A;  4A72 A;  1FC4 A;  4IY7 A;  4TN4 A;  4P7Y A;  3EI7 A;  1MAQ A;  3VP6 A;  1D2F A;  3EI5 A;  2QA3 A;  2W7H A;  2GSA A;  3TFU A;  3OP7 A;  3WGB A;  3FDB A;  2Z9V A;  4F5F A;  4ZAH A;  3AOV A;  2XH1 A;  3UAK A;  4JEV A;  4F5K A;  2R5C B;  5M4B A;  1W7M A;  2D5Y A;  2Z61 A;  4AH3 A;  1O61 A;  3G8M A;  5FT5 A;  3GBX A;  2EPJ A;  2GMS A;  5I92 A;  4WYG A;  3CQ4 A;  3EIA A;  9AAT A;  3BS8 A;  3FD0 A;  3A9Y A;  3PPL A;  4WYD A;  8AAT A;  4WXF A;  3QM2 A;  2HOR A;  2ZY3 A;  3KGW A;  1RV4 A;  4RLG A;  3JW9 A;  3N75 A;  4IXO A;  3TFT A;  2C81 A;  1YJY A;  2W7D A;  2VMZ A;  3QHX A;  3HVY A;  2W7J A;  4F5I A;  5BJ4 A;  1E5E A;  3MC6 C;  4RIZ A;  1X29 A;  1SVV A;  3JWB A;  4ZAS A;  2Z20 A;  2RFV A;  1ORD A;  1M32 A;  1ELU A;  2VGT A;  3AEN B;  1S0A A;  2JJH A;  2ZJG A;  3E6G A;  4WYF A;  1LKC A;  3PD6 B;  4K2I A;  4W1V A;  3HBX A;  3L44 A;  3MBB A;  2W8U A;  3NX3 A;  4KXK A;  2O7C A;  4AO4 A;  5K8B A;  4Q31 A;  4DGT A;  4ADB A;  1AIA A;  4ZSY A;  4EB7 A;  4Y0D A;  3UE8 A;  1MDZ A;  3BN1 A;  3DR7 A;  1YIY A;  4JF0 A;  2WKA A;  1AAW A;  1SZS A;  1PMO A;  1QIT A;  4OBU A;  1QJ3 A;  5HHY A;  4ADD A;  1AHX A;  2AEU A;  1TPL A;  2VGV A;  3QI6 A;  5C6U A;  2DGM A;  1IX8 A;  2D66 A;  5G0A A;  5IWQ A;  4LC3 A;  2X5D A;  2R0T A;  3DC1 A;  1EQB A;  4U2H A;  2ZY2 A;  1BT4 A;  2AAT A;  4ADE A;  2OKJ A;  1KL2 A;  1WKG A;  2DR1 A;  1YIZ A;  2VI9 A;  4ZWM A;  3NDN A;  1TOI A;  2YCP A;  3BCX A;  4EB5 A;  1ASF A;  3DU4 A;  5EAA A;  1S06 A;  1X28 A;  5G4J A;  3DZZ A;  4J5U A;  4BQ0 A;  3A9Z A;  2OGA A;  1O4S A;  3IF2 A;  5EIG A;  1X0M A;  1YJS A;  3ZZJ A;  4ZDL A;  1I29 A;  1V2E A;  1ASE A;  3G7Q A;  3ASB A;  3HDO A;  1C7O A;  2Q7W A;  2YKV A;  2YOB A;  2WK7 A;  4B9B A;  2AY1 A;  1J04 A;  3MAF A;  1BJN A;  1FG3 A;  1WYT A;  3TQX A;  4MY5 A;  4ATQ A;  2FNI A;  3RCH B;  2QB3 A;  7AAT A;  4LNL A;  4WB0 A;  1KKP A;  4GE7 A;  4GSA A;  3COG A;  5BJ3 A;  1DFO A;  3LVJ A;  4MKK A;  2BYJ A;  3N5M A;  3QGU A;  2JGT A;  1SZK A;  3PGY A;  1AHG A;  1H1C A;  4W8I A;  4Y0H A;  2VMU A;  2HP2 A;  1WYT B;  1KMK A;  1SF2 A;  1ZOD A;  4U1T A;  1W7N A;  4F4E A;  4ADC A;  1JG8 A;  3EZ1 A;  2VLF A;  1CL1 A;  2FYF A;  4WB0 B;  3ZRQ A;  1N31 A;  4AOA A;  2VI8 A;  1D7R A;  3FVU A;  4Q75 A;  2YCT A;  4K2B A;  5EQC A;  2CY8 A;  5EUD A;  4A0F A;  1AIB A;  1TAT A;  1GEW A;  2W8J A;  3HMU A;  4W5K A;  4E1O A;  3DOD A;  4JEY A;  4MQP A;  4MQQ A;  4Y0I A;  3WZF A;  3ELE A;  5DJ9 A;  3EIB A;  5F8V A;  4P3M A;  3BWO A;  5J8Q A;  3KGX A;  1PG8 A;  4WBT A;  4IYO A;  4BHD A;  3FVX A;  4W1X A;  5F9S A;  1BJO B;  3I5T A;  1UKJ A;  3VAX A;  1IX7 A;  2NMP A;  5EUN A;  1WYV B;  4WYE A;  3GSB A;  1EG5 A;  4CXQ A;  2QBT A;  3JZL A;  4RM1 A;  3R9A A;  3FFH A;  1ART A;  1E5F A;  4IYO B;  1S08 A;  2ZSM A;  1GEY A;  2WK8 A;  5DB5 A;  1ARG A;  2CH1 A;  2FQ6 A;  2HP1 A;  3ISL A;  3WCO A;  4AZK A;  3FSL A;  4L0O A;  4WLJ A;  1ARS A;  3MEB A;  4BA5 A;  3AEP A;  1BS0 A;  1KMJ A;  5DX5 A;  2XBN A;  2C44 A;  4UOY A;  1ASB A;  2V0Y A;  4OC9 A;  1AX4 A;  4WYA A;  4ISY A;  2CIN A;  4R8D A;  1TOE A;  1S09 