1AKCA

Structural basis for the catalytic activity of aspartate aminotransferase k258h lacking its pyridoxal-5'-phosphate-binding lysine residue
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
401
structure length
401
Chain Sequence
b'SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAHNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Structural basis for the catalytic activity of aspartate aminotransferase K258H lacking the pyridoxal 5'-phosphate-binding lysine residue.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase(aminotransferase)
total genus 146
structure length 401
sequence length 401
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1994-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1akcA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1akcA01
4RKDA 3NRAA 1IUGA 1M4NA 3MEBA 5M4BA 3ATHA 1KL2A 2R5CA 1EQBA 2ZY2A 1B9IA 1U08A 2X5FA 3QM2A 4A0FA 1ASAA 4E1OA 4BHDA 4XJOA 2ZY5A 4JEZA 1D2FA 4A00A 1LW4A 1TOGA 1BJOA 3AOVA 3D6KA 4IXZA 1SZKA 2DKBA 2D63A 3USFA 2AY9A 3G7QA 2W8WA 1AAWA 1QIRA 1SVVA 2AY7A 2CH2A 2WKAA 4A6TA 2VMYA 1LC8A 3GWPA 4GSAA 1YJYA 4EB5A 2VMSA 2EPJA 3PPLA 3LVMA 2W7GA 4GE4A 3HT4A 9AATA 3OP7A 5D95A 4CBRA 5M4DA 3AEMC 3NTJA 4JEVA 3ZZKA 4MQQA 4E3RA 2Z9UA 3EI5A 5G4IA 3VK2A 2BI1A 3EI6A 8AATA 1CQ6A 3COGA 3DR7A 3WX9A 2V1PA 3PDBB 3BWNC 1B9HA 4ITGA 4DGTA 4JEYA 2BKWA 4PIWA 1WSTA 2YKYA 4BA4A 5JAYA 1YIZA 4P3MA 4ZDOA 3KGXA 1RVUA 1W7LA 4W91A 3JW9A 2EZ1A 3AATA 3HLMA 1CQ7A 4HVKA 4EMYA 1CJ0A 3WCOA 2FNIA 1I48A 1V72A 2PB2A 3FFRA 2Z9XA 4RITA 3VK4A 2ZY3A 1Y4IA 1N2TA 2FN6A 3ZRQA 3VP6A 2AY6A 5EUDA 3W1HA 1ASNA 1DGEA 3DC1A 1O61A 4FFCA 1ASMA 4JF0A 2ZSMA 5G0AA 4R5FA 4JEWA 3QHXA 3UWCA 2BI9A 1ARHA 3NUBA 3NYUA 1XI9A 2YRIA 4R5ZA 3ZRPA 2DGMA 4UOYA 4F5LA 3A9ZA 1BJNA 3EI8A 3N5MA 4PFNA 4ZLVA 2CB1A 3VOMA 3BB8A 4A6RA 2CJGA 2AEVA 2OKKA 2VMUA 2W7FA 4AH3A 2AY3A 1UKJA 2Q7WA 4ZDPA 4WYDA 2BIEA 3F0HA 1ORDA 3FVXA 2VGSA 2D5YA 1KKPA 2WK8A 3FKDA 3AV7A 2R5EA 1RVYA 4M2KA 5C6UA 2YRRA 4IY7A 1W23A 2BYLA 1AMAA 1SFFA 4KAMA 3MC6A 4WYAA 2R0TA 1AY5A 4BQ0A 1WYUA 1IJIA 3CQ5A 3HQTA 4E77A 2Z1ZA 5K8BA 1KL1A 1MLZA 3BCXA 3K7YA 3JU7A 1SZUA 2JG2A 5G2PA 1BJWA 3WY7A 5J8QA 1TOJA 3WGBA 2VYCA 2BWOA 3B1DA 1CL2A 4XEWA 3BN1A 4U2HA 4OBUA 4EU1A 3E6GA 1B5PA 3F6TA 4J5UA 1BW0A 1YAAA 4A0GA 1PMOA 4GE9A 3KGWA 3LY1A 3PDBA 2W7KA 4F5GA 1G4XA 2GMSA 2W7HA 2GSAA 3JWBA 3QN6A 5LH9A 4EFFA 1AMRA 1I43A 1LK9A 2BIGA 1PMMA 2HUIA 3L8AA 4Q6RA 3EIAA 4MKKA 2YKXA 2XH1A 4IYOB 1OXPA 3L44A 5HDMA 3WZFA 3A9YA 2VMZA 3AELA 3CQ6A 4OT8A 2W8UA 4R8DA 3K28A 3AEJA 4Y0IA 1ARIA 4AZJA 2VMVA 4ITXA 4I8AA 3PAAA 1IAXA 1ARSA 1E5FA 1MLYA 2FNUA 3GZDA 1LC7A 1IVRA 4F4EA 3MBBA 1UU2A 4WYCA 2CH1A 2EH6A 4U1TA 4WYEA 3QI6A 3FTBA 3IF2A 4JF1A 3FDDA 4IXSA 4WYGA 3FQ8A 1W7MA 1OHYA 3BCBA 5EUNA 1TATA 2JJFA 4OYTA 3WLXA 2Z9VA 1AHEA 3MAFB 3DXVA 1D7UA 2F8JA 1SZSA 5E4ZA 3HBXA 3NX3A 3ASAA 1AJSB 4MQPA 2VMPA 1C9CA 1CS1A 4ADCA 2BWPA 4LW4A 4EB7A 4IW7A 3ZRRA 4DQ6A 3BS8A 2D7YA 1BS0A 3NNKA 3DR4A 4RAEA 5EIGB 2AY4A 2W8TA 3GJUA 2CJDA 3LVLB 1KKJA 3TQXA 1Z7DA 1W7NA 2O7CA 5DJ9A 2YCNA 1M7YA 4AOAA 5EAAA 4BA5A 3KE3A 2BI5A 2GQNA 1ZC9A 4E3QA 1IX7A 1GC2A 1TARA 2AY8A 4MY5A 2VI8A 3GETA 3PDXA 4XJPA 1JG8A 2VGUA 3ECDA 1T3IA 5G2QA 5LHAA 1QGNA 2FM1A 1FG7A 2EGYA 4WB0B 4AO9A 3PJ0A 4HF8A 1YIYA 2HORA 4M2MA 1Z3ZA 4F5IA 5FT6A 3UAKA 2QB2A 2E7UA 2WK7A 4F5HA 5FT8A 4WLJA 1ASGA 3NDNA 1BQDA 2C7TA 4J8LA 3NUIA 4ATPA 1AY8A 2DGLA 3QPGA 2HOYA 3BCAA 3G8MA 3FCRA 4XAUA 1TOEA 2CANA 2C44A 2CFBA 2E7JA 3B8XA 3BC8A 3DZZA 3JTXA 5EFSA 4IYOA 3HL2A 4CXRA 1G7XA 3RQ1A 1O62A 3QBOA 4XK1A 5FT5A 1MAQA 1MGVA 4A0HA 1YNUA 1X2AA 2BIAA 2VMQA 1MDXA 1V2FA 5M46A 1ASBA 1D7VA 3E2YA 4M2JA 4WXGA 1IX6A 1WYTB 1AHFA 1GC3A 3FVUA 4JE5A 2W7JA 2Z20A 4AO4A 3E77A 5F8VA 3TFUA 5E5IA 1EJIA 3EUCA 3VK3A 1M32A 3MC6C 1YOOA 2W7EA 4N0BA 1G4VA 4LNLA 3WGCA 1IBJA 1D7SA 3DYDA 1AKBA 2HP1A 2VLHA 1G7WA 1QJ5A 1AJSA 3GSBA 3OKSA 3ASBA 1AMQA 3FFHA 1AKCA 1WYVB 3DXWA 1FC4A 3E9KA 3FD0A 4MQRA 2AEUA 1O69A 4FL0A 1AHGA 4Q75A 5HHYA 5D5SA 3G0TA 3ACZA 4CVQA 1M0OA 3NYSA 4WP0A 5EIGA 1BJ4A 1DKAA 1EG5A 4TN4A 1BQAA 1N31A 3WKSA 2BYJA 2O0RA 3A2BA 2YHKA 4H51A 5DB5A 4ZASA 4WBTA 1C7NA 1AY4A 2CTZA 2CY8A 1AAMA 3ELEA 4UHOA 1H0CA 1H1CA 1W3UA 3P1TA 1ASCA 1D7RA 1LS3A 2HUFA 4UHMA 4K2IA 1AKAA 4B98A 1X29A 1C4KA 2QB3A 3BWOA 3GR9A 1GD9A 4Y0DA 1OXOA 4W1WA 2GMUA 1ASFA 4K2MA 3EI7A 4A0RA 1JS6A 3AEJC 2W8JA 3RCHB 1QJ3A 4PFFA 4Q31A 3MAUA 3W1IA 2HZPA 4KYOA 3RBLA 1M6SA 1BJOB 4RLGA 3TATA 1P3WA 2EZ2A 2R2NA 5DJ1A 2D65A 2ZJGA 3WKRA 1JF9A 2QLRA 2W8VA 2QMAA 5G09A 3N75A 2VGTA 2DGKA 1LKCA 3WCNA 4ZWVA 5FT4A 3I4JA 3CQ4A 3GBXA 2W7MA 4A72A 5M49A 2D61A 2HUUA 2VMNA 4LC3A 1UU0A 2ORDA 1WYTA 4W5KA 2VI9A 1CZCA 2D64A 2JGTA 1CZEA 2EO5A 4ZM3A 1DTYA 1TOIA 3EIBA 2X5DA 1PFFA 2YOBA 1LC5A 2Z1YA 1ZOBA 4PVFA 1AICA 1CQ8A 3B46A 3PD6B 4GRXA 2Z67A 2W7IA 4LNJA 1KMKA 4AZKA 1WYVA 3E2ZB 4L0OA 5BJ3A 4ZSYA 4GDYA 5IWQA 1RV4A 1YJZA 4LNMA 1ECXA 1MDZA 2D66A 2AATA 2G6WA 2HOXA 3IHJA 3NYTA 1QZ9A 2QBTA 4OBVA 1ELUA 3LVJA 2D7ZA 2YKVA 2ZSLA 3JWAA 5AX8A 1DJUA 4W1XA 2DOUA 2ZYJA 4ZSWA 2QA3A 4WD2A 1ASLA 3DU4A 1S09A 2BWNA 4O6ZA 4UQVA 2VMWA 5TF5A 2CSTA 3N0LA 3FZ6A 1VJOA 2CINA 2HOZA 2OKJA 2ZUKA 3EI9A 5DX5A 3AENB 1AIBA 5F9SA 1OHVA 4B9BA 1XEYA 4TV7A 1WKHA 3I5TA 3RBFA 3RCHA 3TFTA 4OTLA 3BV0A 4P7YA 1GBNA 3II0A 3HMUA 4OC9A 4RJ0A 3R4TA 4ZWMA 2PB0A 1GDEA 2BHXA 1TPLA 3JZLA 1WYUB 1AHXA 1VEFA 3UE8A 1X0MA 5EUEA 1ELQA 4RM1A 4ADEA 3DODA 4GEBA 1I29A 1AJRA 2JISA 3FQAA 2AY5A 4MKJA 4MSOA 1QISA 1V2DA 2VMOA 4DBCA 3LV2A 4XJMA 4KXKA 3QGUA 5G4JA 3P6KA 3HVYA 1AIAA 3A8UX 7AATA 4N0WA 4CBSA 2VGVA 1ASEA 1V2EA 3I16A 1M0QA 2V0YA 4WXBA 3FQ7A 4GE7A 1J32A 1B4XA 3Q8NA 3PD6A 5BJ4A 3MAFA 1SPAA 2RFVA 3FZ8A 4W1VA 1ARGA 3NU7A 3LVKA 3AEMA 1GC0A 1KMJA 3E2ZA 3HDOA 2Z9WA 3FDBA 4Q76A 2JJGA 1C0NA 1B8GA 2BI3A 1WKGA 1B5OA 2AY1A 2Z61A 2AY2A 1S08A 5EAVA 3LG0A 3VAXA 3BWNA 3NU8A 4F5KA 2YCPA 4ZAHA 1MAPA 3FSLA 4IXOA 1E5EA 2C81A 3F9TA 4ADBA 1RV3A 4WXFA 5I92A 1CL1A 1X28A 