1ARIA

Aspartate aminotransferase, w140h mutant, maleate complex
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSHPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Substitution of apolar residues in the active site of aspartate aminotransferase by histidine. Effects on reaction and substrate specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (aminotransferase)
total genus 133
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1995-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1ariA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1ariA01
3FDDA 3Q8NA 1G4XA 1S07A 3RQ1A 1AY8A 3WLXA 1N2TA 3LVJA 2BHXA 3LY1A 5D5SA 3WCOA 1MDXA 1J04A 1D7VA 4ZM4A 4Q31A 2W7IA 1IVRA 1ARIA 3FQ8A 1MAPA 3UWCA 3LVKA 4IW7A 7AATA 1X2AA 3FRKA 1O61A 2W7GA 2Z9XA 4UHMA 3BC8A 4MGRA 2BYJA 4UQVA 3VK4A 1ORDA 4TMRA 3UAKA 4ATPA 4ZDOA 4F5GA 3FVXA 3WKRA 1AAWA 2ZSMA 3AENB 1WSTA 4KYOA 1V2FA 4N0BA 4JEZA 4RKDA 3A9XA 2W7FA 3WGBA 3A2BA 3D6KA 3EI7A 1B8GA 1AHFA 2VMNA 4LC3A 1ELQA 4EFFA 3GZDC 1ZC9A 2X5FA 4FL0A 3BWNC 3L8AA 1GC2A 2AY6A 4OBVA 3HL2A 4JEYA 1BQAA 3W1JA 1ASFA 3B46A 3NYUA 2HORA 1M7YA 4Y0IA 1ASBA 1O4SA 1M0QA 2YRRA 1VJOA 1FG3A 4A72A 2GMSA 4XEWA 3G8MA 3M5UA 1AIAA 1W23A 2JJEA 3AENA 3E2ZA 2C44A 4XJOA 4E3RA 4F5KA 1ECXA 2YCTA 2CINA 1CS1A 1JS6A 2ZJGA 1ASNA 1TASA 4NOGA 4W91A 1G7WA 1MGVA 2DKBA 3PDXA 3ISLA 2WKAA 4A0HA 1SFFA 2VMZA 3PD6A 2W7DA 3TQXA 4WYCA 4R2NA 3USFA 3WY7A 2ZY3A 1W7NA 2Z1ZA 3CQ6A 2GQNA 3QHXA 4BA5A 1TOEA 4IY7A 2PO3A 1EQBA 2YKXA 4CBSA 1T3IA 1LC8A 2DKJA 2W7LA 1KL1A 3MKJA 2R0TA 5E3KA 2HUUA 4LNMA 4XJMA 5DJ9A 3AOVA 2FQ6A 5LHAA 3B1DA 3HVYA 2Q7WA 4AOAA 3FTBA 5EAAA 1TOIA 1OHYA 2EGYA 1Z7DA 5EUNA 1I43A 3F6TA 1OHWA 4MKJA 2HP2A 2AY7A 4KXKA 2BWOA 2VLHA 3FFRA 1KL2A 2JJFA 5EIGB 2YRIA 4HVKA 3PJ0A 3BCXA 4Q6RA 5FT4A 1O69A 4GDYA 3FD0A 3FFHA 3PA9A 5F9SA 2VMTA 4F5IA 1BJOA 2ZYJA 1WYTB 2W7JA 4Y0DA 4JE5D 5M4DA 1AICA 4W5KA 1AJSB 3JWAA 3IHJA 1YJYA 4ZWMA 2R5CA 2OKKA 2ZP7A 5BJ3A 3CAIA 1H0CA 2WK7A 4ATQA 1XEYA 1QITA 2GSAA 2D64A 4R5ZA 3AELA 5F8VA 2HP1A 2AY8A 4H51A 4A6RA 3CQ5A 3AEJC 2R5EA 1BKGA 4ADBA 3T32A 1YAAA 3EI6A 4GEBA 4W8IA 5EQCA 1G4VA 1WYTA 4MKKA 1DTYA 2JG2A 4Y0HA 3N75A 5AX8A 2GMUA 2W8UA 3BV0A 4OCAA 5TF5A 1LKCA 3GJUA 1V2DA 4N0WA 4WB0B 1IUGA 1TATA 1TPLA 3PGYA 4ZM3A 4RM1A 1D7SA 2ZY5A 2YKUA 5EUDA 3F9TA 4DGTA 3HQTA 3MAUA 1S08A 1LS3A 1C4KA 1JF9A 5J8QA 2AY9A 4BA4A 4BHDA 1OHVA 4WLHA 1DKAA 2D7YA 2VI8A 2AY5A 4GSAA 1CL1A 4WLJA 2BI1A 1EG5A 1W3UA 2QB3A 1ZOBA 1AKCA 3VK2A 4A00A 1EJIA 1GC0A 1I29A 3JTXA 2E7UA 2PB0A 1BW0A 1ARTA 1UU2A 2W7EA 4J5UA 4WB0A 3RCHB 2OGAA 4F5HA 3CQ4A 1P3WA 2BI5A 2W8WA 4ZLVA 2OGEA 2CJHA 3NYTA 1GEWA 3GSBA 3QBOA 1AAMA 2DGLA 5JAYA 1B5OA 3N0LA 1MLZA 3CBFA 2HUIA 4WXFA 1DFOA 2CFBA 3R9AA 4F4EA 3B1CA 4HF8A 5EFSA 5FT8A 2VMWA 4JE5A 4ZASA 2W7KA 1ASCA 4WP0A 1ASMA 1JG8A 1DGDA 1GDEA 2BKWA 3GZDA 3NU7A 4ITXA 3RCHA 4U2HA 3WX9A 2R2NA 3ZRQA 4DQ6A 3BWNA 2OKJA 4MQPA 4EB7A 1AHEA 1AMSA 1AMAA 1X28A 4IYOB 3JW9A 4OBUA 1QJ3A 3EUCA 4B9BA 1AMQA 2CJDA 4XJLA 4WBTA 1GD9A 3OP7A 2VMSA 1SZKA 1AY4A 3EI8A 5G09A 2W8VA 4IXZA 4ZSWA 2HZPA 3GR9A 3I16A 3JU7A 2AATA 2BIEA 3N5MA 3ZRRA 1GCKA 4CXRA 3HMUA 4EU1A 2EPJA 1M32A 3TFUA 1LK9A 3K40A 2D5YA 4ISYA 3NNKA 2VIAA 2E7JA 2FN6A 3ELPA 2VMRA 4CXQA 2QBTA 5D95A 3I5TA 4IX8A 1ARGA 3NU8A 4LW2A 3AOWA 4IYOA 1O62A 2AY3A 2O7CA 3E2YA 5G0AA 1AX4A 3B1EA 2DGMA 1WKGA 1W7LA 4R8DA 3ELEA 4AO9A 2CSTA 3B8XA 3DU4A 3NYSA 1M4NA 2GB3A 5E4ZA 1KMJA 3MC6A 3VOMA 5EAVA 4Q75A 3W1IA 1KMKA 2EZ1A 3ASAA 3RBLA 4BQ0A 1M0NA 3QM2A 2VMUA 3MC6C 3R4TA 2VMOA 1B5PA 1S06A 1ASAA 2YHKA 5G2QA 1BJWA 3GWPA 2CY8A 2E7IA 2Z9UA 3LG0A 1V72A 2F8JA 3E77A 1LC5A 1IX8A 4OMAA 2YKVA 3MADA 3G0TA 1BJNA 1QGNA 1C9CA 4KAMA 4L0OA 1C0NA 1ASDA 1PG8A 2ZY2A 3DZZA 3RI6A 4ADEA 2O1BA 1KKJA 4P7YA 4RAEA 3HDOA 3VK3A 4AZJA 3BCAA 3E6GA 4ZDPA 1ASGA 1QIRA 4AO4A 3FCRA 1ARHA 1QZ9A 1H1CA 1IBJA 2VIBA 2VMVA 1I48A 3AEJA 3ATHA 3BWOA 3QPGA 1PMOA 1GEXA 5EIGA 1B9IA 3TCMA 5DX5A 2D61A 4W1VA 1U08A 2X3LA 2VI9A 3HLMA 1IX7A 1IAYA 5C6UA 1RV3A 2D7ZA 3NDNA 4JF1A 3WCNA 3DXWA 1AJSA 2ZUKA 1QISA 1VEFA 2NMPA 3AATA 4U1TA 1KKPA 3ZRPA 4UOYA 3OKSA 3UE8A 2CTZA 4XAUA 4XQ2A 1AIBA 3PPLA 2AY2A 2VMYA 3BCBA 5FT5A 2ORDA 3FZ6A 2C0RA 4WYGA 4B98A 3BS8A 2QLRA 2BWPA 1GC3A 1CZCA 3AEMA 3LV2A 1DJEA 1M0PA 2EO5A 3AEMC 8AATA 4ZSYA 1UU1A 3COGA 3L44A 2YKYA 4TN4A 1V2EA 4WD2A 3FQAA 3FZ7A 3HBXA 2JGTA 3VP6A 3JWBA 3AEPA 5DB5A 3H7FA 1WYUB 1C7OA 2AY1A 1TOKA 4LW4A 4RITA 2VGSA 9AATA 1YOOA 3WGCA 2VMXA 3MEBA 4K2IA 1D7UA 2VGWA 2XBNA 4PFFA 4PIWA 2Z61A 1B9HA 1BS0A 2O0RA 4ADDA 4ZAHA 1XI9A 1D7RA 1YJSA 2AEUA 2ZC0A 2VGVA 2VGUA 3GBXA 3II0A 3AV7A 5K8BA 5IWQA 1AKAA 1AMRA 1CQ7A 3NRAA 4I8AA 4R5FA 1S09A 1D2FA 4DBCA 2HOXA 4WXBA 1BQDA 2Z1YA 4LNLA 1GC4A 1IJIA 1FC4A 2Z9VA 3JZLA 4K2MA 4UHNA 2VGTA 3E9KA 4PFNA 4UHOA 1WYUA 3P1TA 1BJ4A 1CJ0A 1YIYA 4MQRA 2X5DA 4ZDLA 3QI6A 3EZSA 3H14A 3MAFB 1ZODA 5HHYA 1DJUA 1YNUA 1AY5A 1VP4A 4ADCA 3DXVA 1LW5A 4W1WA 4JEVA 2D66A 2Z67A 4OC9A 4QGRA 2YCNA 4GRXA 1MLYA 2WK8A 3PIUA 1OXOA 1DGEA 4A0FA 1M0OA 4CVQA 5M46A 3ECDA 2VMPA 2HOZA 4EMYA 1N31A 2E54A 2DR1A 2W7HA 1QJ5A 3W1HA 3E2ZB 2CB1A 1UKJA 4F5FA 4XK1A 1MDZA 3MAFA 1YJZA 2BWNA 1RVYA 3QGUA 1CQ6A 2CANA 3QN6A 3FVSA 1G7XA 3A8UX 3LVMA 3PD6B 1CQ8A 5G4JA 4RLGA 2BI9A 3ACZA 3FSLA 1PFFA 1N8PA 2EH6A 3PDBB 3DYDA 5FT6A 1MDOA 3A9YA 3GZCA 4GE9A 4A6TA 4J8LA 4AZKA 1PMMA 2ZSLA 1C7NA 1E5FA 3ZZJA 1E5EA 1LC7A 4F5LA 4A6UA 1ASLA 4RJYA 5I92A 1X0MA 3KKIA 3NUBA 3KGWA 3RUYA 3KE3A 2D65A 2V1PA 4IXOA 1TARA 1Z3ZA 1GEYA 2TPLA 4EB5A 3ASBA 5BJ4A 2CH1A 2XH1A 2VLFA 1M6SA 2AY4A 5LH9A 3LWSA 1SF2A 2AEVA 4W1XA 2CH2A 3PDBA 4M2MA 2DGKA 2W8TA 3TATA 3DC1A 4IXSA 4Q76A 2ZY4A 3G7QA 4BMKA 3K7YA 1BJOB 3DR7A 2BIGA 2X8UA 4LNJA 4OT8A 3NX3A 2R5CB 4P3MA 4WYEA 3K28A 3EZ1A 4ZWVA 1DJ9A 1B4XA 3EI5A 4M2JA 2FM1A 2FNUA 2JJGA 2PB2A 4JF0A 4MQQA 1TOJA 3GETA 5E5IA 1I41A 4E3QA 1OXPA 4XJPA 4TV7A 3EIAA 4O6ZA 4PVFA 3NUIA 2BI3A 3FDBA 4RKCA 3RBFA 3P6KA 1SVVA 3PAAA 4E77A 1UU0A 4F5JA 5M49A 2EZ2A 3E2FA 3DR4A 3FZ8A 4M2KA 3DODA 1MAQA 1YIZA 3FQ7A 2YOBA 3F0HA 3NTJA 2DOUA 3AEOA 2OATA 1AJRA 4F5MA 2HOYA 3EIBA 1WYVB 2W7MA 1SZSA 2OQXA 1LW4A 1IAXA 3MBBA 1BT4A 3FKDA 1CZEA 1RV4A 4MY5A 4WYAA 2WK9A 5EUEA 2VYCA 3DRDA 3VAXA 3TFTA 4WXGA 4WYDA 1Y4IA 2FYFA 2RFVA 1S0AA 2JJHA 2CJGA 5M4BA 2QMAA 1RVUA 1X29A 4E1OA 4WYFA 2BI2A 2C7TA 2BIAA 4A0GA 4FFCA 1CL2A 1GBNA 3BB8A 2VMQA 1AHYA 4RIZA 5G2PA 3WKSA 2G6WA 3WZFA 1ELUA 3KGXA 5G4IA 2Z9WA 2FNIA 1WYVA 4GE7A 1SZUA 1FG7A 2QA3A 2HUFA 3IF2A 1TOGA 1WKHA 4CBRA 2YCPA 1SPAA 1ARSA 1OATA 1W7MA 3A9ZA 4ITGA 2D63A 2C81A 4GE4A 4AH3A 1C7GA 2JISA 3LVLB 3BN1A 1IX6A 4OTLA 1AKBA 3HT4A 2VGZA 1AHGA 3EI9A 5HXXA 2QB2A 3FVUA 4K2BA 4JEXA 2BYLA 2Z20A 4OYTA 2W8JA 4RJ0A 1ASEA 1JS3A 5DJ1A 3I4JA 4MSOA 5HDMA 3ZZKA 2V0YA 1AHXA 1J32A 4JEWA 4A0RA