A;  3W1J A;  1B5O A;  4IXS A;  2VIA A;  1WYU A;  2AY8 A;  3AEN A;  5G2Q A;  5HDM A;  5FT8 A;  1B9H A;  1G4V A;  3NUB A;  1I41 A;  3NU7 A;  3PD6 A;  4ZDP A;  4GRX A;  2PO3 A;  1VEF A;  1LC5 A;  1LW5 A;  3WKR A;  4XJM A;  2W8T A;  2D64 A;  2O0R A;  1AKC A;  3FVS A;  4MSO A;  4OCA A;  1ASL A;  3NTJ A;  1C4K A;  3NUI A;  4XJL A;  4CBR A;  4GE4 A;  1WYU B;  3GZC A;  4A00 A;  1B8G A;  1CL2 A;  2JIS A;  3KE3 A;  1M0P A;  2YKX A;  4TMR A;  1G7W A;  1MDX A;  1IX6 A;  2JJE A;  1FG7 A;  1XEY A;  1AMQ A;  3FZ7 A;  2EO5 A;  2HOY A;  3PDB A;  1LW4 A;  1U08 A;  1C7N A;  5E4Z A;  1PFF A;  1ASA A;  1DTY A;  1MLZ A;  4MGR A;  1SZU A;  3EI6 A;  4M2K A;  1G4X A;  1M0N A;  3GR9 A;  5G09 A;  3K28 A;  1ASD A;  2OGE A;  1B4X A;  3LVM A;  3F6T A;  3VOM A;  4WXG A;  2BIE A;  2VMP A;  4H51 A;  2HOZ A;  3B1C A;  4WP0 A;  3PDB B;  1N8P A;  3WGC A;  4W1W A;  2BI3 A;  2VGW A;  2VGU A;  2OQX A;  2PB2 A;  1GC2 A;  1I48 A;  2X5F A;  3ZRR A;  1ECX A;  1DJU A;  4ITG A;  3AEO A;  3BWN C;  3WY7 A;  3GZD A;  4MQR A;  3R4T A;  4HVK A;  1S07 A;  2CH2 A;  2W7F A;  2BHX A;  2D63 A;  2YHK A;  3JWA A;  2E54 A;  2BWP A;  5HXX A;  3DR4 A;  1TOK A;  4M2J A;  1ASN A;  3AEJ A;  1GC4 A;  2CST A;  4A6R A;  3VK3 A;  3LVK A;  1O62 A;  4Q76 A;  1DJE A;  4F5M A;  1EJI A;  1M7Y A;  2AY5 A;  4HF8 A;  1AY4 A;  2EZ2 A;  4ITX A;  1Y4I A;  3W1H A;  4FFC A;  2HUF A;  3GET A;  1ZC9 A;  1WKH A;  1MLY A;  3FQA A;  4M2M A;  4W91 A;  2GMU A;  2W7E A;  5FT4 A;  3AAT A;  4ZDO A;  3ECD A;  1Z3Z A;  3RCH A;  1GD9 A;  2ZY5 A;  2YKY A;  3K7Y A;  2YRR A;  3NYT A;  2TPL A;  1CZC A;  4UHO A;  1LK9 A;  3NU8 A;  1D7V A;  1UU1 A;  2JG2 A;  3F9T A;  4RIT A;  5JAY A;  2FM1 A;  3RBF A;  3JU7 A;  2F8J A;  2HOX A;  2V1P A;  1AJR A;  3P1T A;  3JTX A;  2ZC0 A;  3FDD A;  4N0B A;  3TCM A;  4OT8 A;  1QJ5 A;  1M4N A;  3TAT A;  4R2N A;  3RI6 A;  3T32 A;  3BV0 A;  1MAP A;  2VLH A;  3IHJ A;  4DBC A;  1IAX A;  2QLR A;  3GWP A;  1D7S A;  2ZY4 A;  2AY4 A;  1LS3 A;  1TOJ A;  1MGV A;  1OHW A;  4A0G A;  1ASG A;  2FN6 A;  2GQN A;  1AHF A;  1BW0 A;  1QIS A;  2CFB A;  4UHN A;  4LNJ A;  4UQV A;  3AEM A;  3ZRP A;  1CZE A;  3AEL A;  4PFF A;  1BJO A;  4JE5 A;  4WD2 A;  2VMW A;  3H14 A;  4RKD A;  1AY8 A;  2BI2 A;  5M46 A;  1TOG A;  1YOO A;  2CJG A;  3GZD C;  1WYV A;  5E3K A;  3WX9 A;  4BMK A;  4JE5 D;  2W7M A;  3NYS A;  3LY1 A;  3LWS A;  4LW4 A;  3B46 A;  1VJO A;  4F5L A;  1J32 A;  3AEJ C;  1Z7D A;  2VMS A;  4IX8 A;  4K2M A;  2Z67 A;  4WYC A;  1WST A;  2Z1Y A;  3ATH A;  4QGR A;  2OAT A;  4MKJ A;  3CAI A;  4EMY A;  3PJ0 A;  4R5F A;  1IUG A;  1CQ6 A;  3ACZ A;  2G6W A;  3EI8 A;  1AMR A;  1SPA A;  3MC6 A;  5FT6 A;  1V2D A;  2D7Z A;  1GBN A;  3L8A A;  1AHE A;  1GC0 A;  1M6S A;  4F5H A;  2VYC A;  1AJS A;  4IW7 A;  3AV7 A;  4XJP A;  3BCB A;  1UU0 A;  3A8U X;  2W7K A;  1GDE A;  3FCR A;  4PFN A;  3B1E A;  4UHM A;  3PA9 A;  3WKS A;  1UU2 A;  3E77 A;  2W7G A;  1KKJ A;  1JS6 A;  3H7F A;  2FNU A;  3WCN A;  1BJW A;  4XEW A;  4EU1 A;  1TAR A;  3LG0 A;  1AJS B;  3W1I A;  3FRK A;  3N0L A;  3HT4 A;  1G7X A;  4I8A A;  5LH9 A;  2ZP7 A;  1O69 A;  3GJU A;  2R2N A; 