1GEYA 1ARTA 2X8UA 1JS3A 3CAIA 3ELPA 3CBFA 1IX8A 3B1CA 4NOGA 1IAYA 2XBNA 2VMRA 2VGWA 3AENA 4WB0A 1PG8A 4WLHA 4CXQA 4ZM4A 3ZZJA 5HXXA 1J04A 2R5CB 2FQ6A 2DKJA 4JE5D 3FVSA 4MGRA 4UHNA 5E3KA 3DRDA 3AEPA 3B1EA 1FG3A 1AHYA 1DGDA 4JEXA 1SF2A 2VMXA 4K2BA 4R2NA 1GEWA 2HP2A 3PIUA 3GZDC 5EQCA 1AX4A 1MDOA 1N8PA 3K40A 4IX8A 4WYFA 4F5MA 1GC4A 4Y0HA 2VIAA 1VP4A 2W7DA 3GZCA 4TMRA 1TOKA 3FZ7A 1S07A 2ZC0A 3H7FA 1O4SA 2X3LA 1GCKA 1GEXA 1TASA 2JJHA 4RJYA 2ZY4A 2VLFA 1BKGA 3H14A 2ZP7A 1OHWA 2YCTA 4ATQA 3FRKA 3AOWA 3EZSA 4F5JA 3RI6A 2E54A 2O1BA 1M0NA 2VGZA 4QGRA 1YJSA 1S06A 4BMKA 3PGYA 3E2FA 2GB3A 2OGEA 4RKCA 4RIZA 2JJEA 4ADDA 2VMTA 1M0PA 2FYFA 1ZODA 3T32A 3RUYA 3PA9A 1QITA 1S0AA 1C7OA 2TPLA 1LW5A 4OCAA 3AEOA 2CJHA 2OQXA 3TCMA 2PO3A 3EZ1A 4OMAA 2OATA 1DJ9A 2C0RA 3A9XA 3W1JA 2W7LA 2BI2A 1DFOA 2DR1A 3ISLA 4ZDLA 4W8IA 1BT4A 3KKIA 4LW2A 4XJLA 2WK9A 1DJEA 1AMSA 3R9AA 3MKJA 3MADA 1I41A 1OATA 1UU1A 2OGAA 2YKUA 3M5UA 1ASDA 2VIBA 4ISYA 4A6UA 4F5FA 4XQ2A 2E7IA 1C7GA 3LWSA 2NMPA
chains in the Genus database with same CATH superfamily
4RKDA 3NRAA 1IUGA 1M4NA 3MEBA 5M4BA 3ATHA 1KL2A 2R5CA 1EQBA 2ZY2A 1B9IA 1U08A 2X5FA 3QM2A 4A0FA 1ASAA 4E1OA 3N4XA 4BHDA 4XJOA 2ZY5A 4JEZA 1D2FA 4A00A 1LW4A 1TOGA 1BJOA 3AOVA 3D6KA 4IXZA 1SZKA 2DKBA 2D63A 3USFA 2AY9A 3G7QA 2W8WA 1AAWA 1QIRA 1SVVA 2AY7A 2CH2A 2WKAA 4A6TA 2VMYA 1LC8A 3GWPA 4GSAA 3H9XA 1YJYA 4EB5A 2VMSA 2EPJA 3PPLA 3LVMA 2W7GA 4GE4A 3HT4A 9AATA 3OP7A 5D95A 4CBRA 5M4DA 3AEMC 3NTJA 4JEVA 3ZZKA 4MQQA 4E3RA 2Z9UA 3EI5A 5G4IA 3VK2A 2BI1A 3EI6A 8AATA 1CQ6A 3COGA 3DR7A 3WX9A 2V1PA 3PDBB 3BWNC 1B9HA 4ITGA 4DGTA 4JEYA 2BKWA 4PIWA 1WSTA 2YKYA 4BA4A 5JAYA 1YIZA 4P3MA 4ZDOA 3KGXA 1RVUA 1W7LA 4W91A 3JW9A 2EZ1A 3AATA 3HLMA 1CQ7A 4HVKA 4EMYA 1CJ0A 3WCOA 2FNIA 1I48A 1V72A 2PB2A 3FFRA 2Z9XA 4RITA 3VK4A 2ZY3A 1Y4IA 1N2TA 2FN6A 3ZRQA 3VP6A 2AY6A 5EUDA 3W1HA 1ASNA 1DGEA 3DC1A 1O61A 4FFCA 1ASMA 4JF0A 2ZSMA 5G0AA 4R5FA 4JEWA 3QHXA 3UWCA 2BI9A 1ARHA 3NUBA 3NYUA 1XI9A 2YRIA 4R5ZA 3ZRPA 2DGMA 4UOYA 4F5LA 3A9ZA 1BJNA 3EI8A 3N5MA 4PFNA 4ZLVA 2CB1A 3VOMA 3BB8A 4A6RA 2CJGA 2AEVA 2OKKA 2VMUA 2W7FA 4AH3A 2AY3A 1UKJA 2Q7WA 4ZDPA 4WYDA 2BIEA 3F0HA 1ORDA 3FVXA 2VGSA 2D5YA 1KKPA 2WK8A 3FKDA 3AV7A 2R5EA 1RVYA 4M2KA 5C6UA 2YRRA 4IY7A 1W23A 2BYLA 1AMAA 1SFFA 4KAMA 3MC6A 4WYAA 2R0TA 1AY5A 4BQ0A 1WYUA 1IJIA 3CQ5A 3HQTA 4E77A 2Z1ZA 5K8BA 1KL1A 1MLZA 3BCXA 3K7YA 3JU7A 1SZUA 2JG2A 5G2PA 1BJWA 3WY7A 5J8QA 1TOJA 3WGBA 2VYCA 2BWOA 3B1DA 1CL2A 4XEWA 3BN1A 4U2HA 4OBUA 4EU1A 3E6GA 1B5PA 3F6TA 4J5UA 1BW0A 1YAAA 4A0GA 1PMOA 4GE9A 3KGWA 3LY1A 3PDBA 2W7KA 4F5GA 1G4XA 2GMSA 2W7HA 2GSAA 3JWBA 3QN6A 5LH9A 4EFFA 1AMRA 1I43A 1LK9A 2BIGA 1PMMA 2HUIA 3L8AA 4Q6RA 3EIAA 2EYQA 4H63Q 4MKKA 2YKXA 2XH1A 4IYOB 1OXPA 3L44A 5HDMA 3WZFA 3A9YA 2VMZA 3AELA 3CQ6A 4OT8A 2W8UA 4R8DA 3K28A 3AEJA 4Y0IA 1ARIA 4AZJA 2VMVA 4ITXA 4I8AA 3PAAA 1IAXA 1ARSA 1E5FA 1MLYA 2FNUA 3GZDA 1LC7A 1IVRA 4F4EA 3MBBA 1UU2A 4WYCA 2CH1A 2EH6A 4U1TA 4WYEA 3QI6A 3FTBA 3IF2A 4JF1A 3FDDA 4IXSA 4WYGA 3FQ8A 1W7MA 1OHYA 3BCBA 5EUNA 1TATA 2JJFA 4OYTA 3WLXA 2Z9VA 1AHEA 3MAFB 3DXVA 1D7UA 2F8JA 1SZSA 5E4ZA 3HBXA 3NX3A 3ASAA 1AJSB 4MQPA 2VMPA 1C9CA 1CS1A 4ADCA 2BWPA 4LW4A 4EB7A 4IW7A 3ZRRA 4DQ6A 3BS8A 2D7YA 1BS0A 3NNKA 3DR4A 4RAEA 5EIGB 2AY4A 2W8TA 3GJUA 2CJDA 3LVLB 1KKJA 3TQXA 1Z7DA 1W7NA 2O7CA 5DJ9A 2YCNA 1M7YA 4AOAA 5EAAA 4BA5A 3KE3A 2BI5A 2GQNA 1ZC9A 4E3QA 1IX7A 1GC2A 1TARA 2AY8A 4MY5A 2VI8A 3GETA 3PDXA 4XJPA 1JG8A 2VGUA 3ECDA 1T3IA 5G2QA 5LHAA 1QGNA 2FM1A 1FG7A 2EGYA 4WB0B 4AO9A 3N7NA 3PJ0A 4HF8A 1YIYA 2HORA 4M2MA 1Z3ZA 4F5IA 5FT6A 3UAKA 2QB2A 2E7UA 2WK7A 4F5HA 5FT8A 4WLJA 1ASGA 3NDNA 1BQDA 2C7TA 4J8LA 3NUIA 4ATPA 1AY8A 2DGLA 3QPGA 2HOYA 3BCAA 3G8MA 3FCRA 4XAUA 1TOEA 2CANA 2C44A 2CFBA 2E7JA 3B8XA 3BC8A 3DZZA 3JTXA 5EFSA 4IYOA 3HL2A 1KAFA 4CXRA 1G7XA 3RQ1A 1O62A 3QBOA 4XK1A 5FT5A 1MAQA 1MGVA 4A0HA 1YNUA 1X2AA 2BIAA 2VMQA 1MDXA 1V2FA 5M46A 1ASBA 1D7VA 3E2YA 4M2JA 4WXGA 1IX6A 1WYTB 1AHFA 1GC3A 3FVUA 4JE5A 2W7JA 2Z20A 4AO4A 3E77A 5F8VA 3TFUA 5E5IA 1EJIA 3EUCA 3VK3A 1M32A 3MC6C 1YOOA 2W7EA 4N0BA 1G4VA 4LNLA 3WGCA 1IBJA 1D7SA 3DYDA 1AKBA 2HP1A 2VLHA 1G7WA 1QJ5A 1AJSA 3GSBA 3OKSA 3ASBA 1AMQA 3FFHA 1AKCA 1WYVB 3DXWA 1FC4A 3E9KA 3FD0A 4MQRA 2AEUA 1O69A 4FL0A 1AHGA 4Q75A 5HHYA 5D5SA 3G0TA 3ACZA 4CVQA 1M0OA 3NYSA 4WP0A 5EIGA 1BJ4A 1DKAA 1EG5A 4TN4A 1BQAA 1N31A 3WKSA 2BYJA 2O0RA 3A2BA 2YHKA 4H51A 5DB5A 4ZASA 4WBTA 1C7NA 1AY4A 2CTZA 2CY8A 1AAMA 3ELEA 4UHOA 1H0CA 1H1CA 4K05A 1W3UA 3P1TA 1ASCA 1D7RA 1LS3A 2HUFA 4UHMA 4K2IA 1AKAA 4B98A 1X29A 1C4KA 2QB3A 3BWOA 3GR9A 1GD9A 4Y0DA 1OXOA 4W1WA 2GMUA 1ASFA 4K2MA 3EI7A 4A0RA 1JS6A 3AEJC 2FKIA 2W8JA 3RCHB 2WB6A 1QJ3A 4PFFA 4Q31A 3MAUA 3W1IA 2HZPA 4KYOA 3RBLA 1M6SA 1BJOB 4RLGA 3TATA 1P3WA 2EZ2A 2R2NA 5DJ1A 2D65A 2ZJGA 3WKRA 1JF9A 2QLRA 2W8VA 2QMAA 5G09A 3N75A 2VGTA 2DGKA 1LKCA 3WCNA 4ZWVA 5FT4A 3I4JA 3CQ4A 3GBXA 2W7MA 4A72A 5M49A 2D61A 2HUUA 2VMNA 4LC3A 1UU0A 2ORDA 1WYTA 4W5KA 2VI9A 1CZCA 2D64A 2JGTA 1CZEA 2EO5A 4ZM3A 1DTYA 1TOIA 3EIBA 2X5DA 1PFFA 2YOBA 1LC5A 2Z1YA 1ZOBA 4PVFA 1AICA 1CQ8A 3B46A 3PD6B 4GRXA 2Z67A 2W7IA 4LNJA 2G7JA 1KMKA 4AZKA 1WYVA 3E2ZB 4L0OA 5BJ3A 4ZSYA 4GDYA 5IWQA 1RV4A 1YJZA 4LNMA 1ECXA 1MDZA 2D66A 2AATA 2G6WA 2HOXA 3IHJA 3NYTA 1QZ9A 2QBTA 4OBVA 1ELUA 3LVJA 2D7ZA 2YKVA 2ZSLA 3JWAA 5AX8A 1DJUA 4W1XA 2DOUA 2ZYJA 4ZSWA 2QA3A 4WD2A 1ASLA 3DU4A 1S09A 2BWNA 4O6ZA 4UQVA 2VMWA 5TF5A 2CSTA 3N0LA 3FZ6A 1VJOA 2CINA 2HOZA 2OKJA 2ZUKA 3EI9A 5DX5A 3AENB 1AIBA 5F9SA 1OHVA 4B9BA 1XEYA 4TV7A 1WKHA 3I5TA 3RBFA 3RCHA 3TFTA 4OTLA 3BV0A 4P7YA 2A1VA 1GBNA 3II0A 3HMUA 4OC9A 4RJ0A 3R4TA 4ZWMA 2PB0A 1GDEA 2BHXA 1TPLA 3JZLA 1WYUB 1AHXA 1VEFA 3UE8A 1X0MA 5EUEA 1ELQA 4RM1A 4ADEA 3DODA 4GEBA 1I29A 1AJRA 2JISA 3FQAA 2KFPA 2AY5A 4MKJA 4MSOA 1QISA 1V2DA 2VMOA 4DBCA 3LV2A 4XJMA 4KXKA 3QGUA 5G4JA 3P6KA 3HVYA 1AIAA 3A8UX 7AATA 4N0WA 4CBSA 2VGVA 1ASEA 1V2EA 3I16A 1M0QA 2V0YA 4WXBA 3FQ7A 4GE7A 1J32A 1B4XA 