chains in the Genus database with same CATH superfamily
3FDDA 3Q8NA 1G4XA 1S07A 3RQ1A 1AY8A 3WLXA 1N2TA 3LVJA 2BHXA 3LY1A 5D5SA 3WCOA 1MDXA 1J04A 1D7VA 4ZM4A 4Q31A 2A1VA 2W7IA 1IVRA 3N4RA 1ARIA 3FQ8A 1MAPA 3UWCA 3LVKA 4IW7A 7AATA 1X2AA 3FRKA 1O61A 2W7GA 2Z9XA 4UHMA 3BC8A 4MGRA 2BYJA 4UQVA 3VK4A 1ORDA 4TMRA 3UAKA 4ATPA 4ZDOA 4F5GA 3FVXA 3WKRA 1AAWA 2ZSMA 3AENB 1WSTA 4KYOA 1V2FA 4N0BA 4JEZA 4RKDA 3A9XA 2W7FA 3WGBA 3A2BA 3D6KA 3EI7A 1B8GA 1AHFA 2VMNA 4LC3A 1ELQA 4EFFA 3GZDC 1ZC9A 2X5FA 4FL0A 3BWNC 3L8AA 1GC2A 2AY6A 4OBVA 3HL2A 4JEYA 1BQAA 3W1JA 1ASFA 3B46A 3NYUA 2HORA 1M7YA 4Y0IA 1ASBA 1O4SA 1M0QA 2YRRA 1VJOA 1FG3A 4A72A 2GMSA 4XEWA 3G8MA 3M5UA 1AIAA 1W23A 2JJEA 3AENA 3E2ZA 2C44A 4XJOA 4E3RA 4F5KA 1ECXA 2YCTA 2CINA 1CS1A 1JS6A 2ZJGA 1ASNA 1TASA 4NOGA 4W91A 1G7WA 1MGVA 2DKBA 3PDXA 3ISLA 2WKAA 4A0HA 1SFFA 2VMZA 3PD6A 2W7DA 3TQXA 4WYCA 4R2NA 3USFA 3WY7A 2ZY3A 1W7NA 2Z1ZA 3CQ6A 2GQNA 3QHXA 4BA5A 1TOEA 4IY7A 2PO3A 1EQBA 2YKXA 4CBSA 1T3IA 1LC8A 2DKJA 2W7LA 1KL1A 3MKJA 2R0TA 5E3KA 2HUUA 4LNMA 4XJMA 5DJ9A 3AOVA 2FQ6A 5LHAA 3B1DA 3HVYA 2Q7WA 4AOAA 3FTBA 5EAAA 1TOIA 1OHYA 2EGYA 1Z7DA 5EUNA 1I43A 3F6TA 1OHWA 4MKJA 2HP2A 2AY7A 4KXKA 2BWOA 2VLHA 3FFRA 1KL2A 2JJFA 5EIGB 2YRIA 4HVKA 3PJ0A 3BCXA 4Q6RA 5FT4A 1O69A 4GDYA 3FD0A 3FFHA 3PA9A 5F9SA 2VMTA 4F5IA 1BJOA 2ZYJA 1WYTB 2W7JA 4Y0DA 4JE5D 5M4DA 1AICA 4W5KA 1AJSB 3JWAA 3IHJA 1YJYA 4ZWMA 2R5CA 4H63Q 2OKKA 2ZP7A 5BJ3A 3CAIA 1H0CA 2WK7A 4ATQA 1XEYA 1QITA 2GSAA 2D64A 4R5ZA 3AELA 5F8VA 2HP1A 2AY8A 4H51A 4A6RA 3CQ5A 3AEJC 2R5EA 1BKGA 4ADBA 3N4XA 3T32A 1YAAA 3EI6A 4GEBA 4W8IA 5EQCA 1G4VA 1WYTA 4MKKA 1DTYA 2JG2A 4Y0HA 3N75A 5AX8A 2GMUA 2W8UA 3BV0A 4OCAA 5TF5A 1LKCA 3GJUA 1V2DA 3N4SA 4N0WA 4WB0B 1IUGA 1TATA 1TPLA 3PGYA 4ZM3A 4RM1A 1D7SA 2ZY5A 2YKUA 5EUDA 3F9TA 4DGTA 3HQTA 3MAUA 1S08A 1LS3A 1C4KA 1JF9A 5J8QA 2AY9A 4BA4A 4BHDA 1OHVA 4WLHA 1DKAA 2D7YA 2VI8A 2AY5A 4GSAA 1CL1A 4WLJA 2BI1A 1EG5A 1W3UA 2QB3A 1ZOBA 1AKCA 3VK2A 4A00A 1EJIA 1GC0A 1I29A 3JTXA 2E7UA 2PB0A 3H9XA 1BW0A 1ARTA 1UU2A 2W7EA 4J5UA 4WB0A 3RCHB 2OGAA 4F5HA 3CQ4A 1P3WA 2BI5A 2W8WA 4ZLVA 2OGEA 2CJHA 3NYTA 1GEWA 3GSBA 3QBOA 1AAMA 2DGLA 5JAYA 1B5OA 3N0LA 1MLZA 3CBFA 2HUIA 4WXFA 1DFOA 2CFBA 3R9AA 4F4EA 3B1CA 4HF8A 5EFSA 5FT8A 2VMWA 4JE5A 4ZASA 2W7KA 1ASCA 4WP0A 1ASMA 1JG8A 1DGDA 1GDEA 2BKWA 3GZDA 3NU7A 4ITXA 3RCHA 4U2HA 3WX9A 2R2NA 3ZRQA 4DQ6A 3BWNA 2OKJA 4MQPA 4EB7A 1AHEA 1AMSA 1AMAA 1X28A 4IYOB 3JW9A 4OBUA 1QJ3A 3EUCA 4B9BA 1AMQA 1KAFA 2CJDA 4XJLA 4WBTA 1GD9A 3OP7A 2VMSA 1SZKA 1AY4A 3EI8A 5G09A 2W8VA 4IXZA 4ZSWA 2HZPA 3GR9A 3I16A 3JU7A 2AATA 2BIEA 3N5MA 3ZRRA 1GCKA 4CXRA 3HMUA 4EU1A 2EPJA 1M32A 3TFUA 1LK9A 3K40A 2D5YA 4ISYA 3NNKA 2VIAA 2E7JA 2FN6A 3ELPA 2VMRA 4CXQA 2QBTA 5D95A 3I5TA 4IX8A 1ARGA 3NU8A 4LW2A 3AOWA 4IYOA 1O62A 2AY3A 2O7CA 3E2YA 5G0AA 1AX4A 3B1EA 4K05A 2DGMA 3N7NA 1WKGA 1W7LA 4R8DA 3ELEA 4AO9A 2CSTA 3B8XA 3DU4A 3NYSA 1M4NA 2GB3A 5E4ZA 1KMJA 3MC6A 3VOMA 5EAVA 4Q75A 3W1IA 1KMKA 2EZ1A 3ASAA 3RBLA 4BQ0A 1M0NA 3QM2A 2VMUA 3MC6C 3R4TA 2VMOA 1B5PA 1S06A 1ASAA 2YHKA 5G2QA 1BJWA 3GWPA 2CY8A 2E7IA 2Z9UA 3LG0A 1V72A 2F8JA 2G7JA 3E77A 1LC5A 1IX8A 4OMAA 2QSRA 2YKVA 3MADA 3G0TA 1BJNA 1QGNA 1C9CA 4KAMA 4L0OA 1C0NA 1ASDA 1PG8A 2ZY2A 3DZZA 3RI6A 4ADEA 2O1BA 1KKJA 4P7YA 4RAEA 3HDOA 3VK3A 4AZJA 3BCAA 3E6GA 4ZDPA 1ASGA 1QIRA 4AO4A 3FCRA 1ARHA 1QZ9A 1H1CA 1IBJA 2VIBA 2VMVA 1I48A 3AEJA 3ATHA 3BWOA 3QPGA 1PMOA 1GEXA 5EIGA 1B9IA 3TCMA 5DX5A 2D61A 4W1VA 1U08A 2X3LA 2VI9A 3HLMA 1IX7A 1IAYA 5C6UA 1RV3A 2D7ZA 3NDNA 4JF1A 3WCNA 3DXWA 1AJSA 2ZUKA 1QISA 1VEFA 2NMPA 3AATA 4U1TA 1KKPA 3ZRPA 4UOYA 3OKSA 3UE8A 2WB6A 2CTZA 4XAUA 4XQ2A 1AIBA 3PPLA 2AY2A 2VMYA 3BCBA 5FT5A 2ORDA 3FZ6A 2C0RA 4WYGA 4B98A 3BS8A 2QLRA 2BWPA 2KFPA 1GC3A 1CZCA 3AEMA 3LV2A 1DJEA 1M0PA 2EO5A 3AEMC 8AATA 4ZSYA 1UU1A 3COGA 3L44A 2YKYA 4TN4A 1V2EA 4WD2A 3FQAA 3FZ7A 3HBXA 2JGTA 3VP6A 3JWBA 3AEPA 5DB5A 3H7FA 1WYUB 1C7OA 2AY1A 1TOKA 4LW4A 4RITA 2VGSA 9AATA 1YOOA 3WGCA 2VMXA 3MEBA 4K2IA 1D7UA 2VGWA 2XBNA 4PFFA 4PIWA 2Z61A 1B9HA 1BS0A 2O0RA 4ADDA 4ZAHA 1XI9A 1D7RA 1YJSA 2AEUA 2ZC0A 2VGVA 2VGUA 3GBXA 3II0A 3AV7A 5K8BA 5IWQA 1AKAA 1AMRA 1CQ7A 3NRAA 4I8AA 4R5FA 1S09A 1D2FA 4DBCA 2HOXA 4WXBA 1BQDA 2Z1YA 4LNLA 1GC4A 1IJIA 1FC4A 2Z9VA 3JZLA 4K2MA 4UHNA 2VGTA 3E9KA 4PFNA 4UHOA 1WYUA 3P1TA 1BJ4A 1CJ0A 1YIYA 4MQRA 2X5DA 4ZDLA 3QI6A 3EZSA 3H14A 3MAFB 1ZODA 5HHYA 1DJUA 1YNUA 1AY5A 1VP4A 4ADCA 3DXVA 1LW5A 4W1WA 4JEVA 2D66A 2Z67A 4OC9A 4QGRA 2YCNA 4GRXA 1MLYA 2WK8A 3PIUA 1OXOA 1DGEA 4A0FA 1M0OA 4CVQA 5M46A 3ECDA 2VMPA 2HOZA 4EMYA 1N31A 2E54A 2DR1A 2W7HA 1QJ5A 3W1HA 3E2ZB 2CB1A 1UKJA 4F5FA 4XK1A 1MDZA 3MAFA 1YJZA 2BWNA 1RVYA 3QGUA 1CQ6A 2CANA 3QN6A 3FVSA 1G7XA 3A8UX 3LVMA 3PD6B 1CQ8A 5G4JA 2EYQA 4RLGA 2BI9A 3ACZA 3FSLA 1PFFA 1N8PA 2EH6A 3PDBB 3DYDA 5FT6A 1MDOA 3A9YA 3GZCA 4GE9A 4A6TA 4J8LA 4AZKA 1PMMA 2ZSLA 1C7NA 1E5FA 3ZZJA 1E5EA 1LC7A 4F5LA 4A6UA 1ASLA 4RJYA 5I92A 1X0MA 3KKIA 3NUBA 3KGWA 3RUYA 3KE3A 2D65A 2V1PA 4IXOA 1TARA 1Z3ZA 1GEYA 2TPLA 4EB5A 3ASBA 5BJ4A 2CH1A 2XH1A 2VLFA 1M6SA 2AY4A 5LH9A 3LWSA 1SF2A 2AEVA 4W1XA 2CH2A 3PDBA 