#chains in the Genus database with same CATH topology
 1GC3 A;  2CJH A;  4RAE A;  4TV7 A;  1DKA A;  3CQ5 A;  1M0O A;  3E9K A;  1VP4 A;  4WXB A;  4N0W A;  1PMM A;  3NNK A;  1ELQ A;  3QBO A;  4OTL A;  1AKA A;  4ZSW A;  1OXO A;  2BKW A;  4ZWV A;  1DJ9 A;  4E77 A;  4OYT A;  4XJO A;  2VGZ A;  3MKJ A;  4ZM3 A;  2VMV A;  3E2Y A;  4XK1 A;  2D61 A;  5EUE A;  2ZYJ A;  2VMY A;  4JEX A;  3BB8 A;  2DKJ A;  3FQ7 A;  2VMO A;  3BCA A;  2EZ1 A;  1GEX A;  4A6T A;  1KL1 A;  4NOG A;  3MAD A;  2ZSL A;  4KYO A;  1ARH A;  3ELP A;  4F5J A;  1C7G A;  3DRD A;  1QIR A;  4Q6R A;  1T3I A;  1XI9 A;  4E3R A;  1OHV A;  1CS1 A;  3E2Z A;  4OMA A;  3OKS A;  4J8L A;  1JF9 A;  1ZOB A;  4OBV A;  2CAN A;  2EH6 A;  1BKG A;  1BJ4 A;  2O1B A;  2ORD A;  1OXP A;  4RJ0 A;  5D5S A;  1CQ7 A;  2BI5 A;  2GB3 A;  3I4J A;  2BYL A;  5EAV A;  3UWC A;  4AZJ A;  2WK9 A;  4WLH A;  2HUI A;  1M0Q A;  4E3Q A;  4ZM4 A;  1QGN A;  4LNM A;  1AKB A;  3G0T A;  3E2Z B;  2DOU A;  3CQ6 A;  1RVY A;  3VK4 A;  2W8W A;  3EZS A;  4B98 A;  2VMX A;  1C9C A;  3HQT A;  1V2F A;  4R5Z A;  2CTZ A;  4KAM A;  2C0R A;  4PVF A;  1AIC A;  3K40 A;  2YKU A;  1AHY A;  2BWO A;  2YCN A;  3PIU A;  2X3L A;  2AEV A;  2DGL A;  2CJD A;  2W8V A;  4FL0 A;  4GE9 A;  5DJ1 A;  3FZ6 A;  3DXV A;  1BQD A;  1N2T A;  2PB0 A;  2BIG A;  3FFR A;  2AY9 A;  2JJF A;  1IAY A;  2E7J A;  3PAA A;  2X8U A;  1D7U A;  3EUC A;  2W7L A;  2ZUK A;  4JF1 A;  2VMT A;  1QZ9 A;  2AY6 A;  2QMA A;  3P6K A;  2DGK A;  2CB1 A;  4DQ6 A;  3N4R A;  4ZLV A;  1X2A A;  3DXW A;  4ATP A;  2JJG A;  3RUY A;  3I16 A;  1CQ8 A;  3MAU A;  1YNU A;  3KKI A;  1IBJ A;  3WLX A;  3PDX A;  1OAT A;  5M49 A;  1YAA A;  2AY7 A;  2HUU A;  1P3W A;  1B9I A;  1C0N A;  1ASC A;  4JEW A;  3USF A;  4CXR A;  3RBL A;  2YRI A;  3EI9 A;  3FKD A;  3FZ8 A;  1AMA A;  2Z9X A;  3FTB A;  2OKK A;  3CBF A;  3B1D A;  2E7U A;  3RQ1 A;  4JEZ A;  1RVU A;  4GEB A;  3LVL B;  2BI9 A;  5EIG B;  2WB6 A;  1I43 A;  4GDY A;  2QB2 A;  3HLM A;  2EYQ A;  2DKB A;  2Z1Z A;  4XAU A;  2BI1 A;  3D6K A;  2VMR A;  1RV3 A;  1CJ0 A;  2D7Y A;  2VMN A;  3AOW A;  5TF5 A;  3Q8N A;  4A0H A;  3MAF B;  3HL2 A;  2C7T A;  3QPG A;  2D65 A;  4CVQ A;  1W23 A;  3LV2 A;  1SFF A;  4IXZ A;  4PIW A;  1BQA A;  1AY5 A;  3ZZK A;  2HZP A;  1V72 A;  1LC7 A;  1AMS A;  2R5E A;  2VMQ A;  5LHA A;  1LC8 A;  1ASM A;  5D95 A;  3N7N A;  2VIB A;  2EGY A;  1B5P A;  1GCK A;  5G2P A;  4EFF A;  1H0C A;  1JS3 A;  1AAM A;  4RKC A;  1TAS A;  4LW2 A;  3BC8 A;  4F5G A;  3II0 A;  2AY2 A;  3NYU A;  3QN6 A;  5E5I A;  4XQ2 A;  2BWN A;  1W7L A;  5AX8 A;  3ASA A;  4AO9 A;  4O6Z A;  4CBS A;  1IVR A;  3B8X A;  3F0H A;  2E7I A;  2VGS A;  3NRA A;  1YJZ A;  5EFS A;  1OHY A;  3FQ8 A;  4A6U A;  2BIA A;  3M5U A;  2W7I A;  2AY3 A;  1DGD A;  1IJI A;  1DGE A;  3A9X A;  3DYD A;  4A0R A;  5M4D A;  3A2B A;  3E2F A;  1MDO A;  4RJY A;  2R5C A;  4BA4 A;  2KFP A;  3VK2 A;  5G4I A;  3AEM C;  1ARI A;  1W3U A;  2Z9W A;  2Z9U A;  3BWN A;  4A72 A;  1FC4 A;  4IY7 A;  4TN4 A;  4P7Y A;  3EI7 A;  1MAQ A;  3VP6 A;  1D2F A;  3EI5 A;  2QA3 A;  2W7H A;  2GSA A;  3TFU A;  