3Q8NA 3PD6A 5BJ4A 3MAFA 1SPAA 2RFVA 3FZ8A 4W1VA 1ARGA 3NU7A 3LVKA 3AEMA 1GC0A 1KMJA 3E2ZA 3HDOA 2Z9WA 3FDBA 4Q76A 2JJGA 1C0NA 1B8GA 2BI3A 1WKGA 1B5OA 2AY1A 2Z61A 2AY2A 1S08A 5EAVA 3LG0A 3VAXA 3BWNA 3NU8A 4F5KA 2YCPA 4ZAHA 1MAPA 3FSLA 4IXOA 1E5EA 2C81A 3F9TA 4ADBA 1RV3A 4WXFA 5I92A 1CL1A 1X28A 1GEYA 1ARTA 2X8UA 1JS3A 3CAIA 3ELPA 3CBFA 1IX8A 3B1CA 4NOGA 1IAYA 2XBNA 2VMRA 2VGWA 3AENA 4WB0A 1PG8A 4WLHA 4CXQA 4ZM4A 3ZZJA 5HXXA 1J04A 2R5CB 2FQ6A 2DKJA 4JE5D 3FVSA 4MGRA 4UHNA 5E3KA 3DRDA 3AEPA 3B1EA 1FG3A 1AHYA 1DGDA 4JEXA 1SF2A 2VMXA 4K2BA 4R2NA 1GEWA 2HP2A 3PIUA 3GZDC 5EQCA 1AX4A 1MDOA 1N8PA 3K40A 4IX8A 4WYFA 4F5MA 1GC4A 4Y0HA 2VIAA 1VP4A 2W7DA 3GZCA 4TMRA 1TOKA 3FZ7A 1S07A 2ZC0A 3H7FA 1O4SA 2X3LA 1GCKA 1GEXA 1TASA 2JJHA 4RJYA 2ZY4A 2VLFA 1BKGA 3H14A 2ZP7A 1OHWA 2YCTA 4ATQA 3FRKA 3AOWA 3EZSA 4F5JA 3RI6A 2E54A 2O1BA 1M0NA 2VGZA 4QGRA 1YJSA 1S06A 4BMKA 3PGYA 3E2FA 2GB3A 2OGEA 4RKCA 4RIZA 2JJEA 4ADDA 2VMTA 1M0PA 2FYFA 1ZODA 3T32A 3RUYA 3PA9A 1QITA 1S0AA 1C7OA 2TPLA 1LW5A 3N4SA 4OCAA 3AEOA 2CJHA 2OQXA 3TCMA 2PO3A 3EZ1A 4OMAA 2OATA 1DJ9A 2C0RA 3A9XA 3N4RA 3W1JA 2W7LA 2BI2A 1DFOA 2DR1A 3ISLA 4ZDLA 4W8IA 1BT4A 3KKIA 4LW2A 4XJLA 2WK9A 1DJEA 1AMSA 3R9AA 3MKJA 3MADA 1I41A 1OATA 1UU1A 2OGAA 2YKUA 3M5UA 1ASDA 2VIBA 4ISYA 4A6UA 4F5FA 4XQ2A 2QSRA 5KTBA 2E7IA 1C7GA 3LWSA 2NMPA
chains in the Genus database with same CATH topology
4RKDA 3NRAA 1IUGA 1M4NA 3MEBA 5M4BA 3ATHA 1KL2A 2R5CA 1EQBA 2ZY2A 1B9IA 1U08A 2X5FA 3QM2A 4A0FA 1ASAA 4E1OA 3N4XA 4BHDA 4XJOA 2ZY5A 4JEZA 1D2FA 4A00A 1LW4A 1TOGA 1BJOA 3AOVA 3D6KA 4IXZA 1SZKA 2DKBA 2D63A 3USFA 2AY9A 3G7QA 2W8WA 1AAWA 1QIRA 1SVVA 2AY7A 2CH2A 2WKAA 4A6TA 2VMYA 1LC8A 3GWPA 4GSAA 3H9XA 1YJYA 4EB5A 2VMSA 2EPJA 3PPLA 3LVMA 2W7GA 4GE4A 3HT4A 9AATA 3OP7A 5D95A 4CBRA 5M4DA 3AEMC 3NTJA 4JEVA 3ZZKA 4MQQA 4E3RA 2Z9UA 3EI5A 5G4IA 3VK2A 2BI1A 3EI6A 8AATA 1CQ6A 3COGA 3DR7A 3WX9A 2V1PA 3PDBB 3BWNC 1B9HA 4ITGA 4DGTA 4JEYA 2BKWA 4PIWA 1WSTA 2YKYA 4BA4A 5JAYA 1YIZA 4P3MA 4ZDOA 3KGXA 1RVUA 1W7LA 4W91A 3JW9A 2EZ1A 3AATA 3HLMA 1CQ7A 4HVKA 4EMYA 1CJ0A 3WCOA 2FNIA 1I48A 1V72A 2PB2A 3FFRA 2Z9XA 4RITA 3VK4A 2ZY3A 1Y4IA 1N2TA 2FN6A 3ZRQA 3VP6A 2AY6A 5EUDA 3W1HA 1ASNA 1DGEA 3DC1A 1O61A 4FFCA 1ASMA 4JF0A 2ZSMA 5G0AA 4R5FA 4JEWA 3QHXA 3UWCA 2BI9A 1ARHA 3NUBA 3NYUA 1XI9A 2YRIA 4R5ZA 3ZRPA 2DGMA 4UOYA 4F5LA 3A9ZA 1BJNA 3EI8A 3N5MA 4PFNA 4ZLVA 2CB1A 3VOMA 3BB8A 4A6RA 2CJGA 2AEVA 2OKKA 2VMUA 2W7FA 4AH3A 2AY3A 1UKJA 2Q7WA 4ZDPA 4WYDA 2BIEA 3F0HA 1ORDA 3FVXA 2VGSA 2D5YA 1KKPA 2WK8A 3FKDA 3AV7A 2R5EA 1RVYA 4M2KA 5C6UA 2YRRA 4IY7A 1W23A 2BYLA 1AMAA 1SFFA 4KAMA 3MC6A 4WYAA 2R0TA 1AY5A 4BQ0A 1WYUA 1IJIA 3CQ5A 3HQTA 4E77A 2Z1ZA 5K8BA 1KL1A 1MLZA 3BCXA 3K7YA 3JU7A 1SZUA 2JG2A 5G2PA 1BJWA 3WY7A 5J8QA 1TOJA 3WGBA 2VYCA 2BWOA 3B1DA 1CL2A 4XEWA 3BN1A 4U2HA 4OBUA 4EU1A 3E6GA 1B5PA 3F6TA 4J5UA 1BW0A 1YAAA 4A0GA 1PMOA 4GE9A 3KGWA 3LY1A 3PDBA 2W7KA 4F5GA 1G4XA 2GMSA 2W7HA 2GSAA 3JWBA 3QN6A 5LH9A 4EFFA 1AMRA 1I43A 1LK9A 2BIGA 1PMMA 2HUIA 3L8AA 4Q6RA 3EIAA 2EYQA 4H63Q 4MKKA 2YKXA 2XH1A 4IYOB 1OXPA 3L44A 5HDMA 3WZFA 3A9YA 2VMZA 3AELA 3CQ6A 4OT8A 2W8UA 4R8DA 3K28A 3AEJA 4Y0IA 1ARIA 4AZJA 2VMVA 4ITXA 4I8AA 3PAAA 1IAXA 1ARSA 1E5FA 1MLYA 2FNUA 3GZDA 1LC7A 1IVRA 4F4EA 3MBBA 1UU2A 4WYCA 2CH1A 2EH6A 4U1TA 4WYEA 3QI6A 3FTBA 3IF2A 4JF1A 3FDDA 4IXSA 4WYGA 3FQ8A 1W7MA 1OHYA 3BCBA 5EUNA 1TATA 2JJFA 4OYTA 3WLXA 2Z9VA 1AHEA 3MAFB 3DXVA 1D7UA 2F8JA 1SZSA 5E4ZA 3HBXA 3NX3A 3ASAA 1AJSB 4MQPA 2VMPA 1C9CA 1CS1A 4ADCA 2BWPA 4LW4A 4EB7A 4IW7A 3ZRRA 4DQ6A 3BS8A 2D7YA 1BS0A 3NNKA 3DR4A 4RAEA 5EIGB 2AY4A 2W8TA 3GJUA 2CJDA 3LVLB 1KKJA 3TQXA 1Z7DA 1W7NA 2O7CA 5DJ9A 2YCNA 1M7YA 4AOAA 5EAAA 4BA5A 3KE3A 2BI5A 2GQNA 1ZC9A 4E3QA 1IX7A 1GC2A 1TARA 2AY8A 4MY5A 2VI8A 3GETA 3PDXA 4XJPA 1JG8A 2VGUA 3ECDA 1T3IA 5G2QA 5LHAA 1QGNA 2FM1A 1FG7A 2EGYA 4WB0B 4AO9A 3N7NA 3PJ0A 4HF8A 1YIYA 2HORA 4M2MA 1Z3ZA 4F5IA 5FT6A 3UAKA 2QB2A 2E7UA 2WK7A 4F5HA 5FT8A 4WLJA 1ASGA 3NDNA 1BQDA 2C7TA 4J8LA 3NUIA 4ATPA 1AY8A 2DGLA 3QPGA 2HOYA 3BCAA 3G8MA 3FCRA 4XAUA 1TOEA 2CANA 2C44A 2CFBA 2E7JA 3B8XA 3BC8A 3DZZA 3JTXA 5EFSA 4IYOA 3HL2A 4CXRA 1G7XA 3RQ1A 1O62A 3QBOA 4XK1A 5FT5A 1MAQA 1MGVA 4A0HA 1YNUA 1X2AA 2BIAA 2VMQA 1MDXA 1V2FA 5M46A 1ASBA 1D7VA 3E2YA 4M2JA 4WXGA 1IX6A 1WYTB 1AHFA 1GC3A 3FVUA 4JE5A 2W7JA 2Z20A 4AO4A 3E77A 5F8VA 3TFUA 5E5IA 1EJIA 3EUCA 3VK3A 1M32A 3MC6C 1YOOA 2W7EA 4N0BA 1G4VA 4LNLA 3WGCA 1IBJA 1D7SA 3DYDA 1AKBA 2HP1A 2VLHA 1G7WA 1QJ5A 1AJSA 3GSBA 3OKSA 3ASBA 1AMQA 3FFHA 1AKCA 1WYVB 3DXWA 1FC4A 3E9KA 3FD0A 4MQRA 2AEUA 1O69A 4FL0A 1AHGA 4Q75A 5HHYA 5D5SA 3G0TA 3ACZA 4CVQA 1M0OA 3NYSA 4WP0A 5EIGA 1BJ4A 1DKAA 1EG5A 4TN4A 1BQAA 1N31A 3WKSA 2BYJA 2O0RA 3A2BA 2YHKA 4H51A 5DB5A 4ZASA 4WBTA 1C7NA 1AY4A 2CTZA 2CY8A 1AAMA 3ELEA 4UHOA 1H0CA 1H1CA 4K05A 1W3UA 3P1TA 1ASCA 1D7RA 1LS3A 2HUFA 4UHMA 4K2IA 1AKAA 4B98A 1X29A 1C4KA 2QB3A 3BWOA 3GR9A 1GD9A 4Y0DA 1OXOA 4W1WA 2GMUA 1ASFA 4K2MA 3EI7A 4A0RA 1JS6A 3AEJC 2FKIA 2W8JA 3RCHB 2WB6A 1QJ3A 4PFFA 4Q31A 3MAUA 3W1IA 2HZPA 4KYOA 3RBLA 1M6SA 1BJOB 4RLGA 3TATA 1P3WA 2EZ2A 2R2NA 5DJ1A 2D65A 2ZJGA 3WKRA 1JF9A 2QLRA 2W8VA 2QMAA 5G09A 3N75A 2VGTA 2DGKA 1LKCA 3WCNA 4ZWVA 5FT4A 3I4JA 3CQ4A 3GBXA 2W7MA 4A72A 5M49A 2D61A 2HUUA 2VMNA 4LC3A 1UU0A 2ORDA 1WYTA 4W5KA 2VI9A 1CZCA 2D64A 2JGTA 1CZEA 2EO5A 4ZM3A 1DTYA 1TOIA 3EIBA 2X5DA 1PFFA 2YOBA 1LC5A 2Z1YA 1ZOBA 4PVFA 1AICA 1CQ8A 3B46A 3PD6B 4GRXA 2Z67A 2W7IA 4LNJA 2G7JA 1KMKA 4AZKA 1WYVA 3E2ZB 4L0OA 5BJ3A 4ZSYA 4GDYA 5IWQA 1RV4A 1YJZA 4LNMA 1ECXA 1MDZA 2D66A 2AATA 2G6WA 2HOXA 3IHJA 3NYTA 1QZ9A 2QBTA 4OBVA 1ELUA 3LVJA 2D7ZA 2YKVA 2ZSLA 3JWAA 5AX8A 1DJUA 4W1XA 2DOUA 2ZYJA 4ZSWA 2QA3A 4WD2A 1ASLA 3DU4A 1S09A 2BWNA 4O6ZA 4UQVA 2VMWA 5TF5A 2CSTA 3N0LA 3FZ6A 1VJOA 2CINA 2HOZA 2OKJA 2ZUKA 3EI9A 5DX5A 3AENB 1AIBA 5F9SA 1OHVA 4B9BA 1XEYA 4TV7A 1WKHA 3I5TA 3RBFA 3RCHA 3TFTA 4OTLA 3BV0A 4P7YA 2A1VA 1GBNA 3II0A 3HMUA 4OC9A 4RJ0A 3R4TA 4ZWMA 