4M2MA 2DGKA 2W8TA 3TATA 5KTBA 3DC1A 4IXSA 4Q76A 2ZY4A 3G7QA 4BMKA 3K7YA 1BJOB 3DR7A 2BIGA 2X8UA 4LNJA 4OT8A 3NX3A 2R5CB 4P3MA 4WYEA 3K28A 3EZ1A 4ZWVA 1DJ9A 1B4XA 3EI5A 4M2JA 2FM1A 2FNUA 2JJGA 2PB2A 4JF0A 4MQQA 1TOJA 3GETA 5E5IA 1I41A 4E3QA 1OXPA 4XJPA 4TV7A 3EIAA 4O6ZA 4PVFA 3NUIA 2BI3A 3FDBA 4RKCA 3RBFA 3P6KA 1SVVA 3PAAA 4E77A 1UU0A 4F5JA 5M49A 2EZ2A 3E2FA 3DR4A 3FZ8A 4M2KA 3DODA 1MAQA 2FKIA 1YIZA 3FQ7A 2YOBA 3F0HA 3NTJA 2DOUA 3AEOA 2OATA 1AJRA 4F5MA 2HOYA 3EIBA 1WYVB 2W7MA 1SZSA 2OQXA 1LW4A 1IAXA 3MBBA 1BT4A 3FKDA 1CZEA 1RV4A 4MY5A 4WYAA 2WK9A 5EUEA 2VYCA 3DRDA 3VAXA 3TFTA 4WXGA 4WYDA 1Y4IA 2FYFA 2RFVA 1S0AA 2JJHA 2CJGA 5M4BA 2QMAA 1RVUA 1X29A 4E1OA 4WYFA 2BI2A 2C7TA 2BIAA 4A0GA 4FFCA 1CL2A 1GBNA 3BB8A 2VMQA 1AHYA 4RIZA 5G2PA 3WKSA 2G6WA 3WZFA 1ELUA 3KGXA 5G4IA 2Z9WA 2FNIA 1WYVA 4GE7A 1SZUA 1FG7A 2QA3A 2HUFA 3IF2A 1TOGA 1WKHA 4CBRA 2YCPA 1SPAA 1ARSA 1OATA 1W7MA 3A9ZA 4ITGA 2D63A 2C81A 4GE4A 4AH3A 1C7GA 2JISA 3LVLB 3BN1A 1IX6A 4OTLA 1AKBA 3HT4A 2VGZA 1AHGA 3EI9A 5HXXA 2QB2A 3FVUA 4K2BA 4JEXA 2BYLA 2Z20A 4OYTA 2W8JA 4RJ0A 1ASEA 1JS3A 5DJ1A 3I4JA 4MSOA 5HDMA 3ZZKA 2V0YA 1AHXA 1J32A 4JEWA 4A0RA
chains in the Genus database with same CATH topology
3FDDA 3Q8NA 1G4XA 1S07A 3RQ1A 1AY8A 3WLXA 1N2TA 3LVJA 2BHXA 3LY1A 5D5SA 3WCOA 1MDXA 1J04A 1D7VA 4ZM4A 4Q31A 2A1VA 2W7IA 1IVRA 3N4RA 1ARIA 3FQ8A 1MAPA 3UWCA 3LVKA 4IW7A 7AATA 1X2AA 3FRKA 1O61A 2W7GA 2Z9XA 4UHMA 3BC8A 4MGRA 2BYJA 4UQVA 3VK4A 1ORDA 4TMRA 3UAKA 4ATPA 4ZDOA 4F5GA 3FVXA 3WKRA 1AAWA 2ZSMA 3AENB 1WSTA 4KYOA 1V2FA 4N0BA 4JEZA 4RKDA 3A9XA 2W7FA 3WGBA 3A2BA 3D6KA 3EI7A 1B8GA 1AHFA 2VMNA 4LC3A 1ELQA 4EFFA 3GZDC 1ZC9A 2X5FA 4FL0A 3BWNC 3L8AA 1GC2A 2AY6A 4OBVA 3HL2A 4JEYA 1BQAA 3W1JA 1ASFA 3B46A 3NYUA 2HORA 1M7YA 4Y0IA 1ASBA 1O4SA 1M0QA 2YRRA 1VJOA 1FG3A 4A72A 2GMSA 4XEWA 3G8MA 3M5UA 1AIAA 1W23A 2JJEA 3AENA 3E2ZA 2C44A 4XJOA 4E3RA 4F5KA 1ECXA 2YCTA 2CINA 1CS1A 1JS6A 2ZJGA 1ASNA 1TASA 4NOGA 4W91A 1G7WA 1MGVA 2DKBA 3PDXA 3ISLA 2WKAA 4A0HA 1SFFA 2VMZA 3PD6A 2W7DA 3TQXA 4WYCA 4R2NA 3USFA 3WY7A 2ZY3A 1W7NA 2Z1ZA 3CQ6A 2GQNA 3QHXA 4BA5A 1TOEA 4IY7A 2PO3A 1EQBA 2YKXA 4CBSA 1T3IA 1LC8A 2DKJA 2W7LA 1KL1A 3MKJA 2R0TA 5E3KA 2HUUA 4LNMA 4XJMA 5DJ9A 3AOVA 2FQ6A 5LHAA 3B1DA 3HVYA 2Q7WA 4AOAA 3FTBA 5EAAA 1TOIA 1OHYA 2EGYA 1Z7DA 5EUNA 1I43A 3F6TA 1OHWA 4MKJA 2HP2A 2AY7A 4KXKA 2BWOA 2VLHA 3FFRA 1KL2A 2JJFA 5EIGB 2YRIA 4HVKA 3PJ0A 3BCXA 4Q6RA 5FT4A 1O69A 4GDYA 3FD0A 3FFHA 3PA9A 5F9SA 2VMTA 4F5IA 1BJOA 2ZYJA 1WYTB 2W7JA 4Y0DA 4JE5D 5M4DA 1AICA 4W5KA 1AJSB 3JWAA 3IHJA 1YJYA 4ZWMA 2R5CA 4H63Q 2OKKA 2ZP7A 5BJ3A 3CAIA 1H0CA 2WK7A 4ATQA 1XEYA 1QITA 2GSAA 2D64A 4R5ZA 3AELA 5F8VA 2HP1A 2AY8A 4H51A 4A6RA 3CQ5A 3AEJC 2R5EA 1BKGA 4ADBA 3N4XA 3T32A 1YAAA 3EI6A 4GEBA 4W8IA 5EQCA 1G4VA 1WYTA 4MKKA 1DTYA 2JG2A 4Y0HA 3N75A 5AX8A 2GMUA 2W8UA 3BV0A 4OCAA 5TF5A 1LKCA 3GJUA 1V2DA 3N4SA 4N0WA 4WB0B 1IUGA 1TATA 1TPLA 3PGYA 4ZM3A 4RM1A 1D7SA 2ZY5A 2YKUA 5EUDA 3F9TA 4DGTA 3HQTA 3MAUA 1S08A 1LS3A 1C4KA 1JF9A 5J8QA 2AY9A 4BA4A 4BHDA 1OHVA 4WLHA 1DKAA 2D7YA 2VI8A 2AY5A 4GSAA 1CL1A 4WLJA 2BI1A 1EG5A 1W3UA 2QB3A 1ZOBA 1AKCA 3VK2A 4A00A 1EJIA 1GC0A 1I29A 3JTXA 2E7UA 2PB0A 3H9XA 1BW0A 1ARTA 1UU2A 2W7EA 4J5UA 4WB0A 3RCHB 2OGAA 4F5HA 3CQ4A 1P3WA 2BI5A 2W8WA 4ZLVA 2OGEA 2CJHA 3NYTA 1GEWA 3GSBA 3QBOA 1AAMA 2DGLA 5JAYA 1B5OA 3N0LA 1MLZA 3CBFA 2HUIA 4WXFA 1DFOA 2CFBA 3R9AA 4F4EA 3B1CA 4HF8A 5EFSA 5FT8A 2VMWA 4JE5A 4ZASA 2W7KA 1ASCA 4WP0A 1ASMA 1JG8A 1DGDA 1GDEA 2BKWA 3GZDA 3NU7A 4ITXA 3RCHA 4U2HA 3WX9A 2R2NA 3ZRQA 4DQ6A 3BWNA 2OKJA 4MQPA 4EB7A 1AHEA 1AMSA 1AMAA 1X28A 4IYOB 3JW9A 4OBUA 1QJ3A 3EUCA 4B9BA 1AMQA 2CJDA 4XJLA 4WBTA 1GD9A 3OP7A 2VMSA 1SZKA 1AY4A 3EI8A 5G09A 2W8VA 4IXZA 4ZSWA 2HZPA 3GR9A 3I16A 3JU7A 2AATA 2BIEA 3N5MA 3ZRRA 1GCKA 4CXRA 3HMUA 4EU1A 2EPJA 1M32A 3TFUA 1LK9A 3K40A 2D5YA 4ISYA 3NNKA 2VIAA 2E7JA 2FN6A 3ELPA 2VMRA 4CXQA 2QBTA 5D95A 3I5TA 4IX8A 1ARGA 3NU8A 4LW2A 3AOWA 4IYOA 1O62A 2AY3A 2O7CA 3E2YA 5G0AA 1AX4A 3B1EA 4K05A 2DGMA 3N7NA 1WKGA 1W7LA 4R8DA 3ELEA 4AO9A 2CSTA 3B8XA 3DU4A 3NYSA 1M4NA 2GB3A 5E4ZA 1KMJA 3MC6A 3VOMA 5EAVA 4Q75A 3W1IA 1KMKA 2EZ1A 3ASAA 3RBLA 4BQ0A 1M0NA 3QM2A 2VMUA 3MC6C 3R4TA 2VMOA 1B5PA 1S06A 1ASAA 2YHKA 5G2QA 1BJWA 3GWPA 2CY8A 2E7IA 2Z9UA 3LG0A 1V72A 2F8JA 2G7JA 3E77A 1LC5A 1IX8A 4OMAA 2QSRA 2YKVA 3MADA 3G0TA 1BJNA 1QGNA 1C9CA 4KAMA 4L0OA 1C0NA 1ASDA 1PG8A 2ZY2A 3DZZA 3RI6A 4ADEA 2O1BA 1KKJA 4P7YA 4RAEA 3HDOA 3VK3A 4AZJA 3BCAA 3E6GA 4ZDPA 1ASGA 1QIRA 4AO4A 3FCRA 1ARHA 1QZ9A 1H1CA 1IBJA 2VIBA 2VMVA 1I48A 3AEJA 3ATHA 3BWOA 3QPGA 1PMOA 1GEXA 5EIGA 1B9IA 3TCMA 5DX5A 2D61A 4W1VA 1U08A 2X3LA 2VI9A 3HLMA 1IX7A 1IAYA 5C6UA 1RV3A 2D7ZA 3NDNA 4JF1A 3WCNA 3DXWA 1AJSA 2ZUKA 1QISA 1VEFA 2NMPA 3AATA 4U1TA 1KKPA 3ZRPA 4UOYA 3OKSA 3UE8A 2WB6A 2CTZA 4XAUA 4XQ2A 1AIBA 3PPLA 2AY2A 2VMYA 3BCBA 5FT5A 2ORDA 3FZ6A 2C0RA 4WYGA 4B98A 3BS8A 2QLRA 2BWPA 2KFPA 1GC3A 1CZCA 3AEMA 3LV2A 1DJEA 1M0PA 2EO5A 3AEMC 8AATA 4ZSYA 1UU1A 3COGA 3L44A 2YKYA 4TN4A 1V2EA 4WD2A 3FQAA 3FZ7A 3HBXA 2JGTA 3VP6A 3JWBA 3AEPA 5DB5A 3H7FA 1WYUB 1C7OA 2AY1A 1TOKA 4LW4A 4RITA 2VGSA 9AATA 1YOOA 3WGCA 2VMXA 3MEBA 4K2IA 1D7UA 2VGWA 2XBNA 4PFFA 4PIWA 2Z61A 1B9HA 1BS0A 2O0RA 4ADDA 4ZAHA 1XI9A 1D7RA 1YJSA 2AEUA 2ZC0A 2VGVA 2VGUA 3GBXA 3II0A 3AV7A 5K8BA 5IWQA 1AKAA 1AMRA 1CQ7A 3NRAA 4I8AA 4R5FA 1S09A 1D2FA 4DBCA 2HOXA 4WXBA 1BQDA 2Z1YA 4LNLA 1GC4A 1IJIA 1FC4A 2Z9VA 3JZLA 4K2MA 4UHNA 2VGTA 3E9KA 4PFNA 4UHOA 1WYUA 3P1TA 1BJ4A 1CJ0A 1YIYA 4MQRA 2X5DA 4ZDLA 3QI6A 3EZSA 3H14A 3MAFB 1ZODA 5HHYA 1DJUA 1YNUA 1AY5A 1VP4A 4ADCA 3DXVA 1LW5A 4W1WA 4JEVA 2D66A 2Z67A 4OC9A 4QGRA 2YCNA 4GRXA 1MLYA 2WK8A 3PIUA 1OXOA 1DGEA 4A0FA 1M0OA 4CVQA 5M46A 3ECDA 2VMPA 2HOZA 4EMYA 1N31A 2E54A 2DR1A 2W7HA 1QJ5A 3W1HA 3E2ZB 2CB1A 1UKJA 4F5FA 4XK1A 1MDZA 3MAFA 1YJZA 2BWNA 1RVYA 3QGUA 1CQ6A 2CANA 3QN6A 3FVSA 1G7XA 3A8UX 3LVMA 3PD6B 1CQ8A 5G4JA 2EYQA 4RLGA 