3OP7 A;  3WGB A;  3FDB A;  2Z9V A;  4F5F A;  4ZAH A;  3AOV A;  2XH1 A;  3UAK A;  4JEV A;  4F5K A;  2R5C B;  5M4B A;  1W7M A;  2D5Y A;  2Z61 A;  4AH3 A;  1O61 A;  3G8M A;  5FT5 A;  3GBX A;  2EPJ A;  2GMS A;  5I92 A;  4WYG A;  3CQ4 A;  3EIA A;  9AAT A;  3BS8 A;  3FD0 A;  3A9Y A;  3PPL A;  4WYD A;  8AAT A;  4WXF A;  3QM2 A;  2HOR A;  2QSR A;  3KGW A;  1RV4 A;  2ZY3 A;  4RLG A;  3JW9 A;  3N75 A;  4IXO A;  3TFT A;  2C81 A;  1YJY A;  2W7D A;  2VMZ A;  3QHX A;  3HVY A;  2W7J A;  4F5I A;  5BJ4 A;  1E5E A;  3MC6 C;  4RIZ A;  1X29 A;  2A1V A;  1SVV A;  3JWB A;  4ZAS A;  2Z20 A;  2RFV A;  1ORD A;  1M32 A;  1ELU A;  2VGT A;  3AEN B;  1S0A A;  2JJH A;  2ZJG A;  3E6G A;  4WYF A;  1LKC A;  3PD6 B;  4K2I A;  4W1V A;  3HBX A;  3L44 A;  3MBB A;  2W8U A;  3NX3 A;  4KXK A;  2O7C A;  4AO4 A;  5K8B A;  4Q31 A;  4DGT A;  4ADB A;  1AIA A;  4ZSY A;  4EB7 A;  4Y0D A;  3UE8 A;  1MDZ A;  3BN1 A;  3DR7 A;  1YIY A;  4JF0 A;  2WKA A;  1AAW A;  1SZS A;  1PMO A;  1QIT A;  4OBU A;  1QJ3 A;  5HHY A;  4ADD A;  1AHX A;  2AEU A;  1TPL A;  2VGV A;  3QI6 A;  5C6U A;  2DGM A;  1IX8 A;  2D66 A;  5G0A A;  5IWQ A;  4LC3 A;  2X5D A;  2R0T A;  3DC1 A;  1EQB A;  4U2H A;  2ZY2 A;  1BT4 A;  2AAT A;  4ADE A;  2OKJ A;  1KL2 A;  1WKG A;  2DR1 A;  1YIZ A;  2VI9 A;  4ZWM A;  3NDN A;  1TOI A;  2YCP A;  3BCX A;  4EB5 A;  1ASF A;  3DU4 A;  5EAA A;  1S06 A;  1X28 A;  5G4J A;  3DZZ A;  4J5U A;  4BQ0 A;  3A9Z A;  2OGA A;  1O4S A;  3IF2 A;  5EIG A;  1X0M A;  1YJS A;  3ZZJ A;  4ZDL A;  1I29 A;  1V2E A;  1ASE A;  3G7Q A;  3ASB A;  3HDO A;  1C7O A;  2Q7W A;  2YKV A;  2YOB A;  2WK7 A;  4B9B A;  2AY1 A;  1J04 A;  3MAF A;  1BJN A;  1FG3 A;  4K05 A;  1WYT A;  3TQX A;  4MY5 A;  4ATQ A;  2FNI A;  3RCH B;  2QB3 A;  7AAT A;  4LNL A;  4WB0 A;  1KKP A;  4GE7 A;  4GSA A;  3COG A;  5BJ3 A;  1DFO A;  3LVJ A;  4MKK A;  2BYJ A;  3N5M A;  3QGU A;  2JGT A;  1SZK A;  3PGY A;  1AHG A;  1H1C A;  4W8I A;  4Y0H A;  2VMU A;  2HP2 A;  1WYT B;  1KMK A;  1SF2 A;  1ZOD A;  4U1T A;  1W7N A;  4F4E A;  4ADC A;  1JG8 A;  3EZ1 A;  2VLF A;  1CL1 A;  2FYF A;  4WB0 B;  3ZRQ A;  1N31 A;  4AOA A;  2VI8 A;  1D7R A;  3FVU A;  4Q75 A;  2YCT A;  4K2B A;  5EQC A;  2CY8 A;  5EUD A;  4A0F A;  1AIB A;  1TAT A;  1GEW A;  2W8J A;  3HMU A;  4W5K A;  4E1O A;  3DOD A;  4JEY A;  4MQP A;  4MQQ A;  4Y0I A;  3WZF A;  3ELE A;  5DJ9 A;  3EIB A;  5F8V A;  4P3M A;  3BWO A;  5J8Q A;  3KGX A;  1PG8 A;  4WBT A;  4IYO A;  4BHD A;  3FVX A;  4W1X A;  5F9S A;  1BJO B;  3I5T A;  1UKJ A;  3VAX A;  1IX7 A;  2NMP A;  5EUN A;  1WYV B;  4WYE A;  3GSB A;  1EG5 A;  4CXQ A;  2QBT A;  3JZL A;  4RM1 A;  3R9A A;  3FFH A;  1ART A;  1E5F A;  4IYO B;  1S08 A;  2ZSM A;  1GEY A;  2WK8 A;  5DB5 A;  1ARG A;  2CH1 A;  2FQ6 A;  2HP1 A;  3ISL A;  3WCO A;  4AZK A;  3FSL A;  4L0O A;  4WLJ A;  1ARS A;  3MEB A;  4BA5 A;  3AEP A;  5KTB A;  1BS0 A;  1KMJ A;  5DX5 A;  2XBN A;  2C44 A;  4UOY A;  1ASB A;  2V0Y A;  4OC9 A;  1AX4 A;  4WYA A;  4ISY A;  2CIN A;  4R8D A;  1TOE A;  1S09 A;  3W1J A;  1B5O A;  4IXS A;  2VIA A;  1WYU A;  2AY8 A;  3AEN A;  5G2Q A;  5HDM A;  5FT8 A;  