2PB0A 1GDEA 2BHXA 1TPLA 3JZLA 1WYUB 1AHXA 1VEFA 3UE8A 1X0MA 5EUEA 1ELQA 4RM1A 4ADEA 3DODA 4GEBA 1I29A 1AJRA 2JISA 3FQAA 2KFPA 2AY5A 4MKJA 4MSOA 1QISA 1V2DA 2VMOA 4DBCA 3LV2A 4XJMA 4KXKA 3QGUA 5G4JA 3P6KA 3HVYA 1AIAA 3A8UX 7AATA 4N0WA 4CBSA 2VGVA 1ASEA 1V2EA 3I16A 1M0QA 2V0YA 4WXBA 3FQ7A 4GE7A 1J32A 1B4XA 3Q8NA 3PD6A 5BJ4A 3MAFA 1SPAA 2RFVA 3FZ8A 4W1VA 1ARGA 3NU7A 3LVKA 3AEMA 1GC0A 1KMJA 3E2ZA 3HDOA 2Z9WA 3FDBA 4Q76A 2JJGA 1C0NA 1B8GA 2BI3A 1WKGA 1B5OA 2AY1A 2Z61A 2AY2A 1S08A 5EAVA 3LG0A 3VAXA 3BWNA 3NU8A 4F5KA 2YCPA 4ZAHA 1MAPA 3FSLA 4IXOA 1E5EA 2C81A 3F9TA 4ADBA 1RV3A 4WXFA 5I92A 1CL1A 1X28A 1GEYA 1ARTA 2X8UA 1JS3A 3CAIA 3ELPA 3CBFA 1IX8A 3B1CA 4NOGA 1IAYA 2XBNA 2VMRA 2VGWA 3AENA 4WB0A 1PG8A 4WLHA 4CXQA 4ZM4A 3ZZJA 5HXXA 1J04A 2R5CB 2FQ6A 2DKJA 4JE5D 3FVSA 4MGRA 4UHNA 5E3KA 3DRDA 3AEPA 3B1EA 1FG3A 1AHYA 1DGDA 4JEXA 1SF2A 2VMXA 4K2BA 4R2NA 1GEWA 2HP2A 3PIUA 3GZDC 5EQCA 1AX4A 1MDOA 1N8PA 3K40A 4IX8A 4WYFA 4F5MA 1GC4A 4Y0HA 2VIAA 1VP4A 2W7DA 3GZCA 4TMRA 1TOKA 3FZ7A 1S07A 2ZC0A 3H7FA 1O4SA 2X3LA 1GCKA 1GEXA 1TASA 2JJHA 4RJYA 2ZY4A 2VLFA 1BKGA 3H14A 2ZP7A 1OHWA 2YCTA 4ATQA 3FRKA 3AOWA 3EZSA 4F5JA 3RI6A 2E54A 2O1BA 1M0NA 2VGZA 4QGRA 1YJSA 1S06A 4BMKA 3PGYA 3E2FA 2GB3A 2OGEA 4RKCA 4RIZA 2JJEA 4ADDA 2VMTA 1M0PA 2FYFA 1ZODA 3T32A 3RUYA 3PA9A 1QITA 1S0AA 1C7OA 2TPLA 1LW5A 3N4SA 4OCAA 3AEOA 2CJHA 2OQXA 3TCMA 2PO3A 3EZ1A 4OMAA 2OATA 1DJ9A 2C0RA 3A9XA 3N4RA 3W1JA 2W7LA 2BI2A 1DFOA 2DR1A 3ISLA 4ZDLA 4W8IA 1BT4A 3KKIA 4LW2A 4XJLA 2WK9A 1DJEA 1AMSA 3R9AA 3MKJA 3MADA 1I41A 1OATA 1UU1A 2OGAA 2YKUA 3M5UA 1ASDA 2VIBA 4ISYA 4A6UA 4F5FA 4XQ2A 2QSRA 5KTBA 2E7IA 1C7GA 3LWSA 2NMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKD A;  3NRA A;  1IUG A;  1M4N A;  3MEB A;  5M4B A;  3ATH A;  1KL2 A;  2R5C A;  1EQB A;  2ZY2 A;  1B9I A;  1U08 A;  2X5F A;  3QM2 A;  4A0F A;  1ASA A;  4E1O A;  4BHD A;  4XJO A;  2ZY5 A;  4JEZ A;  1D2F A;  4A00 A;  1LW4 A;  1TOG A;  1BJO A;  3AOV A;  3D6K A;  4IXZ A;  1SZK A;  2DKB A;  2D63 A;  3USF A;  2AY9 A;  3G7Q A;  2W8W A;  1AAW A;  1QIR A;  1SVV A;  2AY7 A;  2CH2 A;  2WKA A;  4A6T A;  2VMY A;  1LC8 A;  3GWP A;  4GSA A;  1YJY A;  4EB5 A;  2VMS A;  2EPJ A;  3PPL A;  3LVM A;  2W7G A;  4GE4 A;  3HT4 A;  9AAT A;  3OP7 A;  5D95 A;  4CBR A;  5M4D A;  3AEM C;  3NTJ A;  4JEV A;  3ZZK A;  4MQQ A;  4E3R A;  2Z9U A;  3EI5 A;  5G4I A;  3VK2 A;  2BI1 A;  3EI6 A;  8AAT A;  1CQ6 A;  3COG A;  3DR7 A;  3WX9 A;  2V1P A;  3PDB B;  3BWN C;  1B9H A;  4ITG A;  4DGT A;  4JEY A;  2BKW A;  4PIW A;  1WST A;  2YKY A;  4BA4 A;  5JAY A;  1YIZ A;  4P3M A;  4ZDO A;  3KGX A;  1RVU A;  1W7L A;  4W91 A;  3JW9 A;  2EZ1 A;  3AAT A;  3HLM A;  1CQ7 A;  4HVK A;  4EMY A;  1CJ0 A;  3WCO A;  2FNI A;  1I48 A;  1V72 A;  2PB2 A;  3FFR A;  2Z9X A;  4RIT A;  3VK4 A;  2ZY3 A;  1Y4I A;  1N2T A;  2FN6 A;  3ZRQ A;  3VP6 A;  2AY6 A;  5EUD A;  3W1H A;  1ASN A;  1DGE A;  3DC1 A;  1O61 A;  4FFC A;  1ASM A;  4JF0 A;  2ZSM A;  5G0A A;  4R5F A;  4JEW A;  3QHX A;  3UWC A;  2BI9 A;  1ARH A;  3NUB A;  3NYU A;  1XI9 A;  2YRI A;  4R5Z A;  3ZRP A;  2DGM A;  4UOY A;  4F5L A;  3A9Z A;  1BJN A;  3EI8 A;  3N5M A;  4PFN A;  4ZLV A;  2CB1 A;  3VOM A;  3BB8 A;  4A6R A;  2CJG A;  2AEV A;  2OKK A;  2VMU A;  2W7F A;  4AH3 A;  2AY3 A;  1UKJ A;  2Q7W A;  4ZDP A;  4WYD A;  2BIE A;  3F0H A;  1ORD A;  3FVX A;  2VGS A;  2D5Y A;  1KKP A;  2WK8 A;  3FKD A;  3AV7 A;  2R5E A;  1RVY A;  4M2K A;  5C6U A;  2YRR A;  4IY7 A;  1W23 A;  2BYL A;  1AMA A;  1SFF A;  4KAM A;  3MC6 A;  4WYA A;  2R0T A;  1AY5 A;  4BQ0 A;  1WYU A;  1IJI A;  3CQ5 A;  3HQT A;  4E77 A;  2Z1Z A;  5K8B A;  1KL1 A;  1MLZ A;  3BCX A;  3K7Y A;  3JU7 A;  1SZU A;  2JG2 A;  5G2P A;  1BJW A;  3WY7 A;  5J8Q A;  1TOJ A;  3WGB A;  2VYC A;  2BWO A;  3B1D A;  1CL2 A;  4XEW A;  3BN1 A;  4U2H A;  4OBU A;  4EU1 A;  3E6G A;  1B5P A;  3F6T A;  4J5U A;  1BW0 A;  1YAA A;  4A0G A;  1PMO A;  4GE9 A;  3KGW A;  3LY1 A;  3PDB A;  2W7K A;  4F5G A;  1G4X A;  2GMS A;  2W7H A;  2GSA A;  3JWB A;  3QN6 A;  5LH9 A;  4EFF A;  1AMR A;  1I43 A;  1LK9 A;  2BIG A;  1PMM A;  2HUI A;  3L8A A;  4Q6R A;  3EIA A;  4MKK A;  2YKX A;  2XH1 A;  4IYO B;  1OXP A;  3L44 A;  5HDM A;  3WZF A;  3A9Y A;  2VMZ A;  3AEL A;  3CQ6 A;  4OT8 A;  2W8U A;  4R8D A;  3K28 A;  3AEJ A;  4Y0I A;  1ARI A;  4AZJ A;  2VMV A;  4ITX A;  4I8A A;  3PAA A;  1IAX A;  1ARS A;  1E5F A;  1MLY A;  2FNU A;  3GZD A;  1LC7 A;  1IVR A;  4F4E A;  3MBB A;  1UU2 A;  4WYC A;  2CH1 A;  2EH6 A;  4U1T A;  4WYE A;  3QI6 A;  3FTB A;  3IF2 A;  4JF1 A;  3FDD A;  4IXS A;  4WYG A;  3FQ8 A;  1W7M A;  1OHY A;  3BCB A;  5EUN A;  1TAT A;  2JJF A;  4OYT A;  3WLX A;  2Z9V A;  1AHE A;  3MAF B;  3DXV A;  1D7U A;  2F8J A;  1SZS A;  5E4Z A;  3HBX A;  3NX3 A;  3ASA A;  1AJS B;  4MQP A;  2VMP A;  1C9C A;  1CS1 A;  4ADC A;  2BWP A;  4LW4 A;  4EB7 A;  4IW7 A;  3ZRR A;  4DQ6 A;  3BS8 A;  2D7Y A;  1BS0 A;  3NNK A;  3DR4 A;  4RAE A;  5EIG B;  2AY4 A;  2W8T A;  3GJU A;  2CJD A;  3LVL B;  1KKJ A;  3TQX A;  1Z7D A;  1W7N A;  2O7C A;  5DJ9 A;  2YCN A;  1M7Y A;  4AOA A;  5EAA A;  4BA5 A;  3KE3 A;  2BI5 A;  2GQN A;  1ZC9 A;  4E3Q A;  1IX7 A;  1GC2 A;  1TAR A;  2AY8 A;  4MY5 A;  2VI8 A;  3GET A;  3PDX A;  4XJP A;  1JG8 A;  2VGU A;  3ECD A;  1T3I A;  5G2Q A;  5LHA A;  1QGN A;  2FM1 A;  1FG7 A;  2EGY A;  4WB0 B;  4AO9 A;  3PJ0 A;  4HF8 A;  1YIY A;  2HOR A;  4M2M A;  1Z3Z A;  4F5I A;  5FT6 A;  3UAK A;  2QB2 A;  2E7U A;  2WK7 A;  4F5H A;  5FT8 A;  4WLJ A;  1ASG A;  3NDN A;  1BQD A;  2C7T A;  4J8L A;  3NUI A;  4ATP A;  1AY8 A;  2DGL A;  3QPG A;  2HOY A;  3BCA A;  3G8M A;  3FCR A;  4XAU A;  1TOE A;  2CAN A;  2C44 A;  2CFB A;  2E7J A;  3B8X A;  3BC8 A;  3DZZ A;  3JTX A;  5EFS A;  4IYO A;  3HL2 A;  4CXR A;  1G7X A;  3RQ1 A;  1O62 A;  3QBO A;  4XK1 A;  5FT5 A;  1MAQ A;  1MGV A;  4A0H A;  1YNU A;  1X2A A;  2BIA A;  2VMQ A;  1MDX A;  1V2F A;  5M46 A;  1ASB