2BI9A 3ACZA 3FSLA 1PFFA 1N8PA 2EH6A 3PDBB 3DYDA 5FT6A 1MDOA 3A9YA 3GZCA 4GE9A 4A6TA 4J8LA 4AZKA 1PMMA 2ZSLA 1C7NA 1E5FA 3ZZJA 1E5EA 1LC7A 4F5LA 4A6UA 1ASLA 4RJYA 5I92A 1X0MA 3KKIA 3NUBA 3KGWA 3RUYA 3KE3A 2D65A 2V1PA 4IXOA 1TARA 1Z3ZA 1GEYA 2TPLA 4EB5A 3ASBA 5BJ4A 2CH1A 2XH1A 2VLFA 1M6SA 2AY4A 5LH9A 3LWSA 1SF2A 2AEVA 4W1XA 2CH2A 3PDBA 4M2MA 2DGKA 2W8TA 3TATA 5KTBA 3DC1A 4IXSA 4Q76A 2ZY4A 3G7QA 4BMKA 3K7YA 1BJOB 3DR7A 2BIGA 2X8UA 4LNJA 4OT8A 3NX3A 2R5CB 4P3MA 4WYEA 3K28A 3EZ1A 4ZWVA 1DJ9A 1B4XA 3EI5A 4M2JA 2FM1A 2FNUA 2JJGA 2PB2A 4JF0A 4MQQA 1TOJA 3GETA 5E5IA 1I41A 4E3QA 1OXPA 4XJPA 4TV7A 3EIAA 4O6ZA 4PVFA 3NUIA 2BI3A 3FDBA 4RKCA 3RBFA 3P6KA 1SVVA 3PAAA 4E77A 1UU0A 4F5JA 5M49A 2EZ2A 3E2FA 3DR4A 3FZ8A 4M2KA 3DODA 1MAQA 2FKIA 1YIZA 3FQ7A 2YOBA 3F0HA 3NTJA 2DOUA 3AEOA 2OATA 1AJRA 4F5MA 2HOYA 3EIBA 1WYVB 2W7MA 1SZSA 2OQXA 1LW4A 1IAXA 3MBBA 1BT4A 3FKDA 1CZEA 1RV4A 4MY5A 4WYAA 2WK9A 5EUEA 2VYCA 3DRDA 3VAXA 3TFTA 4WXGA 4WYDA 1Y4IA 2FYFA 2RFVA 1S0AA 2JJHA 2CJGA 5M4BA 2QMAA 1RVUA 1X29A 4E1OA 4WYFA 2BI2A 2C7TA 2BIAA 4A0GA 4FFCA 1CL2A 1GBNA 3BB8A 2VMQA 1AHYA 4RIZA 5G2PA 3WKSA 2G6WA 3WZFA 1ELUA 3KGXA 5G4IA 2Z9WA 2FNIA 1WYVA 4GE7A 1SZUA 1FG7A 2QA3A 2HUFA 3IF2A 1TOGA 1WKHA 4CBRA 2YCPA 1SPAA 1ARSA 1OATA 1W7MA 3A9ZA 4ITGA 2D63A 2C81A 4GE4A 4AH3A 1C7GA 2JISA 3LVLB 3BN1A 1IX6A 4OTLA 1AKBA 3HT4A 2VGZA 1AHGA 3EI9A 5HXXA 2QB2A 3FVUA 4K2BA 4JEXA 2BYLA 2Z20A 4OYTA 2W8JA 4RJ0A 1ASEA 1JS3A 5DJ1A 3I4JA 4MSOA 5HDMA 3ZZKA 2V0YA 1AHXA 1J32A 4JEWA 4A0RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FDD A;  3Q8N A;  1G4X A;  1S07 A;  3RQ1 A;  1AY8 A;  3WLX A;  1N2T A;  3LVJ A;  2BHX A;  3LY1 A;  5D5S A;  3WCO A;  1MDX A;  1J04 A;  1D7V A;  4ZM4 A;  4Q31 A;  2W7I A;  1IVR A;  1ARI A;  3FQ8 A;  1MAP A;  3UWC A;  3LVK A;  4IW7 A;  7AAT A;  1X2A A;  3FRK A;  1O61 A;  2W7G A;  2Z9X A;  4UHM A;  3BC8 A;  4MGR A;  2BYJ A;  4UQV A;  3VK4 A;  1ORD A;  4TMR A;  3UAK A;  4ATP A;  4ZDO A;  4F5G A;  3FVX A;  3WKR A;  1AAW A;  2ZSM A;  3AEN B;  1WST A;  4KYO A;  1V2F A;  4N0B A;  4JEZ A;  4RKD A;  3A9X A;  2W7F A;  3WGB A;  3A2B A;  3D6K A;  3EI7 A;  1B8G A;  1AHF A;  2VMN A;  4LC3 A;  1ELQ A;  4EFF A;  3GZD C;  1ZC9 A;  2X5F A;  4FL0 A;  3BWN C;  3L8A A;  1GC2 A;  2AY6 A;  4OBV A;  3HL2 A;  4JEY A;  1BQA A;  3W1J A;  1ASF A;  3B46 A;  3NYU A;  2HOR A;  1M7Y A;  4Y0I A;  1ASB A;  1O4S A;  1M0Q A;  2YRR A;  1VJO A;  1FG3 A;  4A72 A;  2GMS A;  4XEW A;  3G8M A;  3M5U A;  1AIA A;  1W23 A;  2JJE A;  3AEN A;  3E2Z A;  2C44 A;  4XJO A;  4E3R A;  4F5K A;  1ECX A;  2YCT A;  2CIN A;  1CS1 A;  1JS6 A;  2ZJG A;  1ASN A;  1TAS A;  4NOG A;  4W91 A;  1G7W A;  1MGV A;  2DKB A;  3PDX A;  3ISL A;  2WKA A;  4A0H A;  1SFF A;  2VMZ A;  3PD6 A;  2W7D A;  3TQX A;  4WYC A;  4R2N A;  3USF A;  3WY7 A;  2ZY3 A;  1W7N A;  2Z1Z A;  3CQ6 A;  2GQN A;  3QHX A;  4BA5 A;  1TOE A;  4IY7 A;  2PO3 A;  1EQB A;  2YKX A;  4CBS A;  1T3I A;  1LC8 A;  2DKJ A;  2W7L A;  1KL1 A;  3MKJ A;  2R0T A;  5E3K A;  2HUU A;  4LNM A;  4XJM A;  5DJ9 A;  3AOV A;  2FQ6 A;  5LHA A;  3B1D A;  3HVY A;  2Q7W A;  4AOA A;  3FTB A;  5EAA A;  1TOI A;  1OHY A;  2EGY A;  1Z7D A;  5EUN A;  1I43 A;  3F6T A;  1OHW A;  4MKJ A;  2HP2 A;  2AY7 A;  4KXK A;  2BWO A;  2VLH A;  3FFR A;  1KL2 A;  2JJF A;  5EIG B;  2YRI A;  4HVK A;  3PJ0 A;  3BCX A;  4Q6R A;  5FT4 A;  1O69 A;  4GDY A;  3FD0 A;  3FFH A;  3PA9 A;  5F9S A;  2VMT A;  4F5I A;  1BJO A;  2ZYJ A;  1WYT B;  2W7J A;  4Y0D A;  4JE5 D;  5M4D A;  1AIC A;  4W5K A;  1AJS B;  3JWA A;  3IHJ A;  1YJY A;  4ZWM A;  2R5C A;  2OKK A;  2ZP7 A;  5BJ3 A;  3CAI A;  1H0C A;  2WK7 A;  4ATQ A;  1XEY A;  1QIT A;  2GSA A;  2D64 A;  4R5Z A;  3AEL A;  5F8V A;  2HP1 A;  2AY8 A;  4H51 A;  4A6R A;  3CQ5 A;  3AEJ C;  2R5E A;  1BKG A;  4ADB A;  3T32 A;  1YAA A;  3EI6 A;  4GEB A;  4W8I A;  5EQC A;  1G4V A;  1WYT A;  4MKK A;  1DTY A;  2JG2 A;  4Y0H A;  3N75 A;  5AX8 A;  2GMU A;  2W8U A;  3BV0 A;  4OCA A;  5TF5 A;  1LKC A;  3GJU A;  1V2D A;  4N0W A;  4WB0 B;  1IUG A;  1TAT A;  1TPL A;  3PGY A;  4ZM3 A;  4RM1 A;  1D7S A;  2ZY5 A;  2YKU A;  5EUD A;  3F9T A;  4DGT A;  3HQT A;  3MAU A;  1S08 A;  1LS3 A;  1C4K A;  1JF9 A;  5J8Q A;  2AY9 A;  4BA4 A;  4BHD A;  1OHV A;  4WLH A;  1DKA A;  2D7Y A;  2VI8 A;  2AY5 A;  4GSA A;  1CL1 A;  4WLJ A;  2BI1 A;  1EG5 A;  1W3U A;  2QB3 A;  1ZOB A;  1AKC A;  3VK2 A;  4A00 A;  1EJI A;  1GC0 A;  1I29 A;  3JTX A;  2E7U A;  2PB0 A;  1BW0 A;  1ART A;  1UU2 A;  2W7E A;  4J5U A;  4WB0 A;  3RCH B;  2OGA A;  4F5H A;  3CQ4 A;  1P3W A;  2BI5 A;  2W8W A;  4ZLV A;  2OGE A;  2CJH A;  3NYT A;  1GEW A;  3GSB A;  3QBO A;  1AAM A;  2DGL A;  5JAY A;  1B5O A;  3N0L A;  1MLZ A;  3CBF A;  2HUI A;  4WXF A;  1DFO A;  2CFB A;  3R9A A;  4F4E A;  3B1C A;  4HF8 A;  5EFS A;  5FT8 A;  2VMW A;  4JE5 A;  4ZAS A;  2W7K A;  1ASC A;  4WP0 A;  1ASM A;  1JG8 A;  1DGD A;  1GDE A;  2BKW A;  3GZD A;  3NU7 A;  4ITX A;  3RCH A;  4U2H A;  3WX9 A;  2R2N A;  3ZRQ A;  4DQ6 A;  3BWN A;  2OKJ A;  4MQP A;  4EB7 A;  1AHE A;  1AMS A;  1AMA A;  1X28 A;  4IYO B;  3JW9 A;  4OBU A;  1QJ3 A;  3EUC A;  4B9B A;  1AMQ A;  2CJD A;  4XJL A;  4WBT A;  1GD9 A;  3OP7 A;  2VMS A;  1SZK A;  1AY4 A;  3EI8 A;  5G09 A;  2W8V A;  4IXZ A;  4ZSW A;  2HZP A;  3GR9 A;  3I16 A;  3JU7 A;  2AAT A;  2BIE A;  3N5M A;  3ZRR A;  1GCK A;  4CXR A;  3HMU A;  4EU1 A;  2EPJ A;  1M32 A;  3TFU A;  1LK9 A;  3K40 A;  2D5Y A;  4ISY A;  3NNK A;  2VIA A;  2E7J A;  2FN6 A;  3ELP A;  2VMR A;  4CXQ A;  2QBT A;  5D95 A;  3I5T A;  4IX8 A;  1ARG A;  3NU8 A;  4LW2 A;  3AOW A;  4IYO A;  1O62 A;  2AY3 A;  2O7C A;  3E2Y A;  5G0A A;  1AX4 A;  3B1E A;  2DGM A;  1WKG A;  1W7L A;  4R8D A;  3ELE A;  4AO9 A;  2CST A;  3B8X A;  3DU4 A;  3NYS A;  1M4N A;  2GB3 A;  5E4Z A;  1KMJ A;  3MC6 A;  3VOM A;  5EAV A;  4Q75 A;  3W1I A;  1KMK A;  2EZ1 A;  3ASA A;  3RBL A;  4BQ0 A;  