1B9H A;  1G4V A;  3NUB A;  1I41 A;  3NU7 A;  3PD6 A;  4ZDP A;  4GRX A;  2PO3 A;  1VEF A;  1LC5 A;  1LW5 A;  3WKR A;  4XJM A;  2W8T A;  2D64 A;  2O0R A;  1AKC A;  3FVS A;  4MSO A;  4OCA A;  1ASL A;  3NTJ A;  1C4K A;  3NUI A;  4XJL A;  4CBR A;  4GE4 A;  1WYU B;  3GZC A;  4A00 A;  1B8G A;  1CL2 A;  2JIS A;  3KE3 A;  1M0P A;  2YKX A;  4TMR A;  1G7W A;  1MDX A;  1IX6 A;  2JJE A;  1FG7 A;  1XEY A;  1AMQ A;  3FZ7 A;  2EO5 A;  2HOY A;  3PDB A;  1LW4 A;  1U08 A;  1C7N A;  5E4Z A;  1PFF A;  1ASA A;  1DTY A;  1MLZ A;  4MGR A;  1SZU A;  3EI6 A;  4M2K A;  1G4X A;  1M0N A;  3GR9 A;  5G09 A;  3K28 A;  1ASD A;  2OGE A;  1B4X A;  3LVM A;  3F6T A;  3VOM A;  4WXG A;  2BIE A;  2VMP A;  4H51 A;  2HOZ A;  3B1C A;  4WP0 A;  3PDB B;  1N8P A;  3WGC A;  4W1W A;  2BI3 A;  2VGW A;  2VGU A;  2OQX A;  2PB2 A;  1GC2 A;  1I48 A;  2X5F A;  3ZRR A;  1ECX A;  1DJU A;  4ITG A;  3AEO A;  3BWN C;  3WY7 A;  3GZD A;  4MQR A;  3R4T A;  4HVK A;  1S07 A;  2CH2 A;  2W7F A;  2BHX A;  2D63 A;  2YHK A;  3JWA A;  2E54 A;  2BWP A;  5HXX A;  3DR4 A;  1TOK A;  4M2J A;  1ASN A;  3AEJ A;  1GC4 A;  2CST A;  4A6R A;  3VK3 A;  3LVK A;  1O62 A;  4Q76 A;  1DJE A;  4F5M A;  1EJI A;  1M7Y A;  2AY5 A;  4HF8 A;  1AY4 A;  2G7J A;  2EZ2 A;  4ITX A;  1Y4I A;  3W1H A;  4FFC A;  2HUF A;  3GET A;  1ZC9 A;  1WKH A;  1MLY A;  3FQA A;  4M2M A;  4W91 A;  2GMU A;  2W7E A;  5FT4 A;  3AAT A;  4ZDO A;  3ECD A;  1Z3Z A;  3RCH A;  3H9X A;  1GD9 A;  1KAF A;  2ZY5 A;  2YKY A;  3K7Y A;  2YRR A;  3NYT A;  2TPL A;  1CZC A;  4UHO A;  1LK9 A;  3NU8 A;  1D7V A;  1UU1 A;  2JG2 A;  3F9T A;  4RIT A;  5JAY A;  2FKI A;  2FM1 A;  3RBF A;  3JU7 A;  2F8J A;  2HOX A;  2V1P A;  1AJR A;  3P1T A;  3JTX A;  2ZC0 A;  3FDD A;  3N4X A;  4N0B A;  3TCM A;  4OT8 A;  1QJ5 A;  1M4N A;  3TAT A;  4R2N A;  3RI6 A;  3T32 A;  3BV0 A;  1MAP A;  2VLH A;  3IHJ A;  4DBC A;  1IAX A;  2QLR A;  3GWP A;  1D7S A;  2ZY4 A;  2AY4 A;  1LS3 A;  1TOJ A;  1MGV A;  1OHW A;  4A0G A;  1ASG A;  2FN6 A;  2GQN A;  1AHF A;  1BW0 A;  1QIS A;  2CFB A;  4UHN A;  4LNJ A;  4UQV A;  3AEM A;  3ZRP A;  1CZE A;  3AEL A;  4PFF A;  1BJO A;  4JE5 A;  4WD2 A;  2VMW A;  3H14 A;  4RKD A;  1AY8 A;  2BI2 A;  5M46 A;  1TOG A;  1YOO A;  2CJG A;  3GZD C;  1WYV A;  5E3K A;  3WX9 A;  4BMK A;  4JE5 D;  2W7M A;  3NYS A;  3LY1 A;  3LWS A;  4LW4 A;  3B46 A;  1VJO A;  4F5L A;  1J32 A;  3AEJ C;  1Z7D A;  2VMS A;  4IX8 A;  3N4S A;  4K2M A;  2Z67 A;  4WYC A;  1WST A;  4H63 Q;  2Z1Y A;  3ATH A;  4QGR A;  2OAT A;  4MKJ A;  3CAI A;  4EMY A;  3PJ0 A;  4R5F A;  1IUG A;  1CQ6 A;  3ACZ A;  2G6W A;  3EI8 A;  1AMR A;  1SPA A;  3MC6 A;  5FT6 A;  1V2D A;  2D7Z A;  1GBN A;  3L8A A;  1AHE A;  1GC0 A;  1M6S A;  4F5H A;  2VYC A;  1AJS A;  4IW7 A;  3AV7 A;  4XJP A;  3BCB A;  1UU0 A;  3A8U X;  2W7K A;  1GDE A;  3FCR A;  4PFN A;  3B1E A;  4UHM A;  3PA9 A;  3WKS A;  1UU2 A;  3E77 A;  2W7G A;  1KKJ A;  1JS6 A;  3H7F A;  2FNU A;  3WCN A;  1BJW A;  4XEW A;  4EU1 A;  1TAR A;  3LG0 A;  1AJS B;  3W1I A;  3FRK A;  3N0L A;  3HT4 A;  1G7X A;  4I8A A;  5LH9 A;  2ZP7 A;  1O69 A;  3GJU A;  2R2N A; 