A;  1D7V A;  3E2Y A;  4M2J A;  4WXG A;  1IX6 A;  1WYT B;  1AHF A;  1GC3 A;  3FVU A;  4JE5 A;  2W7J A;  2Z20 A;  4AO4 A;  3E77 A;  5F8V A;  3TFU A;  5E5I A;  1EJI A;  3EUC A;  3VK3 A;  1M32 A;  3MC6 C;  1YOO A;  2W7E A;  4N0B A;  1G4V A;  4LNL A;  3WGC A;  1IBJ A;  1D7S A;  3DYD A;  1AKB A;  2HP1 A;  2VLH A;  1G7W A;  1QJ5 A;  1AJS A;  3GSB A;  3OKS A;  3ASB A;  1AMQ A;  3FFH A;  1AKC A;  1WYV B;  3DXW A;  1FC4 A;  3E9K A;  3FD0 A;  4MQR A;  2AEU A;  1O69 A;  4FL0 A;  1AHG A;  4Q75 A;  5HHY A;  5D5S A;  3G0T A;  3ACZ A;  4CVQ A;  1M0O A;  3NYS A;  4WP0 A;  5EIG A;  1BJ4 A;  1DKA A;  1EG5 A;  4TN4 A;  1BQA A;  1N31 A;  3WKS A;  2BYJ A;  2O0R A;  3A2B A;  2YHK A;  4H51 A;  5DB5 A;  4ZAS A;  4WBT A;  1C7N A;  1AY4 A;  2CTZ A;  2CY8 A;  1AAM A;  3ELE A;  4UHO A;  1H0C A;  1H1C A;  1W3U A;  3P1T A;  1ASC A;  1D7R A;  1LS3 A;  2HUF A;  4UHM A;  4K2I A;  1AKA A;  4B98 A;  1X29 A;  1C4K A;  2QB3 A;  3BWO A;  3GR9 A;  1GD9 A;  4Y0D A;  1OXO A;  4W1W A;  2GMU A;  1ASF A;  4K2M A;  3EI7 A;  4A0R A;  1JS6 A;  3AEJ C;  2W8J A;  3RCH B;  1QJ3 A;  4PFF A;  4Q31 A;  3MAU A;  3W1I A;  2HZP A;  4KYO A;  3RBL A;  1M6S A;  1BJO B;  4RLG A;  3TAT A;  1P3W A;  2EZ2 A;  2R2N A;  5DJ1 A;  2D65 A;  2ZJG A;  3WKR A;  1JF9 A;  2QLR A;  2W8V A;  2QMA A;  5G09 A;  3N75 A;  2VGT A;  2DGK A;  1LKC A;  3WCN A;  4ZWV A;  5FT4 A;  3I4J A;  3CQ4 A;  3GBX A;  2W7M A;  4A72 A;  5M49 A;  2D61 A;  2HUU A;  2VMN A;  4LC3 A;  1UU0 A;  2ORD A;  1WYT A;  4W5K A;  2VI9 A;  1CZC A;  2D64 A;  2JGT A;  1CZE A;  2EO5 A;  4ZM3 A;  1DTY A;  1TOI A;  3EIB A;  2X5D A;  1PFF A;  2YOB A;  1LC5 A;  2Z1Y A;  1ZOB A;  4PVF A;  1AIC A;  1CQ8 A;  3B46 A;  3PD6 B;  4GRX A;  2Z67 A;  2W7I A;  4LNJ A;  1KMK A;  4AZK A;  1WYV A;  3E2Z B;  4L0O A;  5BJ3 A;  4ZSY A;  4GDY A;  5IWQ A;  1RV4 A;  1YJZ A;  4LNM A;  1ECX A;  1MDZ A;  2D66 A;  2AAT A;  2G6W A;  2HOX A;  3IHJ A;  3NYT A;  1QZ9 A;  2QBT A;  4OBV A;  1ELU A;  3LVJ A;  2D7Z A;  2YKV A;  2ZSL A;  3JWA A;  5AX8 A;  1DJU A;  4W1X A;  2DOU A;  2ZYJ A;  4ZSW A;  2QA3 A;  4WD2 A;  1ASL A;  3DU4 A;  1S09 A;  2BWN A;  4O6Z A;  4UQV A;  2VMW A;  5TF5 A;  2CST A;  3N0L A;  3FZ6 A;  1VJO A;  2CIN A;  2HOZ A;  2OKJ A;  2ZUK A;  3EI9 A;  5DX5 A;  3AEN B;  1AIB A;  5F9S A;  1OHV A;  4B9B A;  1XEY A;  4TV7 A;  1WKH A;  3I5T A;  3RBF A;  3RCH A;  3TFT A;  4OTL A;  3BV0 A;  4P7Y A;  1GBN A;  3II0 A;  3HMU A;  4OC9 A;  4RJ0 A;  3R4T A;  4ZWM A;  2PB0 A;  1GDE A;  2BHX A;  1TPL A;  3JZL A;  1WYU B;  1AHX A;  1VEF A;  3UE8 A;  1X0M A;  5EUE A;  1ELQ A;  4RM1 A;  4ADE A;  3DOD A;  4GEB A;  1I29 A;  1AJR A;  2JIS A;  3FQA A;  2AY5 A;  4MKJ A;  4MSO A;  1QIS A;  1V2D A;  2VMO A;  4DBC A;  3LV2 A;  4XJM A;  4KXK A;  3QGU A;  5G4J A;  3P6K A;  3HVY A;  1AIA A;  3A8U X;  7AAT A;  4N0W A;  4CBS A;  2VGV A;  1ASE A;  1V2E A;  3I16 A;  1M0Q A;  2V0Y A;  4WXB A;  3FQ7 A;  4GE7 A;  1J32 A;  1B4X A;  3Q8N A;  3PD6 A;  5BJ4 A;  3MAF A;  1SPA A;  2RFV A;  3FZ8 A;  4W1V A;  1ARG A;  3NU7 A;  3LVK A;  3AEM A;  1GC0 A;  1KMJ A;  3E2Z A;  3HDO A;  2Z9W A;  3FDB A;  4Q76 A;  2JJG A;  1C0N A;  1B8G A;  2BI3 A;  1WKG A;  1B5O A;  2AY1 A;  2Z61 A;  2AY2 A;  1S08 A;  5EAV A;  3LG0 A;  3VAX A;  3BWN A;  3NU8 A;  4F5K A;  2YCP A;  4ZAH A;  1MAP A;  3FSL A;  4IXO A;  1E5E A;  2C81 A;  3F9T A;  4ADB A;  1RV3 A;  4WXF A;  5I92 A;  1CL1 A;  1X28 A;  1GEY A;  1ART A;  2X8U A;  1JS3 A;  3CAI A;  3ELP A;  3CBF A;  1IX8 A;  3B1C A;  4NOG A;  1IAY A;  2XBN A;  2VMR A;  2VGW A;  3AEN A;  4WB0 A;  1PG8 A;  4WLH A;  4CXQ A;  4ZM4 A;  3ZZJ A;  5HXX A;  1J04 A;  2R5C B;  2FQ6 A;  2DKJ A;  4JE5 D;  3FVS A;  4MGR A;  4UHN A;  5E3K A;  3DRD A;  3AEP A;  3B1E A;  1FG3 A;  1AHY A;  1DGD A;  4JEX A;  1SF2 A;  2VMX A;  4K2B A;  4R2N A;  1GEW A;  2HP2 A;  3PIU A;  3GZD C;  5EQC A;  1AX4 A;  1MDO A;  1N8P A;  3K40 A;  4IX8 A;  4WYF A;  4F5M A;  1GC4 A;  4Y0H A;  2VIA A;  1VP4 A;  2W7D A;  3GZC A;  4TMR A;  1TOK A;  3FZ7 A;  1S07 A;  2ZC0 A;  3H7F A;  1O4S A;  2X3L A;  1GCK A;  1GEX A;  1TAS A;  2JJH A;  4RJY A;  2ZY4 A;  2VLF A;  1BKG A;  3H14 A;  2ZP7 A;  1OHW A;  2YCT A;  4ATQ A;  3FRK A;  3AOW A;  3EZS A;  4F5J A;  3RI6 A;  2E54 A;  2O1B A;  1M0N A;  2VGZ A;  4QGR A;  1YJS A;  1S06 A;  4BMK A;  3PGY A;  3E2F A;  2GB3 A;  2OGE A;  4RKC A;  4RIZ A;  2JJE A;  4ADD A;  2VMT A;  1M0P A;  2FYF A;  1ZOD A;  3T32 A;  3RUY A;  3PA9 A;  1QIT A;  1S0A A;  1C7O A;  2TPL A;  1LW5 A;  4OCA A;  3AEO A;  2CJH A;  2OQX A;  3TCM A;  2PO3 A;  3EZ1 A;  4OMA A;  2OAT A;  1DJ9 A;  2C0R A;  3A9X A;  3W1J A;  2W7L A;  2BI2 A;  1DFO A;  2DR1 A;  3ISL A;  4ZDL A;  4W8I A;  1BT4 A;  3KKI A;  4LW2 A;  4XJL A;  2WK9 A;  1DJE A;  1AMS A;  3R9A A;  3MKJ A;  3MAD A;  1I41 A;  1OAT A;  1UU1 A;  2OGA A;  2YKU A;  3M5U A;  1ASD A;  2VIB A;  4ISY A;  4A6U A;  4F5F A;  4XQ2 A;  2E7I A;  1C7G A;  3LWS A;  2NMP A; 
#chains in the Genus database with same CATH topology
 4RKD A;  3NRA A;  1IUG A;  1M4N A;  3MEB A;  5M4B A;  3ATH A;  1KL2 A;  2R5C A;  1EQB A;  2ZY2 A;  1B9I A;  1U08 A;  2X5F A;  3QM2 A;  4A0F A;  1ASA A;  4E1O A;  3N4X A;  4BHD A;  4XJO A;  2ZY5 A;  4JEZ A;  1D2F A;  4A00 A;  1LW4 A;  1TOG A;  1BJO A;  3AOV A;  3D6K A;  4IXZ A;  1SZK A;  2DKB A;  2D63 A;  3USF A;  2AY9 A;  3G7Q A;  2W8W A;  1AAW A;  1QIR A;  1SVV A;  2AY7 A;  2CH2 A;  2WKA A;  4A6T A;  2VMY A;  1LC8 A;  3GWP A;  4GSA A;  3H9X A;  1YJY A;  4EB5 A;  2VMS A;  2EPJ A;  3PPL A;  3LVM A;  2W7G A;  4GE4 A;  3HT4 A;  9AAT A;  3OP7 A;  5D95 A;  4CBR A;  5M4D A;  3AEM C;  3NTJ A;  4JEV A;  3ZZK A;  4MQQ A;  4E3R A;  2Z9U A;  3EI5 A;  5G4I A;  3VK2 A;  2BI1 A;  3EI6 A;  8AAT A;  1CQ6 A;  3COG A;  3DR7 A;  3WX9 A;  2V1P A;  3PDB B;  3BWN C;  1B9H A;  4ITG A;  4DGT A;  4JEY A;  2BKW A;  4PIW A;  1WST A;  2YKY A;  4BA4 A;  5JAY A;  1YIZ A;  4P3M A;  4ZDO A;  3KGX