1M0N A;  3QM2 A;  2VMU A;  3MC6 C;  3R4T A;  2VMO A;  1B5P A;  1S06 A;  1ASA A;  2YHK A;  5G2Q A;  1BJW A;  3GWP A;  2CY8 A;  2E7I A;  2Z9U A;  3LG0 A;  1V72 A;  2F8J A;  3E77 A;  1LC5 A;  1IX8 A;  4OMA A;  2YKV A;  3MAD A;  3G0T A;  1BJN A;  1QGN A;  1C9C A;  4KAM A;  4L0O A;  1C0N A;  1ASD A;  1PG8 A;  2ZY2 A;  3DZZ A;  3RI6 A;  4ADE A;  2O1B A;  1KKJ A;  4P7Y A;  4RAE A;  3HDO A;  3VK3 A;  4AZJ A;  3BCA A;  3E6G A;  4ZDP A;  1ASG A;  1QIR A;  4AO4 A;  3FCR A;  1ARH A;  1QZ9 A;  1H1C A;  1IBJ A;  2VIB A;  2VMV A;  1I48 A;  3AEJ A;  3ATH A;  3BWO A;  3QPG A;  1PMO A;  1GEX A;  5EIG A;  1B9I A;  3TCM A;  5DX5 A;  2D61 A;  4W1V A;  1U08 A;  2X3L A;  2VI9 A;  3HLM A;  1IX7 A;  1IAY A;  5C6U A;  1RV3 A;  2D7Z A;  3NDN A;  4JF1 A;  3WCN A;  3DXW A;  1AJS A;  2ZUK A;  1QIS A;  1VEF A;  2NMP A;  3AAT A;  4U1T A;  1KKP A;  3ZRP A;  4UOY A;  3OKS A;  3UE8 A;  2CTZ A;  4XAU A;  4XQ2 A;  1AIB A;  3PPL A;  2AY2 A;  2VMY A;  3BCB A;  5FT5 A;  2ORD A;  3FZ6 A;  2C0R A;  4WYG A;  4B98 A;  3BS8 A;  2QLR A;  2BWP A;  1GC3 A;  1CZC A;  3AEM A;  3LV2 A;  1DJE A;  1M0P A;  2EO5 A;  3AEM C;  8AAT A;  4ZSY A;  1UU1 A;  3COG A;  3L44 A;  2YKY A;  4TN4 A;  1V2E A;  4WD2 A;  3FQA A;  3FZ7 A;  3HBX A;  2JGT A;  3VP6 A;  3JWB A;  3AEP A;  5DB5 A;  3H7F A;  1WYU B;  1C7O A;  2AY1 A;  1TOK A;  4LW4 A;  4RIT A;  2VGS A;  9AAT A;  1YOO A;  3WGC A;  2VMX A;  3MEB A;  4K2I A;  1D7U A;  2VGW A;  2XBN A;  4PFF A;  4PIW A;  2Z61 A;  1B9H A;  1BS0 A;  2O0R A;  4ADD A;  4ZAH A;  1XI9 A;  1D7R A;  1YJS A;  2AEU A;  2ZC0 A;  2VGV A;  2VGU A;  3GBX A;  3II0 A;  3AV7 A;  5K8B A;  5IWQ A;  1AKA A;  1AMR A;  1CQ7 A;  3NRA A;  4I8A A;  4R5F A;  1S09 A;  1D2F A;  4DBC A;  2HOX A;  4WXB A;  1BQD A;  2Z1Y A;  4LNL A;  1GC4 A;  1IJI A;  1FC4 A;  2Z9V A;  3JZL A;  4K2M A;  4UHN A;  2VGT A;  3E9K A;  4PFN A;  4UHO A;  1WYU A;  3P1T A;  1BJ4 A;  1CJ0 A;  1YIY A;  4MQR A;  2X5D A;  4ZDL A;  3QI6 A;  3EZS A;  3H14 A;  3MAF B;  1ZOD A;  5HHY A;  1DJU A;  1YNU A;  1AY5 A;  1VP4 A;  4ADC A;  3DXV A;  1LW5 A;  4W1W A;  4JEV A;  2D66 A;  2Z67 A;  4OC9 A;  4QGR A;  2YCN A;  4GRX A;  1MLY A;  2WK8 A;  3PIU A;  1OXO A;  1DGE A;  4A0F A;  1M0O A;  4CVQ A;  5M46 A;  3ECD A;  2VMP A;  2HOZ A;  4EMY A;  1N31 A;  2E54 A;  2DR1 A;  2W7H A;  1QJ5 A;  3W1H A;  3E2Z B;  2CB1 A;  1UKJ A;  4F5F A;  4XK1 A;  1MDZ A;  3MAF A;  1YJZ A;  2BWN A;  1RVY A;  3QGU A;  1CQ6 A;  2CAN A;  3QN6 A;  3FVS A;  1G7X A;  3A8U X;  3LVM A;  3PD6 B;  1CQ8 A;  5G4J A;  4RLG A;  2BI9 A;  3ACZ A;  3FSL A;  1PFF A;  1N8P A;  2EH6 A;  3PDB B;  3DYD A;  5FT6 A;  1MDO A;  3A9Y A;  3GZC A;  4GE9 A;  4A6T A;  4J8L A;  4AZK A;  1PMM A;  2ZSL A;  1C7N A;  1E5F A;  3ZZJ A;  1E5E A;  1LC7 A;  4F5L A;  4A6U A;  1ASL A;  4RJY A;  5I92 A;  1X0M A;  3KKI A;  3NUB A;  3KGW A;  3RUY A;  3KE3 A;  2D65 A;  2V1P A;  4IXO A;  1TAR A;  1Z3Z A;  1GEY A;  2TPL A;  4EB5 A;  3ASB A;  5BJ4 A;  2CH1 A;  2XH1 A;  2VLF A;  1M6S A;  2AY4 A;  5LH9 A;  3LWS A;  1SF2 A;  2AEV A;  4W1X A;  2CH2 A;  3PDB A;  4M2M A;  2DGK A;  2W8T A;  3TAT A;  3DC1 A;  4IXS A;  4Q76 A;  2ZY4 A;  3G7Q A;  4BMK A;  3K7Y A;  1BJO B;  3DR7 A;  2BIG A;  2X8U A;  4LNJ A;  4OT8 A;  3NX3 A;  2R5C B;  4P3M A;  4WYE A;  3K28 A;  3EZ1 A;  4ZWV A;  1DJ9 A;  1B4X A;  3EI5 A;  4M2J A;  2FM1 A;  2FNU A;  2JJG A;  2PB2 A;  4JF0 A;  4MQQ A;  1TOJ A;  3GET A;  5E5I A;  1I41 A;  4E3Q A;  1OXP A;  4XJP A;  4TV7 A;  3EIA A;  4O6Z A;  4PVF A;  3NUI A;  2BI3 A;  3FDB A;  4RKC A;  3RBF A;  3P6K A;  1SVV A;  3PAA A;  4E77 A;  1UU0 A;  4F5J A;  5M49 A;  2EZ2 A;  3E2F A;  3DR4 A;  3FZ8 A;  4M2K A;  3DOD A;  1MAQ A;  1YIZ A;  3FQ7 A;  2YOB A;  3F0H A;  3NTJ A;  2DOU A;  3AEO A;  2OAT A;  1AJR A;  4F5M A;  2HOY A;  3EIB A;  1WYV B;  2W7M A;  1SZS A;  2OQX A;  1LW4 A;  1IAX A;  3MBB A;  1BT4 A;  3FKD A;  1CZE A;  1RV4 A;  4MY5 A;  4WYA A;  2WK9 A;  5EUE A;  2VYC A;  3DRD A;  3VAX A;  3TFT A;  4WXG A;  4WYD A;  1Y4I A;  2FYF A;  2RFV A;  1S0A A;  2JJH A;  2CJG A;  5M4B A;  2QMA A;  1RVU A;  1X29 A;  4E1O A;  4WYF A;  2BI2 A;  2C7T A;  2BIA A;  4A0G A;  4FFC A;  1CL2 A;  1GBN A;  3BB8 A;  2VMQ A;  1AHY A;  4RIZ A;  5G2P A;  3WKS A;  2G6W A;  3WZF A;  1ELU A;  3KGX A;  5G4I A;  2Z9W A;  2FNI A;  1WYV A;  4GE7 A;  1SZU A;  1FG7 A;  2QA3 A;  2HUF A;  3IF2 A;  1TOG A;  1WKH A;  4CBR A;  2YCP A;  1SPA A;  1ARS A;  1OAT A;  1W7M A;  3A9Z A;  4ITG A;  2D63 A;  2C81 A;  4GE4 A;  4AH3 A;  1C7G A;  2JIS A;  3LVL B;  3BN1 A;  1IX6 A;  4OTL A;  1AKB A;  3HT4 A;  2VGZ A;  1AHG A;  3EI9 A;  5HXX A;  2QB2 A;  3FVU A;  4K2B A;  4JEX A;  2BYL A;  2Z20 A;  4OYT A;  2W8J A;  4RJ0 A;  1ASE A;  1JS3 A;  5DJ1 A;  3I4J A;  4MSO A;  5HDM A;  3ZZK A;  2V0Y A;  1AHX A;  1J32 A;  4JEW A;  4A0R A; 
#chains in the Genus database with same CATH topology
 3FDD A;  3Q8N A;  1G4X A;  1S07 A;  3RQ1 A;  1AY8 A;  3WLX A;  1N2T A;  3LVJ A;  2BHX A;  3LY1 A;  5D5S A;  3WCO A;  1MDX A;  1J04 A;  1D7V A;  4ZM4 A;  4Q31 A;  2A1V A;  2W7I A;  1IVR A;  3N4R A;  1ARI A;  3FQ8 A;  1MAP A;  3UWC A;  3LVK A;  4IW7 A;  7AAT A;  1X2A A;  3FRK A;  1O61 A;  2W7G A;  2Z9X A;  4UHM A;  3BC8 A;  4MGR A;  2BYJ A;  4UQV A;  3VK4 A;  1ORD A;  4TMR A;  3UAK A;  4ATP A;  4ZDO A;  4F5G A;  3FVX A;  3WKR A;  1AAW A;  2ZSM A;  3AEN B;  1WST A;  4KYO A;  1V2F A;  4N0B A;  4JEZ A;  4RKD A;  3A9X A;  2W7F A;  3WGB A;  3A2B A;  3D6K A;  3EI7 A;  1B8G A;  1AHF A;  2VMN A;  4LC3 A;  1ELQ A;  4EFF A;  3GZD C;  1ZC9 A;  2X5F A;  4FL0 A;  3BWN C;  3L8A A;  1GC2 A;  2AY6 A;  4OBV A;  3HL2 A;  4JEY A;  1BQA A;  3W1J A;  1ASF A;  3B46 A;  3NYU A;  2HOR A;  1M7Y A;  4Y0I A;  1ASB A;  1O4S A;  1M0Q A;  2YRR A;  1VJO A;  1FG3 A;  4A72 A;  2GMS A;  4XEW A;  3G8M A;  3M5U A;  1AIA A;  1W23 A;  2JJE A;  3AEN A;  3E2Z A;  2C44 A;  4XJO A;  4E3R A;  