#chains in the Genus database with same CATH homology
 1GC3 A;  2CJH A;  4RAE A;  4TV7 A;  1DKA A;  3CQ5 A;  1M0O A;  3E9K A;  1VP4 A;  4WXB A;  4N0W A;  1PMM A;  3NNK A;  1ELQ A;  3QBO A;  4OTL A;  1AKA A;  4ZSW A;  1OXO A;  2BKW A;  4ZWV A;  1DJ9 A;  4E77 A;  4OYT A;  4XJO A;  2VGZ A;  3MKJ A;  4ZM3 A;  2VMV A;  3E2Y A;  4XK1 A;  2D61 A;  5EUE A;  2ZYJ A;  2VMY A;  4JEX A;  3BB8 A;  2DKJ A;  3FQ7 A;  2VMO A;  3BCA A;  2EZ1 A;  1GEX A;  4A6T A;  1KL1 A;  4NOG A;  3MAD A;  2ZSL A;  4KYO A;  1ARH A;  3ELP A;  4F5J A;  1C7G A;  3DRD A;  1QIR A;  4Q6R A;  1T3I A;  1XI9 A;  4E3R A;  1OHV A;  1CS1 A;  3E2Z A;  4OMA A;  3OKS A;  4J8L A;  1JF9 A;  1ZOB A;  4OBV A;  2CAN A;  2EH6 A;  1BKG A;  1BJ4 A;  2O1B A;  2ORD A;  1OXP A;  4RJ0 A;  5D5S A;  1CQ7 A;  2BI5 A;  2GB3 A;  3I4J A;  2BYL A;  5EAV A;  3UWC A;  4AZJ A;  2WK9 A;  4WLH A;  2HUI A;  1M0Q A;  4E3Q A;  4ZM4 A;  1QGN A;  4LNM A;  1AKB A;  3G0T A;  3E2Z B;  2DOU A;  3CQ6 A;  1RVY A;  3VK4 A;  2W8W A;  3EZS A;  4B98 A;  2VMX A;  1C9C A;  3HQT A;  1V2F A;  4R5Z A;  2CTZ A;  4KAM A;  2C0R A;  4PVF A;  1AIC A;  3K40 A;  2YKU A;  1AHY A;  2BWO A;  2YCN A;  3PIU A;  2X3L A;  2AEV A;  2DGL A;  2CJD A;  2W8V A;  4FL0 A;  4GE9 A;  5DJ1 A;  3FZ6 A;  3DXV A;  1BQD A;  1N2T A;  2PB0 A;  2BIG A;  3FFR A;  2AY9 A;  2JJF A;  1IAY A;  2E7J A;  3PAA A;  2X8U A;  1D7U A;  3EUC A;  2W7L A;  2ZUK A;  4JF1 A;  2VMT A;  1QZ9 A;  2AY6 A;  2QMA A;  3P6K A;  2DGK A;  2CB1 A;  4DQ6 A;  3N4R A;  4ZLV A;  1X2A A;  3DXW A;  4ATP A;  2JJG A;  3RUY A;  3I16 A;  1CQ8 A;  3MAU A;  1YNU A;  3KKI A;  1IBJ A;  3WLX A;  3PDX A;  1OAT A;  5M49 A;  1YAA A;  2AY7 A;  2HUU A;  1P3W A;  1B9I A;  1C0N A;  1ASC A;  4JEW A;  3USF A;  4CXR A;  3RBL A;  2YRI A;  3EI9 A;  3FKD A;  3FZ8 A;  1AMA A;  2Z9X A;  3FTB A;  2OKK A;  3CBF A;  3B1D A;  2E7U A;  3RQ1 A;  4JEZ A;  1RVU A;  4GEB A;  3LVL B;  2BI9 A;  5EIG B;  2WB6 A;  1I43 A;  4GDY A;  2QB2 A;  3HLM A;  2EYQ A;  2DKB A;  2Z1Z A;  4XAU A;  2BI1 A;  3D6K A;  2VMR A;  1RV3 A;  1CJ0 A;  2D7Y A;  2VMN A;  3AOW A;  5TF5 A;  3Q8N A;  4A0H A;  3MAF B;  3HL2 A;  2C7T A;  3QPG A;  2D65 A;  4CVQ A;  1W23 A;  3LV2 A;  1SFF A;  4IXZ A;  4PIW A;  1BQA A;  1AY5 A;  3ZZK A;  2HZP A;  1V72 A;  1LC7 A;  1AMS A;  2R5E A;  2VMQ A;  5LHA A;  1LC8 A;  1ASM A;  5D95 A;  3N7N A;  2VIB A;  2EGY A;  1B5P A;  1GCK A;  5G2P A;  4EFF A;  1H0C A;  1JS3 A;  1AAM A;  4RKC A;  1TAS A;  4LW2 A;  3BC8 A;  4F5G A;  3II0 A;  2AY2 A;  3NYU A;  3QN6 A;  5E5I A;  4XQ2 A;  2BWN A;  1W7L A;  5AX8 A;  3ASA A;  4AO9 A;  4O6Z A;  4CBS A;  1IVR A;  3B8X A;  3F0H A;  2E7I A;  2VGS A;  3NRA A;  1YJZ A;  5EFS A;  1OHY A;  3FQ8 A;  4A6U A;  2BIA A;  3M5U A;  2W7I A;  2AY3 A;  1DGD A;  1IJI A;  1DGE A;  3A9X A;  3DYD A;  4A0R A;  5M4D A;  3A2B A;  3E2F A;  1MDO A;  4RJY A;  2R5C A;  4BA4 A;  2KFP A;  3VK2 A;  5G4I A;  3AEM C;  1ARI A;  1W3U A;  2Z9W A;  2Z9U A;  3BWN A;  4A72 A;  1FC4 A;  4IY7 A;  4TN4 A;  4P7Y A;  3EI7 A;  1MAQ A;  3VP6 A;  1D2F A;  3EI5 A;  2QA3 A;  2W7H A;  2GSA A;  3TFU A;  3OP7 A;  3WGB A;  3FDB A;  