1ELUA

Complex between the cystine c-s lyase c-des and its reaction product cysteine persulfide.
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
381
structure length
381
Chain Sequence
QFPGLANKTYFNFGGQGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIAIVQAIAARFGITYRFFPVAATLNQGDAAAVLANHLGPKTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGNYPVRVLVDGAQSAGSLPLDFSRLEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGEINPTYVGWRSITYGAKGEPTGWAEGGKRFEVATSAYPQYAGLLAALQLHQRQGTAEERYQAICQRSEFLWRGLNQLPHVHCLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDCIRACCHYITDEEEINHLLARLADFGP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cystine C-S lyase from Synechocystis: stabilization of cysteine persulfide for FeS cluster biosynthesis.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Lyase
molecule keywords L-CYSTEINE/L-CYSTINE C-S LYASE
total genus 133
structure length 381
sequence length 381
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1eluA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1eluA01
1E5EA 2VGZA 3GETA 4TN4A 5FT4A 3PJ0A 4CBSA 1OHVA 1ZODA 3JWAA 2VMTA 4KAMA 2BIAA 5EIGB 3DR4A 4W91A 1SPAA 4J8LA 3ECDA 3BC8A 3B1DA 4JEYA 2CINA 3W1IA 3FKDA 3RCHA 3W1HA 3B1CA 3ACZA 2EZ2A 4Y0IA 3WLXA 1OATA 7AATA 1BQDA 2CTZA 4RJ0A 2HP1A 2VGSA 1AY4A 5FT5A 5HXXA 1B9IA 2Z1YA 2VIBA 3G0TA 2HOXA 3COGA 3I16A 2F8JA 2W7KA 4WBTA 1RV3A 2CSTA 8AATA 1IX8A 4ADEA 2BHXA 1AHYA 1BJOA 3LVKA 3LVJA 2Z9UA 2VYCA 4GE4A 2CY8A 3EI6A 4PFFA 5G2PA 3GBXA 3KKIA 4RIZA 1BQAA 4UOYA 3UE8A 5M49A 1MAPA 2VLHA 1JS3A 1AIAA 3EIBA 5J8QA 3DODA 4ZM3A 3FCRA 1AY8A 2BWNA 4JF0A 3NX3A 2W7HA 3QM2A 1E5FA 3LV2A 3QGUA 4P7YA 3K28A 3HT4A 3CQ4A 4RLGA 3B1EA 3DZZA 2YOBA 4JEZA 4LW4A 3DRDA 3TFUA 1LW4A 3LWSA 3GZCA 2EH6A 3FQ8A 4MQRA 2W7MA 1D2FA 3F6TA 3AATA 1QISA 5EAAA 4Y0HA 4WLHA 1LS3A 1JS6A 1B5PA 3VK3A 3ZRRA 3FZ7A 4DGTA 4OTLA 4JF1A 2O1BA 3WZFA 4A0FA 3ISLA 4JEWA 2YRIA 1G7WA 3BWOA 1MGVA 1G4XA 2EO5A 2VGTA 3EZSA 2AY9A 5M46A 1EG5A 4ZWVA 4MSOA 1P3WA 3BN1A 1ASBA 1GC4A 2VGVA 3BB8A 3GJUA 2HZPA 2D7YA 3PGYA 1ASGA 1Z7DA 3W1JA 4WB0B 3ELPA 4EFFA 1AHFA 