4F5K A;  1ECX A;  2YCT A;  2CIN A;  1CS1 A;  1JS6 A;  2ZJG A;  1ASN A;  1TAS A;  4NOG A;  4W91 A;  1G7W A;  1MGV A;  2DKB A;  3PDX A;  3ISL A;  2WKA A;  4A0H A;  1SFF A;  2VMZ A;  3PD6 A;  2W7D A;  3TQX A;  4WYC A;  4R2N A;  3USF A;  3WY7 A;  2ZY3 A;  1W7N A;  2Z1Z A;  3CQ6 A;  2GQN A;  3QHX A;  4BA5 A;  1TOE A;  4IY7 A;  2PO3 A;  1EQB A;  2YKX A;  4CBS A;  1T3I A;  1LC8 A;  2DKJ A;  2W7L A;  1KL1 A;  3MKJ A;  2R0T A;  5E3K A;  2HUU A;  4LNM A;  4XJM A;  5DJ9 A;  3AOV A;  2FQ6 A;  5LHA A;  3B1D A;  3HVY A;  2Q7W A;  4AOA A;  3FTB A;  5EAA A;  1TOI A;  1OHY A;  2EGY A;  1Z7D A;  5EUN A;  1I43 A;  3F6T A;  1OHW A;  4MKJ A;  2HP2 A;  2AY7 A;  4KXK A;  2BWO A;  2VLH A;  3FFR A;  1KL2 A;  2JJF A;  5EIG B;  2YRI A;  4HVK A;  3PJ0 A;  3BCX A;  4Q6R A;  5FT4 A;  1O69 A;  4GDY A;  3FD0 A;  3FFH A;  3PA9 A;  5F9S A;  2VMT A;  4F5I A;  1BJO A;  2ZYJ A;  1WYT B;  2W7J A;  4Y0D A;  4JE5 D;  5M4D A;  1AIC A;  4W5K A;  1AJS B;  3JWA A;  3IHJ A;  1YJY A;  4ZWM A;  2R5C A;  4H63 Q;  2OKK A;  2ZP7 A;  5BJ3 A;  3CAI A;  1H0C A;  2WK7 A;  4ATQ A;  1XEY A;  1QIT A;  2GSA A;  2D64 A;  4R5Z A;  3AEL A;  5F8V A;  2HP1 A;  2AY8 A;  4H51 A;  4A6R A;  3CQ5 A;  3AEJ C;  2R5E A;  1BKG A;  4ADB A;  3N4X A;  3T32 A;  1YAA A;  3EI6 A;  4GEB A;  4W8I A;  5EQC A;  1G4V A;  1WYT A;  4MKK A;  1DTY A;  2JG2 A;  4Y0H A;  3N75 A;  5AX8 A;  2GMU A;  2W8U A;  3BV0 A;  4OCA A;  5TF5 A;  1LKC A;  3GJU A;  1V2D A;  3N4S A;  4N0W A;  4WB0 B;  1IUG A;  1TAT A;  1TPL A;  3PGY A;  4ZM3 A;  4RM1 A;  1D7S A;  2ZY5 A;  2YKU A;  5EUD A;  3F9T A;  4DGT A;  3HQT A;  3MAU A;  1S08 A;  1LS3 A;  1C4K A;  1JF9 A;  5J8Q A;  2AY9 A;  4BA4 A;  4BHD A;  1OHV A;  4WLH A;  1DKA A;  2D7Y A;  2VI8 A;  2AY5 A;  4GSA A;  1CL1 A;  4WLJ A;  2BI1 A;  1EG5 A;  1W3U A;  2QB3 A;  1ZOB A;  1AKC A;  3VK2 A;  4A00 A;  1EJI A;  1GC0 A;  1I29 A;  3JTX A;  2E7U A;  2PB0 A;  3H9X A;  1BW0 A;  1ART A;  1UU2 A;  2W7E A;  4J5U A;  4WB0 A;  3RCH B;  2OGA A;  4F5H A;  3CQ4 A;  1P3W A;  2BI5 A;  2W8W A;  4ZLV A;  2OGE A;  2CJH A;  3NYT A;  1GEW A;  3GSB A;  3QBO A;  1AAM A;  2DGL A;  5JAY A;  1B5O A;  3N0L A;  1MLZ A;  3CBF A;  2HUI A;  4WXF A;  1DFO A;  2CFB A;  3R9A A;  4F4E A;  3B1C A;  4HF8 A;  5EFS A;  5FT8 A;  2VMW A;  4JE5 A;  4ZAS A;  2W7K A;  1ASC A;  4WP0 A;  1ASM A;  1JG8 A;  1DGD A;  1GDE A;  2BKW A;  3GZD A;  3NU7 A;  4ITX A;  3RCH A;  4U2H A;  3WX9 A;  2R2N A;  3ZRQ A;  4DQ6 A;  3BWN A;  2OKJ A;  4MQP A;  4EB7 A;  1AHE A;  1AMS A;  1AMA A;  1X28 A;  4IYO B;  3JW9 A;  4OBU A;  1QJ3 A;  3EUC A;  4B9B A;  1AMQ A;  1KAF A;  2CJD A;  4XJL A;  4WBT A;  1GD9 A;  3OP7 A;  2VMS A;  1SZK A;  1AY4 A;  3EI8 A;  5G09 A;  2W8V A;  4IXZ A;  4ZSW A;  2HZP A;  3GR9 A;  3I16 A;  3JU7 A;  2AAT A;  2BIE A;  3N5M A;  3ZRR A;  1GCK A;  4CXR A;  3HMU A;  4EU1 A;  2EPJ A;  1M32 A;  3TFU A;  1LK9 A;  3K40 A;  2D5Y A;  4ISY A;  3NNK A;  2VIA A;  2E7J A;  2FN6 A;  3ELP A;  2VMR A;  4CXQ A;  2QBT A;  5D95 A;  3I5T A;  4IX8 A;  1ARG A;  3NU8 A;  4LW2 A;  3AOW A;  4IYO A;  1O62 A;  2AY3 A;  2O7C A;  3E2Y A;  5G0A A;  1AX4 A;  3B1E A;  4K05 A;  2DGM A;  3N7N A;  1WKG A;  1W7L A;  4R8D A;  3ELE A;  4AO9 A;  2CST A;  3B8X A;  3DU4 A;  3NYS A;  1M4N A;  2GB3 A;  5E4Z A;  1KMJ A;  3MC6 A;  3VOM A;  5EAV A;  4Q75 A;  3W1I A;  1KMK A;  2EZ1 A;  3ASA A;  3RBL A;  4BQ0 A;  1M0N A;  3QM2 A;  2VMU A;  3MC6 C;  3R4T A;  2VMO A;  1B5P A;  1S06 A;  1ASA A;  2YHK A;  5G2Q A;  1BJW A;  3GWP A;  2CY8 A;  2E7I A;  2Z9U A;  3LG0 A;  1V72 A;  2F8J A;  2G7J A;  3E77 A;  1LC5 A;  1IX8 A;  4OMA A;  2QSR A;  2YKV A;  3MAD A;  3G0T A;  1BJN A;  1QGN A;  1C9C A;  4KAM A;  4L0O A;  1C0N A;  1ASD A;  1PG8 A;  2ZY2 A;  3DZZ A;  3RI6 A;  4ADE A;  2O1B A;  1KKJ A;  4P7Y A;  4RAE A;  3HDO A;  3VK3 A;  4AZJ A;  3BCA A;  3E6G A;  4ZDP A;  1ASG A;  1QIR A;  4AO4 A;  3FCR A;  1ARH A;  1QZ9 A;  1H1C A;  1IBJ A;  2VIB A;  2VMV A;  1I48 A;  3AEJ A;  3ATH A;  3BWO A;  3QPG A;  1PMO A;  1GEX A;  5EIG A;  1B9I A;  3TCM A;  5DX5 A;  2D61 A;  4W1V A;  1U08 A;  2X3L A;  2VI9 A;  3HLM A;  1IX7 A;  1IAY A;  5C6U A;  1RV3 A;  2D7Z A;  3NDN A;  4JF1 A;  3WCN A;  3DXW A;  1AJS A;  2ZUK A;  1QIS A;  1VEF A;  2NMP A;  3AAT A;  4U1T A;  1KKP A;  3ZRP A;  4UOY A;  3OKS A;  3UE8 A;  2WB6 A;  2CTZ A;  4XAU A;  4XQ2 A;  1AIB A;  3PPL A;  2AY2 A;  2VMY A;  3BCB A;  5FT5 A;  2ORD A;  3FZ6 A;  2C0R A;  4WYG A;  4B98 A;  3BS8 A;  2QLR A;  2BWP A;  2KFP A;  1GC3 A;  1CZC A;  3AEM A;  3LV2 A;  1DJE A;  1M0P A;  2EO5 A;  3AEM C;  8AAT A;  4ZSY A;  1UU1 A;  3COG A;  3L44 A;  2YKY A;  4TN4 A;  1V2E A;  4WD2 A;  3FQA A;  3FZ7 A;  3HBX A;  2JGT A;  3VP6 A;  3JWB A;  3AEP A;  5DB5 A;  3H7F A;  1WYU B;  1C7O A;  2AY1 A;  1TOK A;  4LW4 A;  4RIT A;  2VGS A;  9AAT A;  1YOO A;  3WGC A;  2VMX A;  3MEB A;  4K2I A;  1D7U A;  2VGW A;  2XBN A;  4PFF A;  4PIW A;  2Z61 A;  1B9H A;  1BS0 A;  2O0R A;  4ADD A;  4ZAH A;  1XI9 A;  1D7R A;  1YJS A;  2AEU A;  2ZC0 A;  2VGV A;  2VGU A;  3GBX A;  3II0 A;  3AV7 A;  5K8B A;  5IWQ A;  1AKA A;  1AMR A;  1CQ7 A;  3NRA A;  4I8A A;  4R5F A;  1S09 A;  1D2F A;  4DBC A;  2HOX A;  4WXB A;  1BQD A;  2Z1Y A;  4LNL A;  1GC4 A;  1IJI A;  1FC4 A;  2Z9V A;  3JZL A;  4K2M A;  4UHN A;  2VGT A;  3E9K A;  4PFN A;  4UHO A;  1WYU A;  3P1T A;  1BJ4 A;  1CJ0 A;  1YIY A;  4MQR A;  2X5D A;  4ZDL A;  3QI6 A;  3EZS A;  3H14 A;  3MAF B;  1ZOD A;  5HHY A;  1DJU A;  1YNU A;  1AY5 A;  1VP4 A;  4ADC A;  3DXV A;  1LW5 A;  4W1W A;  4JEV A;  2D66 A;  2Z67 A;  4OC9 A;  4QGR A;  2YCN A;  4GRX A;  1MLY A;  2WK8 A;  3PIU A;  1OXO A;  1DGE A;  4A0F A;  1M0O A;  4CVQ A;  5M46 A;  3ECD A;  2VMP A;  2HOZ A;  4EMY A;  1N31 A;  2E54 A;  2DR1 A;  2W7H A;  1QJ5 A;  3W1H A;  3E2Z B;  2CB1 A;  1UKJ A;  4F5F A;  4XK1 A;  1MDZ A;  3MAF A;  1YJZ A;  2BWN A;  1RVY A;  3QGU A;  1CQ6 A;  