2Z9V A;  4F5F A;  4ZAH A;  3AOV A;  2XH1 A;  3UAK A;  4JEV A;  4F5K A;  2R5C B;  5M4B A;  1W7M A;  2D5Y A;  2Z61 A;  4AH3 A;  1O61 A;  3G8M A;  5FT5 A;  3GBX A;  2EPJ A;  2GMS A;  5I92 A;  4WYG A;  3CQ4 A;  3EIA A;  9AAT A;  3BS8 A;  3FD0 A;  3A9Y A;  3PPL A;  4WYD A;  8AAT A;  4WXF A;  3QM2 A;  2HOR A;  2QSR A;  3KGW A;  1RV4 A;  2ZY3 A;  4RLG A;  3JW9 A;  3N75 A;  4IXO A;  3TFT A;  2C81 A;  1YJY A;  2W7D A;  2VMZ A;  3QHX A;  3HVY A;  2W7J A;  4F5I A;  5BJ4 A;  1E5E A;  3MC6 C;  4RIZ A;  1X29 A;  2A1V A;  1SVV A;  3JWB A;  4ZAS A;  2Z20 A;  2RFV A;  1ORD A;  1M32 A;  1ELU A;  2VGT A;  3AEN B;  1S0A A;  2JJH A;  2ZJG A;  3E6G A;  4WYF A;  1LKC A;  3PD6 B;  4K2I A;  4W1V A;  3HBX A;  3L44 A;  3MBB A;  2W8U A;  3NX3 A;  4KXK A;  2O7C A;  4AO4 A;  5K8B A;  4Q31 A;  4DGT A;  4ADB A;  1AIA A;  4ZSY A;  4EB7 A;  4Y0D A;  3UE8 A;  1MDZ A;  3BN1 A;  3DR7 A;  1YIY A;  4JF0 A;  2WKA A;  1AAW A;  1SZS A;  1PMO A;  1QIT A;  4OBU A;  1QJ3 A;  5HHY A;  4ADD A;  1AHX A;  2AEU A;  1TPL A;  2VGV A;  3QI6 A;  5C6U A;  2DGM A;  1IX8 A;  2D66 A;  5G0A A;  5IWQ A;  4LC3 A;  2X5D A;  2R0T A;  3DC1 A;  1EQB A;  4U2H A;  2ZY2 A;  1BT4 A;  2AAT A;  4ADE A;  2OKJ A;  1KL2 A;  1WKG A;  2DR1 A;  1YIZ A;  2VI9 A;  4ZWM A;  3NDN A;  1TOI A;  2YCP A;  3BCX A;  4EB5 A;  1ASF A;  3DU4 A;  5EAA A;  1S06 A;  1X28 A;  5G4J A;  3DZZ A;  4J5U A;  4BQ0 A;  3A9Z A;  2OGA A;  1O4S A;  3IF2 A;  5EIG A;  1X0M A;  1YJS A;  3ZZJ A;  4ZDL A;  1I29 A;  1V2E A;  1ASE A;  3G7Q A;  3ASB A;  3HDO A;  1C7O A;  2Q7W A;  2YKV A;  2YOB A;  2WK7 A;  4B9B A;  2AY1 A;  1J04 A;  3MAF A;  1BJN A;  1FG3 A;  4K05 A;  1WYT A;  3TQX A;  4MY5 A;  4ATQ A;  2FNI A;  3RCH B;  2QB3 A;  7AAT A;  4LNL A;  4WB0 A;  1KKP A;  4GE7 A;  4GSA A;  3COG A;  5BJ3 A;  1DFO A;  3LVJ A;  4MKK A;  2BYJ A;  3N5M A;  3QGU A;  2JGT A;  1SZK A;  3PGY A;  1AHG A;  1H1C A;  4W8I A;  4Y0H A;  2VMU A;  2HP2 A;  1WYT B;  1KMK A;  1SF2 A;  1ZOD A;  4U1T A;  1W7N A;  4F4E A;  4ADC A;  1JG8 A;  3EZ1 A;  2VLF A;  1CL1 A;  2FYF A;  4WB0 B;  3ZRQ A;  1N31 A;  4AOA A;  2VI8 A;  1D7R A;  3FVU A;  4Q75 A;  2YCT A;  4K2B A;  5EQC A;  2CY8 A;  5EUD A;  4A0F A;  1AIB A;  1TAT A;  1GEW A;  2W8J A;  3HMU A;  4W5K A;  4E1O A;  3DOD A;  4JEY A;  4MQP A;  4MQQ A;  4Y0I A;  3WZF A;  3ELE A;  5DJ9 A;  3EIB A;  5F8V A;  4P3M A;  3BWO A;  5J8Q A;  3KGX A;  1PG8 A;  4WBT A;  4IYO A;  4BHD A;  3FVX A;  4W1X A;  5F9S A;  1BJO B;  3I5T A;  1UKJ A;  3VAX A;  1IX7 A;  2NMP A;  5EUN A;  1WYV B;  4WYE A;  3GSB A;  1EG5 A;  4CXQ A;  2QBT A;  3JZL A;  4RM1 A;  3R9A A;  3FFH A;  1ART A;  1E5F A;  4IYO B;  1S08 A;  2ZSM A;  1GEY A;  2WK8 A;  5DB5 A;  1ARG A;  2CH1 A;  2FQ6 A;  2HP1 A;  3ISL A;  3WCO A;  4AZK A;  3FSL A;  4L0O A;  4WLJ A;  1ARS A;  3MEB A;  4BA5 A;  3AEP A;  5KTB A;  1BS0 A;  1KMJ A;  5DX5 A;  2XBN A;  2C44 A;  4UOY A;  1ASB A;  2V0Y A;  4OC9 A;  1AX4 A;  4WYA A;  4ISY A;  2CIN A;  4R8D A;  1TOE A;  1S09 A;  3W1J A;  1B5O A;  4IXS A;  2VIA A;  1WYU A;  2AY8 A;  3AEN A;  5G2Q A;  5HDM A;  5FT8 A;  1B9H A;  1G4V A;  3NUB A;  1I41 