A;  1RVU A;  1W7L A;  4W91 A;  3JW9 A;  2EZ1 A;  3AAT A;  3HLM A;  1CQ7 A;  4HVK A;  4EMY A;  1CJ0 A;  3WCO A;  2FNI A;  1I48 A;  1V72 A;  2PB2 A;  3FFR A;  2Z9X A;  4RIT A;  3VK4 A;  2ZY3 A;  1Y4I A;  1N2T A;  2FN6 A;  3ZRQ A;  3VP6 A;  2AY6 A;  5EUD A;  3W1H A;  1ASN A;  1DGE A;  3DC1 A;  1O61 A;  4FFC A;  1ASM A;  4JF0 A;  2ZSM A;  5G0A A;  4R5F A;  4JEW A;  3QHX A;  3UWC A;  2BI9 A;  1ARH A;  3NUB A;  3NYU A;  1XI9 A;  2YRI A;  4R5Z A;  3ZRP A;  2DGM A;  4UOY A;  4F5L A;  3A9Z A;  1BJN A;  3EI8 A;  3N5M A;  4PFN A;  4ZLV A;  2CB1 A;  3VOM A;  3BB8 A;  4A6R A;  2CJG A;  2AEV A;  2OKK A;  2VMU A;  2W7F A;  4AH3 A;  2AY3 A;  1UKJ A;  2Q7W A;  4ZDP A;  4WYD A;  2BIE A;  3F0H A;  1ORD A;  3FVX A;  2VGS A;  2D5Y A;  1KKP A;  2WK8 A;  3FKD A;  3AV7 A;  2R5E A;  1RVY A;  4M2K A;  5C6U A;  2YRR A;  4IY7 A;  1W23 A;  2BYL A;  1AMA A;  1SFF A;  4KAM A;  3MC6 A;  4WYA A;  2R0T A;  1AY5 A;  4BQ0 A;  1WYU A;  1IJI A;  3CQ5 A;  3HQT A;  4E77 A;  2Z1Z A;  5K8B A;  1KL1 A;  1MLZ A;  3BCX A;  3K7Y A;  3JU7 A;  1SZU A;  2JG2 A;  5G2P A;  1BJW A;  3WY7 A;  5J8Q A;  1TOJ A;  3WGB A;  2VYC A;  2BWO A;  3B1D A;  1CL2 A;  4XEW A;  3BN1 A;  4U2H A;  4OBU A;  4EU1 A;  3E6G A;  1B5P A;  3F6T A;  4J5U A;  1BW0 A;  1YAA A;  4A0G A;  1PMO A;  4GE9 A;  3KGW A;  3LY1 A;  3PDB A;  2W7K A;  4F5G A;  1G4X A;  2GMS A;  2W7H A;  2GSA A;  3JWB A;  3QN6 A;  5LH9 A;  4EFF A;  1AMR A;  1I43 A;  1LK9 A;  2BIG A;  1PMM A;  2HUI A;  3L8A A;  4Q6R A;  3EIA A;  2EYQ A;  4H63 Q;  4MKK A;  2YKX A;  2XH1 A;  4IYO B;  1OXP A;  3L44 A;  5HDM A;  3WZF A;  3A9Y A;  2VMZ A;  3AEL A;  3CQ6 A;  4OT8 A;  2W8U A;  4R8D A;  3K28 A;  3AEJ A;  4Y0I A;  1ARI A;  4AZJ A;  2VMV A;  4ITX A;  4I8A A;  3PAA A;  1IAX A;  1ARS A;  1E5F A;  1MLY A;  2FNU A;  3GZD A;  1LC7 A;  1IVR A;  4F4E A;  3MBB A;  1UU2 A;  4WYC A;  2CH1 A;  2EH6 A;  4U1T A;  4WYE A;  3QI6 A;  3FTB A;  3IF2 A;  4JF1 A;  3FDD A;  4IXS A;  4WYG A;  3FQ8 A;  1W7M A;  1OHY A;  3BCB A;  5EUN A;  1TAT A;  2JJF A;  4OYT A;  3WLX A;  2Z9V A;  1AHE A;  3MAF B;  3DXV A;  1D7U A;  2F8J A;  1SZS A;  5E4Z A;  3HBX A;  3NX3 A;  3ASA A;  1AJS B;  4MQP A;  2VMP A;  1C9C A;  1CS1 A;  4ADC A;  2BWP A;  4LW4 A;  4EB7 A;  4IW7 A;  3ZRR A;  4DQ6 A;  3BS8 A;  2D7Y A;  1BS0 A;  3NNK A;  3DR4 A;  4RAE A;  5EIG B;  2AY4 A;  2W8T A;  3GJU A;  2CJD A;  3LVL B;  1KKJ A;  3TQX A;  1Z7D A;  1W7N A;  2O7C A;  5DJ9 A;  2YCN A;  1M7Y A;  4AOA A;  5EAA A;  4BA5 A;  3KE3 A;  2BI5 A;  2GQN A;  1ZC9 A;  4E3Q A;  1IX7 A;  1GC2 A;  1TAR A;  2AY8 A;  4MY5 A;  2VI8 A;  3GET A;  3PDX A;  4XJP A;  1JG8 A;  2VGU A;  3ECD A;  1T3I A;  5G2Q A;  5LHA A;  1QGN A;  2FM1 A;  1FG7 A;  2EGY A;  4WB0 B;  4AO9 A;  3N7N A;  3PJ0 A;  4HF8 A;  1YIY A;  2HOR A;  4M2M A;  1Z3Z A;  4F5I A;  5FT6 A;  3UAK A;  2QB2 A;  2E7U A;  2WK7 A;  4F5H A;  5FT8 A;  4WLJ A;  1ASG A;  3NDN A;  1BQD A;  2C7T A;  4J8L A;  3NUI A;  4ATP A;  1AY8 A;  2DGL A;  3QPG A;  2HOY A;  3BCA A;  3G8M A;  3FCR A;  4XAU A;  1TOE A;  2CAN A;  2C44 A;  2CFB A;  2E7J A;  3B8X A;  3BC8 A;  3DZZ A;  3JTX A;  5EFS A;  4IYO A;  3HL2 A;  1KAF A;  4CXR A;  1G7X A;  3RQ1 A;  1O62 A;  3QBO A;  4XK1 A;  5FT5 A;  1MAQ A;  1MGV A;  4A0H A;  1YNU A;  1X2A A;  2BIA A;  2VMQ A;  1MDX A;  1V2F A;  5M46 A;  1ASB A;  1D7V A;  3E2Y A;  4M2J A;  4WXG A;  1IX6 A;  1WYT B;  1AHF A;  1GC3 A;  3FVU A;  4JE5 A;  2W7J A;  2Z20 A;  4AO4 A;  3E77 A;  5F8V A;  3TFU A;  5E5I A;  1EJI A;  3EUC A;  3VK3 A;  1M32 A;  3MC6 C;  1YOO A;  2W7E A;  4N0B A;  1G4V A;  4LNL A;  3WGC A;  1IBJ A;  1D7S A;  3DYD A;  1AKB A;  2HP1 A;  2VLH A;  1G7W A;  1QJ5 A;  1AJS A;  3GSB A;  3OKS A;  3ASB A;  1AMQ A;  3FFH A;  1AKC A;  1WYV B;  3DXW A;  1FC4 A;  3E9K A;  3FD0 A;  4MQR A;  2AEU A;  1O69 A;  4FL0 A;  1AHG A;  4Q75 A;  5HHY A;  5D5S A;  3G0T A;  3ACZ A;  4CVQ A;  1M0O A;  3NYS A;  4WP0 A;  5EIG A;  1BJ4 A;  1DKA A;  1EG5 A;  4TN4 A;  1BQA A;  1N31 A;  3WKS A;  2BYJ A;  2O0R A;  3A2B A;  2YHK A;  4H51 A;  5DB5 A;  4ZAS A;  4WBT A;  1C7N A;  1AY4 A;  2CTZ A;  2CY8 A;  1AAM A;  3ELE A;  4UHO A;  1H0C A;  1H1C A;  4K05 A;  1W3U A;  3P1T A;  1ASC A;  1D7R A;  1LS3 A;  2HUF A;  4UHM A;  4K2I A;  1AKA A;  4B98 A;  1X29 A;  1C4K A;  2QB3 A;  3BWO A;  3GR9 A;  1GD9 A;  4Y0D A;  1OXO A;  4W1W A;  2GMU A;  1ASF A;  4K2M A;  3EI7 A;  4A0R A;  1JS6 A;  3AEJ C;  2FKI A;  2W8J A;  3RCH B;  2WB6 A;  1QJ3 A;  4PFF A;  4Q31 A;  3MAU A;  3W1I A;  2HZP A;  4KYO A;  3RBL A;  1M6S A;  1BJO B;  4RLG A;  3TAT A;  1P3W A;  2EZ2 A;  2R2N A;  5DJ1 A;  2D65 A;  2ZJG A;  3WKR A;  1JF9 A;  2QLR A;  2W8V A;  2QMA A;  5G09 A;  3N75 A;  2VGT A;  2DGK A;  1LKC A;  3WCN A;  4ZWV A;  5FT4 A;  3I4J A;  3CQ4 A;  3GBX A;  2W7M A;  4A72 A;  5M49 A;  2D61 A;  2HUU A;  2VMN A;  4LC3 A;  1UU0 A;  2ORD A;  1WYT A;  4W5K A;  2VI9 A;  1CZC A;  2D64 A;  2JGT A;  1CZE A;  2EO5 A;  4ZM3 A;  1DTY A;  1TOI A;  3EIB A;  2X5D A;  1PFF A;  2YOB A;  1LC5 A;  2Z1Y A;  1ZOB A;  4PVF A;  1AIC A;  1CQ8 A;  3B46 A;  3PD6 B;  4GRX A;  2Z67 A;  2W7I A;  4LNJ A;  2G7J A;  1KMK A;  4AZK A;  1WYV A;  3E2Z B;  4L0O A;  5BJ3 A;  4ZSY A;  4GDY A;  5IWQ A;  1RV4 A;  1YJZ A;  4LNM A;  1ECX A;  1MDZ A;  2D66 A;  2AAT A;  2G6W A;  2HOX A;  3IHJ A;  3NYT A;  1QZ9 A;  2QBT A;  4OBV A;  1ELU A;  3LVJ A;  2D7Z A;  2YKV A;  2ZSL A;  3JWA A;  5AX8 A;  1DJU A;  4W1X A;  2DOU A;  2ZYJ A;  4ZSW A;  2QA3 A;  4WD2 A;  1ASL A;  3DU4 A;  1S09 A;  2BWN A;  4O6Z A;  4UQV A;  2VMW A;  5TF5 A;  2CST A;  3N0L A;  3FZ6 A;  1VJO A;  2CIN A;  2HOZ A;  2OKJ A;  2ZUK A;  3EI9 A;  5DX5 A;  3AEN B;  1AIB A;  5F9S A;  1OHV A;  4B9B A;  1XEY A;  4TV7 A;  1WKH A;  3I5T A;  3RBF A;  3RCH A;  3TFT A;  4OTL A;  3BV0 A;  4P7Y A;  2A1V A;  1GBN A;  3II0 A;  3HMU A;  4OC9 A;  4RJ0 A;  3R4T A;  4ZWM A;  2PB0 A;  1GDE A;  2BHX A;  1TPL A;  3JZL A;  1WYU