2YKXA 2RFVA 2AY1A 1WKGA 2V0YA 1EQBA 1VJOA 2D7ZA 3ASAA 3BCXA 5EUDA 1N2TA 2GMSA 1IUGA 2EZ1A 5BJ3A 3R4TA 1CQ6A 3HBXA 4IYOB 2YCNA 2XH1A 4OT8A 3VK4A 1M6SA 2Z61A 3TQXA 3QHXA 4B98A 3MADA 2JJHA 3MKJA 1ZC9A 1PMMA 2BI3A 3JTXA 3L8AA 5D95A 1BJ4A 3FRKA 3EI8A 4ITGA 4ATQA 1C4KA 1UU2A 5EQCA 4ITXA 1O4SA 3VP6A 3NUBA 1AKAA 4KYOA 1SZUA 5IWQA 4XJLA 5HDMA 5C6UA 4R5FA 1O69A 5LH9A 3LVMA 2BI5A 3QBOA 1CZCA 3FFRA 2Z20A 3HLMA 4J5UA 3PD6B 2FNIA 3ZRQA 4DBCA 1MAQA 2HP2A 4ZDLA 2D61A 2D64A 2HUFA 3FZ8A 2VMUA 2GSAA 1VP4A 4AZJA 3MBBA 1TOKA 5G0AA 3WY7A 1AAWA 1W23A 1KMJA 2BKWA 3JWBA 3MAFB 3QI6A 1ARGA 4GDYA 4ATPA 4F5FA 5I92A 1DKAA 3HL2A 2ZJGA 3DXWA 1TARA 1M32A 2W7FA 4LNJA 4R8DA 5E3KA 1G7XA 1ARIA 2OGEA 2VMYA 1ASMA 4ZLVA 1DTYA 2DKJA 3FFHA 1AICA 1EJIA 2JJEA 2V1PA 4GRXA 2GB3A 3AEJA 4DQ6A 3FQ7A 1KL2A 4K2MA 4W1VA 2R0TA 1WYUA 3GR9A 4Q76A 4Q6RA 1ASAA 1AJRA 1D7RA 1M4NA 2ORDA 4ZDPA 4A00A 3AEMA 3QPGA 1WYTB 1BW0A 2AATA 1ELUA 4XJMA 3WCNA 3CBFA 1I41A 2CJHA 3B46A 4RITA 1J04A 4K2IA 4F5IA 2BWOA 1SFFA 2DGKA 3FVSA 3ZRPA 2AY4A 2AY8A 4N0WA 3E2YA 3PIUA 2VMRA 2VIAA 1W3UA 1GDEA 2ZC0A 3KGXA 3RUYA 3VAXA 3WX9A 3NU7A 1CS1A 2ZUKA 1AMQA 2VLFA 3N5MA 1AJSB 2HOYA 2HUIA 3OP7A 3PDBB 4BA4A 1I48A 5AX8A 3JU7A 3EI9A 3K40A 2R5CA 4HVKA 5G4JA 2OQXA 4WYGA 3RQ1A 3FD0A 1IX7A 1YJYA 3B8XA 2WK9A 4H51A 3ZZJA 4HF8A 4WYCA 1YAAA 4MQPA 4WXFA 5E5IA 4ZWMA 2VMVA 3MAFA 3FVXA 4JEXA 1S07A 3UAKA 4RAEA 2W8VA 1T3IA 2PB2A 4JE5D 4PIWA 3CQ6A 5FT8A 1DJ9A 3LG0A 1AKCA 4FL0A 1IBJA 3NUIA 1H0CA 2AEVA 2TPLA 3NNKA 1B9HA 5DJ1A 3NYTA 1TPLA 3AENA 2BI2A 3KE3A 3A9ZA 1MDZA 3FSLA 3AOVA 1BS0A 2ZY3A 2YCPA 4N0BA 2VMOA 3ZZKA 1ELQA 3RBFA 1BJNA 1DGDA 2X3LA 3G7QA 3E2ZA 3EIAA 3P6KA 1IVRA 3FQAA 3F9TA 4UHOA 2AY2A 3R9AA 1MLZA 4MY5A 1M0QA 3GZDA 4LNMA 3PPLA 1UKJA 3WGBA 5M4DA 3AV7A 1BT4A 2BYLA 4XEWA 1VEFA 1UU1A 4OCAA 4IXOA 2EPJA 2AY6A 1ZOBA 1GD9A 1ASDA 2DR1A 4Q31A 4F5HA 2ZY4A 4EB7A 2C0RA 1M7YA 3AENB 2W7LA 3DU4A 3HDOA 3QN6A 1M0OA 1WSTA 4GEBA 4RKDA 2EGYA 1X2AA 1FG3A 4RKCA 4IX8A 1Z3ZA 4E77A 1M0NA 4AOAA 2QLRA 2W8JA 5JAYA 3NRAA 2FN6A 4A72A 4AO4A 2R2NA 4U1TA 4A0RA 3A2BA 1SVVA 2YRRA 1ASEA 1BKGA 2O0RA 4XAUA 1PMOA 1W7MA 3ASBA 1V2DA 