A;  3NU7 A;  3PD6 A;  4ZDP A;  4GRX A;  2PO3 A;  1VEF A;  1LC5 A;  1LW5 A;  3WKR A;  4XJM A;  2W8T A;  2D64 A;  2O0R A;  1AKC A;  3FVS A;  4MSO A;  4OCA A;  1ASL A;  3NTJ A;  1C4K A;  3NUI A;  4XJL A;  4CBR A;  4GE4 A;  1WYU B;  3GZC A;  4A00 A;  1B8G A;  1CL2 A;  2JIS A;  3KE3 A;  1M0P A;  2YKX A;  4TMR A;  1G7W A;  1MDX A;  1IX6 A;  2JJE A;  1FG7 A;  1XEY A;  1AMQ A;  3FZ7 A;  2EO5 A;  2HOY A;  3PDB A;  1LW4 A;  1U08 A;  1C7N A;  5E4Z A;  1PFF A;  1ASA A;  1DTY A;  1MLZ A;  4MGR A;  1SZU A;  3EI6 A;  4M2K A;  1G4X A;  1M0N A;  3GR9 A;  5G09 A;  3K28 A;  1ASD A;  2OGE A;  1B4X A;  3LVM A;  3F6T A;  3VOM A;  4WXG A;  2BIE A;  2VMP A;  4H51 A;  2HOZ A;  3B1C A;  4WP0 A;  3PDB B;  1N8P A;  3WGC A;  4W1W A;  2BI3 A;  2VGW A;  2VGU A;  2OQX A;  2PB2 A;  1GC2 A;  1I48 A;  2X5F A;  3ZRR A;  1ECX A;  1DJU A;  4ITG A;  3AEO A;  3BWN C;  3WY7 A;  3GZD A;  4MQR A;  3R4T A;  4HVK A;  1S07 A;  2CH2 A;  2W7F A;  2BHX A;  2D63 A;  2YHK A;  3JWA A;  2E54 A;  2BWP A;  5HXX A;  3DR4 A;  1TOK A;  4M2J A;  1ASN A;  3AEJ A;  1GC4 A;  2CST A;  4A6R A;  3VK3 A;  3LVK A;  1O62 A;  4Q76 A;  1DJE A;  4F5M A;  1EJI A;  1M7Y A;  2AY5 A;  4HF8 A;  1AY4 A;  2G7J A;  2EZ2 A;  4ITX A;  1Y4I A;  3W1H A;  4FFC A;  2HUF A;  3GET A;  1ZC9 A;  1WKH A;  1MLY A;  3FQA A;  4M2M A;  4W91 A;  2GMU A;  2W7E A;  5FT4 A;  3AAT A;  4ZDO A;  3ECD A;  1Z3Z A;  3RCH A;  3H9X A;  1GD9 A;  2ZY5 A;  2YKY A;  3K7Y A;  2YRR A;  3NYT A;  2TPL A;  1CZC A;  4UHO A;  1LK9 A;  3NU8 A;  1D7V A;  1UU1 A;  2JG2 A;  3F9T A;  4RIT A;  5JAY A;  2FKI A;  2FM1 A;  3RBF A;  3JU7 A;  2F8J A;  2HOX A;  2V1P A;  1AJR A;  3P1T A;  3JTX A;  2ZC0 A;  3FDD A;  3N4X A;  4N0B A;  3TCM A;  4OT8 A;  1QJ5 A;  1M4N A;  3TAT A;  4R2N A;  3RI6 A;  3T32 A;  3BV0 A;  1MAP A;  2VLH A;  3IHJ A;  4DBC A;  1IAX A;  2QLR A;  3GWP A;  1D7S A;  2ZY4 A;  2AY4 A;  1LS3 A;  1TOJ A;  1MGV A;  1OHW A;  4A0G A;  1ASG A;  2FN6 A;  2GQN A;  1AHF A;  1BW0 A;  1QIS A;  2CFB A;  4UHN A;  4LNJ A;  4UQV A;  3AEM A;  3ZRP A;  1CZE A;  3AEL A;  4PFF A;  1BJO A;  4JE5 A;  4WD2 A;  2VMW A;  3H14 A;  4RKD A;  1AY8 A;  2BI2 A;  5M46 A;  1TOG A;  1YOO A;  2CJG A;  3GZD C;  1WYV A;  5E3K A;  3WX9 A;  4BMK A;  4JE5 D;  2W7M A;  3NYS A;  3LY1 A;  3LWS A;  4LW4 A;  3B46 A;  1VJO A;  4F5L A;  1J32 A;  3AEJ C;  1Z7D A;  2VMS A;  4IX8 A;  3N4S A;  4K2M A;  2Z67 A;  4WYC A;  1WST A;  4H63 Q;  2Z1Y A;  3ATH A;  4QGR A;  2OAT A;  4MKJ A;  3CAI A;  4EMY A;  3PJ0 A;  4R5F A;  1IUG A;  1CQ6 A;  3ACZ A;  2G6W A;  3EI8 A;  1AMR A;  1SPA A;  3MC6 A;  5FT6 A;  1V2D A;  2D7Z A;  1GBN A;  3L8A A;  1AHE A;  1GC0 A;  1M6S A;  4F5H A;  2VYC A;  1AJS A;  4IW7 A;  3AV7 A;  4XJP A;  3BCB A;  1UU0 A;  3A8U X;  2W7K A;  1GDE A;  3FCR A;  4PFN A;  3B1E A;  4UHM A;  3PA9 A;  3WKS A;  1UU2 A;  3E77 A;  2W7G A;  1KKJ A;  1JS6 A;  3H7F A;  2FNU A;  3WCN A;  1BJW A;  4XEW A;  4EU1 A;  1TAR A;  3LG0 A;  1AJS B;  3W1I A;  3FRK A;  3N0L A;  3HT4 A;  1G7X A;  4I8A A;  5LH9 A;  2ZP7 A;  1O69 A;  3GJU A;  2R2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...