B;  1AHX A;  1VEF A;  3UE8 A;  1X0M A;  5EUE A;  1ELQ A;  4RM1 A;  4ADE A;  3DOD A;  4GEB A;  1I29 A;  1AJR A;  2JIS A;  3FQA A;  2KFP A;  2AY5 A;  4MKJ A;  4MSO A;  1QIS A;  1V2D A;  2VMO A;  4DBC A;  3LV2 A;  4XJM A;  4KXK A;  3QGU A;  5G4J A;  3P6K A;  3HVY A;  1AIA A;  3A8U X;  7AAT A;  4N0W A;  4CBS A;  2VGV A;  1ASE A;  1V2E A;  3I16 A;  1M0Q A;  2V0Y A;  4WXB A;  3FQ7 A;  4GE7 A;  1J32 A;  1B4X A;  3Q8N A;  3PD6 A;  5BJ4 A;  3MAF A;  1SPA A;  2RFV A;  3FZ8 A;  4W1V A;  1ARG A;  3NU7 A;  3LVK A;  3AEM A;  1GC0 A;  1KMJ A;  3E2Z A;  3HDO A;  2Z9W A;  3FDB A;  4Q76 A;  2JJG A;  1C0N A;  1B8G A;  2BI3 A;  1WKG A;  1B5O A;  2AY1 A;  2Z61 A;  2AY2 A;  1S08 A;  5EAV A;  3LG0 A;  3VAX A;  3BWN A;  3NU8 A;  4F5K A;  2YCP A;  4ZAH A;  1MAP A;  3FSL A;  4IXO A;  1E5E A;  2C81 A;  3F9T A;  4ADB A;  1RV3 A;  4WXF A;  5I92 A;  1CL1 A;  1X28 A;  1GEY A;  1ART A;  2X8U A;  1JS3 A;  3CAI A;  3ELP A;  3CBF A;  1IX8 A;  3B1C A;  4NOG A;  1IAY A;  2XBN A;  2VMR A;  2VGW A;  3AEN A;  4WB0 A;  1PG8 A;  4WLH A;  4CXQ A;  4ZM4 A;  3ZZJ A;  5HXX A;  1J04 A;  2R5C B;  2FQ6 A;  2DKJ A;  4JE5 D;  3FVS A;  4MGR A;  4UHN A;  5E3K A;  3DRD A;  3AEP A;  3B1E A;  1FG3 A;  1AHY A;  1DGD A;  4JEX A;  1SF2 A;  2VMX A;  4K2B A;  4R2N A;  1GEW A;  2HP2 A;  3PIU A;  3GZD C;  5EQC A;  1AX4 A;  1MDO A;  1N8P A;  3K40 A;  4IX8 A;  4WYF A;  4F5M A;  1GC4 A;  4Y0H A;  2VIA A;  1VP4 A;  2W7D A;  3GZC A;  4TMR A;  1TOK A;  3FZ7 A;  1S07 A;  2ZC0 A;  3H7F A;  1O4S A;  2X3L A;  1GCK A;  1GEX A;  1TAS A;  2JJH A;  4RJY A;  2ZY4 A;  2VLF A;  1BKG A;  3H14 A;  2ZP7 A;  1OHW A;  2YCT A;  4ATQ A;  3FRK A;  3AOW A;  3EZS A;  4F5J A;  3RI6 A;  2E54 A;  2O1B A;  1M0N A;  2VGZ A;  4QGR A;  1YJS A;  1S06 A;  4BMK A;  3PGY A;  3E2F A;  2GB3 A;  2OGE A;  4RKC A;  4RIZ A;  2JJE A;  4ADD A;  2VMT A;  1M0P A;  2FYF A;  1ZOD A;  3T32 A;  3RUY A;  3PA9 A;  1QIT A;  1S0A A;  1C7O A;  2TPL A;  1LW5 A;  3N4S A;  4OCA A;  3AEO A;  2CJH A;  2OQX A;  3TCM A;  2PO3 A;  3EZ1 A;  4OMA A;  2OAT A;  1DJ9 A;  2C0R A;  3A9X A;  3N4R A;  3W1J A;  2W7L A;  2BI2 A;  1DFO A;  2DR1 A;  3ISL A;  4ZDL A;  4W8I A;  1BT4 A;  3KKI A;  4LW2 A;  4XJL A;  2WK9 A;  1DJE A;  1AMS A;  3R9A A;  3MKJ A;  3MAD A;  1I41 A;  1OAT A;  1UU1 A;  2OGA A;  2YKU A;  3M5U A;  1ASD A;  2VIB A;  4ISY A;  4A6U A;  4F5F A;  4XQ2 A;  2QSR A;  5KTB A;  2E7I A;  1C7G A;  3LWS A;  2NMP A; 
#chains in the Genus database with same CATH homology
 4RKD A;  3NRA A;  1IUG A;  1M4N A;  3MEB A;  5M4B A;  3ATH A;  1KL2 A;  2R5C A;  1EQB A;  2ZY2 A;  1B9I A;  1U08 A;  2X5F A;  3QM2 A;  4A0F A;  1ASA A;  4E1O A;  3N4X A;  4BHD A;  4XJO A;  2ZY5 A;  4JEZ A;  1D2F A;  4A00 A;  1LW4 A;  1TOG A;  1BJO A;  3AOV A;  3D6K A;  4IXZ A;  1SZK A;  2DKB A;  2D63 A;  3USF A;  2AY9 A;  3G7Q A;  2W8W A;  1AAW A;  1QIR A;  1SVV A;  2AY7 A;  2CH2 A;  2WKA A;  4A6T A;  2VMY A;  1LC8 A;  3GWP A;  4GSA A;  3H9X A;  1YJY A;  4EB5 A;  2VMS A;  2EPJ A;  3PPL A;  3LVM A;  2W7G A;  4GE4 A;  3HT4 A;  9AAT A;  3OP7 A;  5D95 A;  4CBR A;  5M4D A;  3AEM C;  3NTJ A;  4JEV A;  3ZZK A;  4MQQ A;  4E3R A;  2Z9U A;  3EI5 A;  5G4I A;  3VK2 A;  2BI1 A;  3EI6 A;  8AAT A;  1CQ6 A;  3COG A;  3DR7 A;  3WX9 A;  2V1P A;  3PDB B;  3BWN C;  1B9H A;  4ITG A;  4DGT A;  4JEY A;  2BKW A;  4PIW A;  1WST A;  2YKY A;  4BA4 A;  5JAY A;  1YIZ A;  4P3M A;  4ZDO A;  3KGX A;  1RVU A;  1W7L A;  4W91 A;  3JW9 A;  2EZ1 A;  3AAT A;  3HLM A;  1CQ7 A;  4HVK A;  4EMY A;  1CJ0 A;  3WCO A;  2FNI A;  1I48 A;  1V72 A;  2PB2 A;  3FFR A;  2Z9X A;  4RIT A;  3VK4 A;  2ZY3 A;  1Y4I A;  1N2T A;  2FN6 A;  3ZRQ A;  3VP6 A;  2AY6 A;  5EUD A;  3W1H A;  1ASN A;  1DGE A;  3DC1 A;  1O61 A;  4FFC A;  1ASM A;  4JF0 A;  2ZSM A;  5G0A A;  4R5F A;  4JEW A;  3QHX A;  3UWC A;  2BI9 A;  1ARH A;  3NUB A;  3NYU A;  1XI9 A;  2YRI A;  4R5Z A;  3ZRP A;  2DGM A;  4UOY A;  4F5L A;  3A9Z A;  1BJN A;  3EI8 A;  3N5M A;  4PFN A;  4ZLV A;  2CB1 A;  3VOM A;  3BB8 A;  4A6R A;  2CJG A;  2AEV A;  2OKK A;  2VMU A;  2W7F A;  4AH3 A;  2AY3 A;  1UKJ A;  2Q7W A;  4ZDP A;  4WYD A;  2BIE A;  3F0H A;  1ORD A;  3FVX A;  2VGS A;  2D5Y A;  1KKP A;  2WK8 A;  3FKD A;  3AV7 A;  2R5E A;  1RVY A;  4M2K A;  5C6U A;  2YRR A;  4IY7 A;  1W23 A;  2BYL A;  1AMA A;  1SFF A;  4KAM A;  3MC6 A;  4WYA A;  2R0T A;  1AY5 A;  4BQ0 A;  1WYU A;  1IJI A;  3CQ5 A;  3HQT A;  4E77 A;  2Z1Z A;  5K8B A;  1KL1 A;  1MLZ A;  3BCX A;  3K7Y A;  3JU7 A;  1SZU A;  2JG2 A;  5G2P A;  1BJW A;  3WY7 A;  5J8Q A;  1TOJ A;  3WGB A;  2VYC A;  2BWO A;  3B1D A;  1CL2 A;  4XEW A;  3BN1 A;  4U2H A;  4OBU A;  4EU1 A;  3E6G A;  1B5P A;  3F6T A;  4J5U A;  1BW0 A;  1YAA A;  4A0G A;  1PMO A;  4GE9 A;  3KGW A;  3LY1 A;  3PDB A;  2W7K A;  4F5G A;  1G4X A;  2GMS A;  2W7H A;  2GSA A;  3JWB A;  3QN6 A;  5LH9 A;  4EFF A;  1AMR A;  1I43 A;  1LK9 A;  2BIG A;  1PMM A;  2HUI A;  3L8A A;  4Q6R A;  3EIA A;  2EYQ A;  4H63 Q;  4MKK A;  2YKX A;  2XH1 A;  4IYO B;  1OXP A;  3L44 A;  5HDM A;  3WZF A;  3A9Y A;  2VMZ A;  3AEL A;  3CQ6 A;  4OT8 A;  2W8U A;  4R8D A;  3K28 A;  3AEJ A;  4Y0I A;  1ARI A;  4AZJ A;  2VMV A;  4ITX A;  4I8A A;  3PAA A;  1IAX A;  1ARS A;  1E5F A;  1MLY A;  2FNU A;  3GZD A;  1LC7 A;  1IVR A;  4F4E A;  3MBB A;  1UU2 A;  4WYC A;  2CH1 A;  2EH6 A;  4U1T A;  4WYE A;  3QI6 A;  3FTB A;  3IF2 A;  4JF1 A;  3FDD A;  4IXS A;  4WYG A;  3FQ8 A;  1W7M A;  1OHY A;  3BCB A;  5EUN A;  1TAT A;  2JJF A;  4OYT A;  3WLX A;  2Z9V A;  1AHE A;  3MAF B;  3DXV A;  1D7U A;  2F8J A;  1SZS A;  5E4Z A;  3HBX A;  3NX3 A;  3ASA A;  1AJS B;  4MQP A;  2VMP A;  1C9C A;  1CS1 A;  4ADC A;  2BWP A;  4LW4 A;  4EB7 A;  4IW7 A;  3ZRR A;  4DQ6 A;  3BS8 A;  2D7Y A;  1BS0 A;  3NNK A;  3DR4 A;  4RAE A;  5EIG B;  2AY4 A;  2W8T A;  3GJU A;  2CJD A;  3LVL B;  1KKJ A;  3TQX A;  1Z7D A;  1W7N A;  2O7C A;  5DJ9 A;  2YCN A;  1M7Y A;  4AOA A;  5EAA