2CAN A;  3QN6 A;  3FVS A;  1G7X A;  3A8U X;  3LVM A;  3PD6 B;  1CQ8 A;  5G4J A;  2EYQ A;  4RLG A;  2BI9 A;  3ACZ A;  3FSL A;  1PFF A;  1N8P A;  2EH6 A;  3PDB B;  3DYD A;  5FT6 A;  1MDO A;  3A9Y A;  3GZC A;  4GE9 A;  4A6T A;  4J8L A;  4AZK A;  1PMM A;  2ZSL A;  1C7N A;  1E5F A;  3ZZJ A;  1E5E A;  1LC7 A;  4F5L A;  4A6U A;  1ASL A;  4RJY A;  5I92 A;  1X0M A;  3KKI A;  3NUB A;  3KGW A;  3RUY A;  3KE3 A;  2D65 A;  2V1P A;  4IXO A;  1TAR A;  1Z3Z A;  1GEY A;  2TPL A;  4EB5 A;  3ASB A;  5BJ4 A;  2CH1 A;  2XH1 A;  2VLF A;  1M6S A;  2AY4 A;  5LH9 A;  3LWS A;  1SF2 A;  2AEV A;  4W1X A;  2CH2 A;  3PDB A;  4M2M A;  2DGK A;  2W8T A;  3TAT A;  5KTB A;  3DC1 A;  4IXS A;  4Q76 A;  2ZY4 A;  3G7Q A;  4BMK A;  3K7Y A;  1BJO B;  3DR7 A;  2BIG A;  2X8U A;  4LNJ A;  4OT8 A;  3NX3 A;  2R5C B;  4P3M A;  4WYE A;  3K28 A;  3EZ1 A;  4ZWV A;  1DJ9 A;  1B4X A;  3EI5 A;  4M2J A;  2FM1 A;  2FNU A;  2JJG A;  2PB2 A;  4JF0 A;  4MQQ A;  1TOJ A;  3GET A;  5E5I A;  1I41 A;  4E3Q A;  1OXP A;  4XJP A;  4TV7 A;  3EIA A;  4O6Z A;  4PVF A;  3NUI A;  2BI3 A;  3FDB A;  4RKC A;  3RBF A;  3P6K A;  1SVV A;  3PAA A;  4E77 A;  1UU0 A;  4F5J A;  5M49 A;  2EZ2 A;  3E2F A;  3DR4 A;  3FZ8 A;  4M2K A;  3DOD A;  1MAQ A;  2FKI A;  1YIZ A;  3FQ7 A;  2YOB A;  3F0H A;  3NTJ A;  2DOU A;  3AEO A;  2OAT A;  1AJR A;  4F5M A;  2HOY A;  3EIB A;  1WYV B;  2W7M A;  1SZS A;  2OQX A;  1LW4 A;  1IAX A;  3MBB A;  1BT4 A;  3FKD A;  1CZE A;  1RV4 A;  4MY5 A;  4WYA A;  2WK9 A;  5EUE A;  2VYC A;  3DRD A;  3VAX A;  3TFT A;  4WXG A;  4WYD A;  1Y4I A;  2FYF A;  2RFV A;  1S0A A;  2JJH A;  2CJG A;  5M4B A;  2QMA A;  1RVU A;  1X29 A;  4E1O A;  4WYF A;  2BI2 A;  2C7T A;  2BIA A;  4A0G A;  4FFC A;  1CL2 A;  1GBN A;  3BB8 A;  2VMQ A;  1AHY A;  4RIZ A;  5G2P A;  3WKS A;  2G6W A;  3WZF A;  1ELU A;  3KGX A;  5G4I A;  2Z9W A;  2FNI A;  1WYV A;  4GE7 A;  1SZU A;  1FG7 A;  2QA3 A;  2HUF A;  3IF2 A;  1TOG A;  1WKH A;  4CBR A;  2YCP A;  1SPA A;  1ARS A;  1OAT A;  1W7M A;  3A9Z A;  4ITG A;  2D63 A;  2C81 A;  4GE4 A;  4AH3 A;  1C7G A;  2JIS A;  3LVL B;  3BN1 A;  1IX6 A;  4OTL A;  1AKB A;  3HT4 A;  2VGZ A;  1AHG A;  3EI9 A;  5HXX A;  2QB2 A;  3FVU A;  4K2B A;  4JEX A;  2BYL A;  2Z20 A;  4OYT A;  2W8J A;  4RJ0 A;  1ASE A;  1JS3 A;  5DJ1 A;  3I4J A;  4MSO A;  5HDM A;  3ZZK A;  2V0Y A;  1AHX A;  1J32 A;  4JEW A;  4A0R A; 
#chains in the Genus database with same CATH homology
 3FDD A;  3Q8N A;  1G4X A;  1S07 A;  3RQ1 A;  1AY8 A;  3WLX A;  1N2T A;  3LVJ A;  2BHX A;  3LY1 A;  5D5S A;  3WCO A;  1MDX A;  1J04 A;  1D7V A;  4ZM4 A;  4Q31 A;  2A1V A;  2W7I A;  1IVR A;  3N4R A;  1ARI A;  3FQ8 A;  1MAP A;  3UWC A;  3LVK A;  4IW7 A;  7AAT A;  1X2A A;  3FRK A;  1O61 A;  2W7G A;  2Z9X A;  4UHM A;  3BC8 A;  4MGR A;  2BYJ A;  4UQV A;  3VK4 A;  1ORD A;  4TMR A;  3UAK A;  4ATP A;  4ZDO A;  4F5G A;  3FVX A;  3WKR A;  1AAW A;  2ZSM A;  3AEN B;  1WST A;  4KYO A;  1V2F A;  4N0B A;  4JEZ A;  4RKD A;  3A9X A;  2W7F A;  3WGB A;  3A2B A;  3D6K A;  3EI7 A;  1B8G A;  1AHF A;  2VMN A;  4LC3 A;  1ELQ A;  4EFF A;  3GZD C;  1ZC9 A;  2X5F A;  4FL0 A;  3BWN C;  3L8A A;  1GC2 A;  2AY6 A;  4OBV A;  3HL2 A;  4JEY A;  1BQA A;  3W1J A;  1ASF A;  3B46 A;  3NYU A;  2HOR A;  1M7Y A;  4Y0I A;  1ASB A;  1O4S A;  1M0Q A;  2YRR A;  1VJO A;  1FG3 A;  4A72 A;  2GMS A;  4XEW A;  3G8M A;  3M5U A;  1AIA A;  1W23 A;  2JJE A;  3AEN A;  3E2Z A;  2C44 A;  4XJO A;  4E3R A;  4F5K A;  1ECX A;  2YCT A;  2CIN A;  1CS1 A;  1JS6 A;  2ZJG A;  1ASN A;  1TAS A;  4NOG A;  4W91 A;  1G7W A;  1MGV A;  2DKB A;  3PDX A;  3ISL A;  2WKA A;  4A0H A;  1SFF A;  2VMZ A;  3PD6 A;  2W7D A;  3TQX A;  4WYC A;  4R2N A;  3USF A;  3WY7 A;  2ZY3 A;  1W7N A;  2Z1Z A;  3CQ6 A;  2GQN A;  3QHX A;  4BA5 A;  1TOE A;  4IY7 A;  2PO3 A;  1EQB A;  2YKX A;  4CBS A;  1T3I A;  1LC8 A;  2DKJ A;  2W7L A;  1KL1 A;  3MKJ A;  2R0T A;  5E3K A;  2HUU A;  4LNM A;  4XJM A;  5DJ9 A;  3AOV A;  2FQ6 A;  5LHA A;  3B1D A;  3HVY A;  2Q7W A;  4AOA A;  3FTB A;  5EAA A;  1TOI A;  1OHY A;  2EGY A;  1Z7D A;  5EUN A;  1I43 A;  3F6T A;  1OHW A;  4MKJ A;  2HP2 A;  2AY7 A;  4KXK A;  2BWO A;  2VLH A;  3FFR A;  1KL2 A;  2JJF A;  5EIG B;  2YRI A;  4HVK A;  3PJ0 A;  3BCX A;  4Q6R A;  5FT4 A;  1O69 A;  4GDY A;  3FD0 A;  3FFH A;  3PA9 A;  5F9S A;  2VMT A;  4F5I A;  1BJO A;  2ZYJ A;  1WYT B;  2W7J A;  4Y0D A;  4JE5 D;  5M4D A;  1AIC A;  4W5K A;  1AJS B;  3JWA A;  3IHJ A;  1YJY A;  4ZWM A;  2R5C A;  4H63 Q;  2OKK A;  2ZP7 A;  5BJ3 A;  3CAI A;  1H0C A;  2WK7 A;  4ATQ A;  1XEY A;  1QIT A;  2GSA A;  2D64 A;  4R5Z A;  3AEL A;  5F8V A;  2HP1 A;  2AY8 A;  4H51 A;  4A6R A;  3CQ5 A;  3AEJ C;  2R5E A;  1BKG A;  4ADB A;  3N4X A;  3T32 A;  1YAA A;  3EI6 A;  4GEB A;  4W8I A;  5EQC A;  1G4V A;  1WYT A;  4MKK A;  1DTY A;  2JG2 A;  4Y0H A;  3N75 A;  5AX8 A;  2GMU A;  2W8U A;  3BV0 A;  4OCA A;  5TF5 A;  1LKC A;  3GJU A;  1V2D A;  3N4S A;  4N0W A;  4WB0 B;  1IUG A;  1TAT A;  1TPL A;  3PGY A;  4ZM3 A;  4RM1 A;  1D7S A;  2ZY5 A;  2YKU A;  5EUD A;  3F9T A;  4DGT A;  3HQT A;  3MAU A;  1S08 A;  1LS3 A;  1C4K A;  1JF9 A;  5J8Q A;  2AY9 A;  4BA4 A;  4BHD A;  1OHV A;  4WLH A;  1DKA A;  2D7Y A;  2VI8 A;  2AY5 A;  4GSA A;  1CL1 A;  4WLJ A;  2BI1 A;  1EG5 A;  1W3U A;  2QB3 A;  1ZOB A;  1AKC A;  3VK2 A;  4A00 A;  1EJI A;  1GC0 A;  1I29 A;  3JTX A;  2E7U A;  2PB0 A;  3H9X A;  1BW0 A;  1ART A;  1UU2 A;  2W7E A;  4J5U A;  4WB0 A;  3RCH B;  2OGA A;  4F5H A;  3CQ4 A;  1P3W A;  2BI5 A;  2W8W A;  4ZLV A;  2OGE A;  2CJH A;  3NYT A;  1GEW A;  3GSB A;  3QBO A;  1AAM A;  2DGL A;  5JAY A;  1B5O A;  3N0L A;  1MLZ A;  3CBF A;  2HUI A;  4WXF A;  1DFO A;  2CFB A;  3R9A A;  4F4E A;  3B1C A;  4HF8 A;  5EFS A;  5FT8 A;  2VMW A;  4JE5 A;  4ZAS A;  2W7K A;  1ASC A;  4WP0 A;  1ASM A;  1JG8 A;  1DGD A;  1GDE A;  2BKW A;  3GZD A;  3NU7 A;  4ITX A;  3RCH A;  4U2H