A;  4BA5 A;  3KE3 A;  2BI5 A;  2GQN A;  1ZC9 A;  4E3Q A;  1IX7 A;  1GC2 A;  1TAR A;  2AY8 A;  4MY5 A;  2VI8 A;  3GET A;  3PDX A;  4XJP A;  1JG8 A;  2VGU A;  3ECD A;  1T3I A;  5G2Q A;  5LHA A;  1QGN A;  2FM1 A;  1FG7 A;  2EGY A;  4WB0 B;  4AO9 A;  3N7N A;  3PJ0 A;  4HF8 A;  1YIY A;  2HOR A;  4M2M A;  1Z3Z A;  4F5I A;  5FT6 A;  3UAK A;  2QB2 A;  2E7U A;  2WK7 A;  4F5H A;  5FT8 A;  4WLJ A;  1ASG A;  3NDN A;  1BQD A;  2C7T A;  4J8L A;  3NUI A;  4ATP A;  1AY8 A;  2DGL A;  3QPG A;  2HOY A;  3BCA A;  3G8M A;  3FCR A;  4XAU A;  1TOE A;  2CAN A;  2C44 A;  2CFB A;  2E7J A;  3B8X A;  3BC8 A;  3DZZ A;  3JTX A;  5EFS A;  4IYO A;  3HL2 A;  4CXR A;  1G7X A;  3RQ1 A;  1O62 A;  3QBO A;  4XK1 A;  5FT5 A;  1MAQ A;  1MGV A;  4A0H A;  1YNU A;  1X2A A;  2BIA A;  2VMQ A;  1MDX A;  1V2F A;  5M46 A;  1ASB A;  1D7V A;  3E2Y A;  4M2J A;  4WXG A;  1IX6 A;  1WYT B;  1AHF A;  1GC3 A;  3FVU A;  4JE5 A;  2W7J A;  2Z20 A;  4AO4 A;  3E77 A;  5F8V A;  3TFU A;  5E5I A;  1EJI A;  3EUC A;  3VK3 A;  1M32 A;  3MC6 C;  1YOO A;  2W7E A;  4N0B A;  1G4V A;  4LNL A;  3WGC A;  1IBJ A;  1D7S A;  3DYD A;  1AKB A;  2HP1 A;  2VLH A;  1G7W A;  1QJ5 A;  1AJS A;  3GSB A;  3OKS A;  3ASB A;  1AMQ A;  3FFH A;  1AKC A;  1WYV B;  3DXW A;  1FC4 A;  3E9K A;  3FD0 A;  4MQR A;  2AEU A;  1O69 A;  4FL0 A;  1AHG A;  4Q75 A;  5HHY A;  5D5S A;  3G0T A;  3ACZ A;  4CVQ A;  1M0O A;  3NYS A;  4WP0 A;  5EIG A;  1BJ4 A;  1DKA A;  1EG5 A;  4TN4 A;  1BQA A;  1N31 A;  3WKS A;  2BYJ A;  2O0R A;  3A2B A;  2YHK A;  4H51 A;  5DB5 A;  4ZAS A;  4WBT A;  1C7N A;  1AY4 A;  2CTZ A;  2CY8 A;  1AAM A;  3ELE A;  4UHO A;  1H0C A;  1H1C A;  4K05 A;  1W3U A;  3P1T A;  1ASC A;  1D7R A;  1LS3 A;  2HUF A;  4UHM A;  4K2I A;  1AKA A;  4B98 A;  1X29 A;  1C4K A;  2QB3 A;  3BWO A;  3GR9 A;  1GD9 A;  4Y0D A;  1OXO A;  4W1W A;  2GMU A;  1ASF A;  4K2M A;  3EI7 A;  4A0R A;  1JS6 A;  3AEJ C;  2FKI A;  2W8J A;  3RCH B;  2WB6 A;  1QJ3 A;  4PFF A;  4Q31 A;  3MAU A;  3W1I A;  2HZP A;  4KYO A;  3RBL A;  1M6S A;  1BJO B;  4RLG A;  3TAT A;  1P3W A;  2EZ2 A;  2R2N A;  5DJ1 A;  2D65 A;  2ZJG A;  3WKR A;  1JF9 A;  2QLR A;  2W8V A;  2QMA A;  5G09 A;  3N75 A;  2VGT A;  2DGK A;  1LKC A;  3WCN A;  4ZWV A;  5FT4 A;  3I4J A;  3CQ4 A;  3GBX A;  2W7M A;  4A72 A;  5M49 A;  2D61 A;  2HUU A;  2VMN A;  4LC3 A;  1UU0 A;  2ORD A;  1WYT A;  4W5K A;  2VI9 A;  1CZC A;  2D64 A;  2JGT A;  1CZE A;  2EO5 A;  4ZM3 A;  1DTY A;  1TOI A;  3EIB A;  2X5D A;  1PFF A;  2YOB A;  1LC5 A;  2Z1Y A;  1ZOB A;  4PVF A;  1AIC A;  1CQ8 A;  3B46 A;  3PD6 B;  4GRX A;  2Z67 A;  2W7I A;  4LNJ A;  2G7J A;  1KMK A;  4AZK A;  1WYV A;  3E2Z B;  4L0O A;  5BJ3 A;  4ZSY A;  4GDY A;  5IWQ A;  1RV4 A;  1YJZ A;  4LNM A;  1ECX A;  1MDZ A;  2D66 A;  2AAT A;  2G6W A;  2HOX A;  3IHJ A;  3NYT A;  1QZ9 A;  2QBT A;  4OBV A;  1ELU A;  3LVJ A;  2D7Z A;  2YKV A;  2ZSL A;  3JWA A;  5AX8 A;  1DJU A;  4W1X A;  2DOU A;  2ZYJ A;  4ZSW A;  2QA3 A;  4WD2 A;  1ASL A;  3DU4 A;  1S09 A;  2BWN A;  4O6Z A;  4UQV A;  2VMW A;  5TF5 A;  2CST A;  3N0L A;  3FZ6 A;  1VJO A;  2CIN A;  2HOZ A;  2OKJ A;  2ZUK A;  3EI9 A;  5DX5 A;  3AEN B;  1AIB A;  5F9S A;  1OHV A;  4B9B A;  1XEY A;  4TV7 A;  1WKH A;  3I5T A;  3RBF A;  3RCH A;  3TFT A;  4OTL A;  3BV0 A;  4P7Y A;  2A1V A;  1GBN A;  3II0 A;  3HMU A;  4OC9 A;  4RJ0 A;  3R4T A;  4ZWM A;  2PB0 A;  1GDE A;  2BHX A;  1TPL A;  3JZL A;  1WYU B;  1AHX A;  1VEF A;  3UE8 A;  1X0M A;  5EUE A;  1ELQ A;  4RM1 A;  4ADE A;  3DOD A;  4GEB A;  1I29 A;  1AJR A;  2JIS A;  3FQA A;  2KFP A;  2AY5 A;  4MKJ A;  4MSO A;  1QIS A;  1V2D A;  2VMO A;  4DBC A;  3LV2 A;  4XJM A;  4KXK A;  3QGU A;  5G4J A;  3P6K A;  3HVY A;  1AIA A;  3A8U X;  7AAT A;  4N0W A;  4CBS A;  2VGV A;  1ASE A;  1V2E A;  3I16 A;  1M0Q A;  2V0Y A;  4WXB A;  3FQ7 A;  4GE7 A;  1J32 A;  1B4X A;  3Q8N A;  3PD6 A;  5BJ4 A;  3MAF A;  1SPA A;  2RFV A;  3FZ8 A;  4W1V A;  1ARG A;  3NU7 A;  3LVK A;  3AEM A;  1GC0 A;  1KMJ A;  3E2Z A;  3HDO A;  2Z9W A;  3FDB A;  4Q76 A;  2JJG A;  1C0N A;  1B8G A;  2BI3 A;  1WKG A;  1B5O A;  2AY1 A;  2Z61 A;  2AY2 A;  1S08 A;  5EAV A;  3LG0 A;  3VAX A;  3BWN A;  3NU8 A;  4F5K A;  2YCP A;  4ZAH A;  1MAP A;  3FSL A;  4IXO A;  1E5E A;  2C81 A;  3F9T A;  4ADB A;  1RV3 A;  4WXF A;  5I92 A;  1CL1 A;  1X28 A;  1GEY A;  1ART A;  2X8U A;  1JS3 A;  3CAI A;  3ELP A;  3CBF A;  1IX8 A;  3B1C A;  4NOG A;  1IAY A;  2XBN A;  2VMR A;  2VGW A;  3AEN A;  4WB0 A;  1PG8 A;  4WLH A;  4CXQ A;  4ZM4 A;  3ZZJ A;  5HXX A;  1J04 A;  2R5C B;  2FQ6 A;  2DKJ A;  4JE5 D;  3FVS A;  4MGR A;  4UHN A;  5E3K A;  3DRD A;  3AEP A;  3B1E A;  1FG3 A;  1AHY A;  1DGD A;  4JEX A;  1SF2 A;  2VMX A;  4K2B A;  4R2N A;  1GEW A;  2HP2 A;  3PIU A;  3GZD C;  5EQC A;  1AX4 A;  1MDO A;  1N8P A;  3K40 A;  4IX8 A;  4WYF A;  4F5M A;  1GC4 A;  4Y0H A;  2VIA A;  1VP4 A;  2W7D A;  3GZC A;  4TMR A;  1TOK A;  3FZ7 A;  1S07 A;  2ZC0 A;  3H7F A;  1O4S A;  2X3L A;  1GCK A;  1GEX A;  1TAS A;  2JJH A;  4RJY A;  2ZY4 A;  2VLF A;  1BKG A;  3H14 A;  2ZP7 A;  1OHW A;  2YCT A;  4ATQ A;  3FRK A;  3AOW A;  3EZS A;  4F5J A;  3RI6 A;  2E54 A;  2O1B A;  1M0N A;  2VGZ A;  4QGR A;  1YJS A;  1S06 A;  4BMK A;  3PGY A;  3E2F A;  2GB3 A;  2OGE A;  4RKC A;  4RIZ A;  2JJE A;  4ADD A;  2VMT A;  1M0P A;  2FYF A;  1ZOD A;  3T32 A;  3RUY A;  3PA9 A;  1QIT A;  1S0A A;  1C7O A;  2TPL A;  1LW5 A;  3N4S A;  4OCA A;  3AEO A;  2CJH A;  2OQX A;  3TCM A;  2PO3 A;  3EZ1 A;  4OMA A;  2OAT A;  1DJ9 A;  2C0R A;  3A9X A;  3N4R A;  3W1J A;  2W7L A;  2BI2 A;  1DFO A;  2DR1 A;  3ISL A;  4ZDL A;  4W8I A;  1BT4 A;  3KKI A;  4LW2 A;  4XJL A;  2WK9 A;  1DJE A;  1AMS A;  3R9A A;  3MKJ A;  3MAD A;  1I41 A;  1OAT A;  1UU1 A;  2OGA A;  2YKU A;  3M5U A;  1ASD A;  2VIB A;  4ISY A;  4A6U A;  4F5F A;  4XQ2 A;  2QSR A;  5KTB A;  2E7I A;  1C7G A;  3LWS A;  2NMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...