A;  3WX9 A;  2R2N A;  3ZRQ A;  4DQ6 A;  3BWN A;  2OKJ A;  4MQP A;  4EB7 A;  1AHE A;  1AMS A;  1AMA A;  1X28 A;  4IYO B;  3JW9 A;  4OBU A;  1QJ3 A;  3EUC A;  4B9B A;  1AMQ A;  2CJD A;  4XJL A;  4WBT A;  1GD9 A;  3OP7 A;  2VMS A;  1SZK A;  1AY4 A;  3EI8 A;  5G09 A;  2W8V A;  4IXZ A;  4ZSW A;  2HZP A;  3GR9 A;  3I16 A;  3JU7 A;  2AAT A;  2BIE A;  3N5M A;  3ZRR A;  1GCK A;  4CXR A;  3HMU A;  4EU1 A;  2EPJ A;  1M32 A;  3TFU A;  1LK9 A;  3K40 A;  2D5Y A;  4ISY A;  3NNK A;  2VIA A;  2E7J A;  2FN6 A;  3ELP A;  2VMR A;  4CXQ A;  2QBT A;  5D95 A;  3I5T A;  4IX8 A;  1ARG A;  3NU8 A;  4LW2 A;  3AOW A;  4IYO A;  1O62 A;  2AY3 A;  2O7C A;  3E2Y A;  5G0A A;  1AX4 A;  3B1E A;  4K05 A;  2DGM A;  3N7N A;  1WKG A;  1W7L A;  4R8D A;  3ELE A;  4AO9 A;  2CST A;  3B8X A;  3DU4 A;  3NYS A;  1M4N A;  2GB3 A;  5E4Z A;  1KMJ A;  3MC6 A;  3VOM A;  5EAV A;  4Q75 A;  3W1I A;  1KMK A;  2EZ1 A;  3ASA A;  3RBL A;  4BQ0 A;  1M0N A;  3QM2 A;  2VMU A;  3MC6 C;  3R4T A;  2VMO A;  1B5P A;  1S06 A;  1ASA A;  2YHK A;  5G2Q A;  1BJW A;  3GWP A;  2CY8 A;  2E7I A;  2Z9U A;  3LG0 A;  1V72 A;  2F8J A;  2G7J A;  3E77 A;  1LC5 A;  1IX8 A;  4OMA A;  2QSR A;  2YKV A;  3MAD A;  3G0T A;  1BJN A;  1QGN A;  1C9C A;  4KAM A;  4L0O A;  1C0N A;  1ASD A;  1PG8 A;  2ZY2 A;  3DZZ A;  3RI6 A;  4ADE A;  2O1B A;  1KKJ A;  4P7Y A;  4RAE A;  3HDO A;  3VK3 A;  4AZJ A;  3BCA A;  3E6G A;  4ZDP A;  1ASG A;  1QIR A;  4AO4 A;  3FCR A;  1ARH A;  1QZ9 A;  1H1C A;  1IBJ A;  2VIB A;  2VMV A;  1I48 A;  3AEJ A;  3ATH A;  3BWO A;  3QPG A;  1PMO A;  1GEX A;  5EIG A;  1B9I A;  3TCM A;  5DX5 A;  2D61 A;  4W1V A;  1U08 A;  2X3L A;  2VI9 A;  3HLM A;  1IX7 A;  1IAY A;  5C6U A;  1RV3 A;  2D7Z A;  3NDN A;  4JF1 A;  3WCN A;  3DXW A;  1AJS A;  2ZUK A;  1QIS A;  1VEF A;  2NMP A;  3AAT A;  4U1T A;  1KKP A;  3ZRP A;  4UOY A;  3OKS A;  3UE8 A;  2WB6 A;  2CTZ A;  4XAU A;  4XQ2 A;  1AIB A;  3PPL A;  2AY2 A;  2VMY A;  3BCB A;  5FT5 A;  2ORD A;  3FZ6 A;  2C0R A;  4WYG A;  4B98 A;  3BS8 A;  2QLR A;  2BWP A;  2KFP A;  1GC3 A;  1CZC A;  3AEM A;  3LV2 A;  1DJE A;  1M0P A;  2EO5 A;  3AEM C;  8AAT A;  4ZSY A;  1UU1 A;  3COG A;  3L44 A;  2YKY A;  4TN4 A;  1V2E A;  4WD2 A;  3FQA A;  3FZ7 A;  3HBX A;  2JGT A;  3VP6 A;  3JWB A;  3AEP A;  5DB5 A;  3H7F A;  1WYU B;  1C7O A;  2AY1 A;  1TOK A;  4LW4 A;  4RIT A;  2VGS A;  9AAT A;  1YOO A;  3WGC A;  2VMX A;  3MEB A;  4K2I A;  1D7U A;  2VGW A;  2XBN A;  4PFF A;  4PIW A;  2Z61 A;  1B9H A;  1BS0 A;  2O0R A;  4ADD A;  4ZAH A;  1XI9 A;  1D7R A;  1YJS A;  2AEU A;  2ZC0 A;  2VGV A;  2VGU A;  3GBX A;  3II0 A;  3AV7 A;  5K8B A;  5IWQ A;  1AKA A;  1AMR A;  1CQ7 A;  3NRA A;  4I8A A;  4R5F A;  1S09 A;  1D2F A;  4DBC A;  2HOX A;  4WXB A;  1BQD A;  2Z1Y A;  4LNL A;  1GC4 A;  1IJI A;  1FC4 A;  2Z9V A;  3JZL A;  4K2M A;  4UHN A;  2VGT A;  3E9K A;  4PFN A;  4UHO A;  1WYU A;  3P1T A;  1BJ4 A;  1CJ0 A;  1YIY A;  4MQR A;  2X5D A;  4ZDL A;  3QI6 A;  3EZS A;  3H14 A;  3MAF B;  1ZOD A;  5HHY A;  1DJU A;  1YNU A;  1AY5 A;  1VP4 A;  4ADC A;  3DXV A;  1LW5 A;  4W1W A;  4JEV A;  2D66 A;  2Z67 A;  4OC9 A;  4QGR A;  2YCN A;  4GRX A;  1MLY A;  2WK8 A;  3PIU A;  1OXO A;  1DGE A;  4A0F A;  1M0O A;  4CVQ A;  5M46 A;  3ECD A;  2VMP A;  2HOZ A;  4EMY A;  1N31 A;  2E54 A;  2DR1 A;  2W7H A;  1QJ5 A;  3W1H A;  3E2Z B;  2CB1 A;  1UKJ A;  4F5F A;  4XK1 A;  1MDZ A;  3MAF A;  1YJZ A;  2BWN A;  1RVY A;  3QGU A;  1CQ6 A;  2CAN A;  3QN6 A;  3FVS A;  1G7X A;  3A8U X;  3LVM A;  3PD6 B;  1CQ8 A;  5G4J A;  2EYQ A;  4RLG A;  2BI9 A;  3ACZ A;  3FSL A;  1PFF A;  1N8P A;  2EH6 A;  3PDB B;  3DYD A;  5FT6 A;  1MDO A;  3A9Y A;  3GZC A;  4GE9 A;  4A6T A;  4J8L A;  4AZK A;  1PMM A;  2ZSL A;  1C7N A;  1E5F A;  3ZZJ A;  1E5E A;  1LC7 A;  4F5L A;  4A6U A;  1ASL A;  4RJY A;  5I92 A;  1X0M A;  3KKI A;  3NUB A;  3KGW A;  3RUY A;  3KE3 A;  2D65 A;  2V1P A;  4IXO A;  1TAR A;  1Z3Z A;  1GEY A;  2TPL A;  4EB5 A;  3ASB A;  5BJ4 A;  2CH1 A;  2XH1 A;  2VLF A;  1M6S A;  2AY4 A;  5LH9 A;  3LWS A;  1SF2 A;  2AEV A;  4W1X A;  2CH2 A;  3PDB A;  4M2M A;  2DGK A;  2W8T A;  3TAT A;  5KTB A;  3DC1 A;  4IXS A;  4Q76 A;  2ZY4 A;  3G7Q A;  4BMK A;  3K7Y A;  1BJO B;  3DR7 A;  2BIG A;  2X8U A;  4LNJ A;  4OT8 A;  3NX3 A;  2R5C B;  4P3M A;  4WYE A;  3K28 A;  3EZ1 A;  4ZWV A;  1DJ9 A;  1B4X A;  3EI5 A;  4M2J A;  2FM1 A;  2FNU A;  2JJG A;  2PB2 A;  4JF0 A;  4MQQ A;  1TOJ A;  3GET A;  5E5I A;  1I41 A;  4E3Q A;  1OXP A;  4XJP A;  4TV7 A;  3EIA A;  4O6Z A;  4PVF A;  3NUI A;  2BI3 A;  3FDB A;  4RKC A;  3RBF A;  3P6K A;  1SVV A;  3PAA A;  4E77 A;  1UU0 A;  4F5J A;  5M49 A;  2EZ2 A;  3E2F A;  3DR4 A;  3FZ8 A;  4M2K A;  3DOD A;  1MAQ A;  2FKI A;  1YIZ A;  3FQ7 A;  2YOB A;  3F0H A;  3NTJ A;  2DOU A;  3AEO A;  2OAT A;  1AJR A;  4F5M A;  2HOY A;  3EIB A;  1WYV B;  2W7M A;  1SZS A;  2OQX A;  1LW4 A;  1IAX A;  3MBB A;  1BT4 A;  3FKD A;  1CZE A;  1RV4 A;  4MY5 A;  4WYA A;  2WK9 A;  5EUE A;  2VYC A;  3DRD A;  3VAX A;  3TFT A;  4WXG A;  4WYD A;  1Y4I A;  2FYF A;  2RFV A;  1S0A A;  2JJH A;  2CJG A;  5M4B A;  2QMA A;  1RVU A;  1X29 A;  4E1O A;  4WYF A;  2BI2 A;  2C7T A;  2BIA A;  4A0G A;  4FFC A;  1CL2 A;  1GBN A;  3BB8 A;  2VMQ A;  1AHY A;  4RIZ A;  5G2P A;  3WKS A;  2G6W A;  3WZF A;  1ELU A;  3KGX A;  5G4I A;  2Z9W A;  2FNI A;  1WYV A;  4GE7 A;  1SZU A;  1FG7 A;  2QA3 A;  2HUF A;  3IF2 A;  1TOG A;  1WKH A;  4CBR A;  2YCP A;  1SPA A;  1ARS A;  1OAT A;  1W7M A;  3A9Z A;  4ITG A;  2D63 A;  2C81 A;  4GE4 A;  4AH3 A;  1C7G A;  2JIS A;  3LVL B;  3BN1 A;  1IX6 A;  4OTL A;  1AKB A;  3HT4 A;  2VGZ A;  1AHG A;  3EI9 A;  5HXX A;  2QB2 A;  3FVU A;  4K2B A;  4JEX A;  2BYL A;  2Z20 A;  4OYT A;  2W8J A;  4RJ0 A;  1ASE A;  1JS3 A;  5DJ1 A;  3I4J A;  4MSO A;  5HDM A;  3ZZK A;  2V0Y A;  1AHX A;  1J32 A;  4JEW A;  4A0R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...