4ZSWA 1CQ7A 1IAYA 5DJ9A 2DGLA 3NTJA 5K8BA 3E9KA 4WYAA 1ARSA 1C7GA 2JISA 4EU1A 4M2KA 4WXGA 3L44A 3PDBA 3Q8NA 3DYDA 4E1OA 1AJSA 4F5JA 1G4VA 1LK9A 1QZ9A 2AY3A 1FC4A 3BV0A 1CQ8A 3E6GA 2VI8A 3I4JA 4UQVA 4ADDA 4BMKA 4M2MA 1IX6A 2C81A 2ZY2A 2GMUA 4WLJA 2W7DA 3KGWA 1S09A 1V72A 1WYVB 4FFCA 4BQ0A 1M0PA 2D65A 3BWNA 1OXPA 4F5LA 1TATA 4XK1A 3E77A 5EIGA 4AH3A 3CAIA 1XEYA 1OHWA 4W8IA 3USFA 2QBTA 2XBNA 4IXSA 2CJGA 3NU8A 2X8UA 4GE9A 1X28A 2JG2A 2QMAA 1OXOA 3PAAA 4NOGA 2G6WA 1DJUA 2X5DA 1MDXA 1W7LA 2YHKA 3JW9A 2WK7A 4OBVA 1N8PA 1D7UA 1AAMA 1RV4A 1TOEA 1QJ3A 4LW2A 1DGEA 2DOUA 1CJ0A 4ADBA 5M4BA 3EI7A 3K7YA 2HORA 3OKSA 1YIYA 1GC0A 1YIZA 2JGTA 4CVQA 3WKSA 3MAUA 5EUEA 3II0A 1AIBA 2Z1ZA 4MKJA 4OBUA 1AHGA 1MLYA 3DR7A 4MQQA 4O6ZA 5D5SA 1GEXA 1KKPA 1X0MA 4R2NA 4CXQA 4F4EA 4A6RA 5G2QA 3DXVA 4EMYA 3H14A 3RCHB 1D7VA 1DJEA 1PFFA 2E7IA 3D6KA 3HVYA 4LNLA 2NMPA 3PA9A 5EFSA 2VGWA 2W8WA 2D63A 4P3MA 1N31A 3HQTA 1QITA 1C0NA 1ARTA 1RVUA 3FZ6A 2OGAA 5F8VA 1B8GA 1BJWA 5E4ZA 2CB1A 2Z9VA 1C7NA 4XQ2A 4ZSYA 3ELEA 3AEJC 3IF2A 2AY7A 4IYOA 1YJSA 5F9SA 2ZP7A 2BWPA 4WYDA 3EI5A 1BJOB 1I43A 1ASLA 1MDOA 4PFNA 2PO3A 4TV7A 2Z67A 1WYVA 2E7JA 2FYFA 3VK2A 3WKRA 1Y4IA 9AATA 1FG7A 1WYTA 4WYFA 2PB0A 4ADCA 2ZSLA 1C9CA 1V2EA 2DGMA 3AELA 4A0HA 1GEYA 2D66A 3G8MA 4K2BA 2VMQA 3A9XA 4WYEA 3AEPA 4L0OA 2W7IA 3WCOA 4GE7A 5G09A 2X5FA 1ARHA 1XI9A 3BS8A 1AKBA 1LC8A 4OC9A 4ZDOA 1QIRA 2WK8A 4IW7A 1LKCA 1PG8A 4MKKA 4OYTA 1KL1A 3PDXA 1LW5A 1S0AA 1AMSA 1C7OA 1GC2A 1SZKA 4BA5A 2AEUA 2ZSMA 3TFTA 4IY7A 1AMAA 4U2HA 1S06A 2YCTA 3LY1A 1ORDA 1UU0A 1AMRA 3DC1A 4W5KA 4ZASA 1I29A 4B9BA 4ZM4A 2VMXA 1IJIA 2BYJA 1V2FA 2FM1A 1H1CA 3E2ZB 3EZ1A 2GQNA 4AZKA 3AEOA 3UWCA 1RVYA 2FQ6A 1WKHA 4RM1A 4LC3A 1SF2A 2CH2A 3AOWA 3E2FA 2OKJA 2YKYA 3FVUA 4M2JA 1AX4A 1IAXA 4KXKA 4A0GA 3NYSA 1B4XA 1OHYA 2O7CA 2CH1A 2Z9WA 4WB0A 4A6TA 2W7EA 2Z9XA 4Y0DA 4JEVA 3I5TA 3P1TA 4CBRA 1AY5A 3MC6C 1YJZA 5FT6A 4XJPA 3VOMA 4GSAA 1JF9A 3LVLB 3F0HA 1DFOA 1CL1A 1J32A 3CQ5A 4ISYA 3RBLA 1TASA 3NYUA 3M5UA 4CXRA 3GZDC 2BI9A 1QJ5A 3N75A 5BJ4A 2ZY5A 1LC5A 5TF5A 1B5OA 2VMPA 3BWNC 5EAVA 3BCAA 4A6UA 1ASFA 4E3QA 4W1XA 5HHYA 5DX5A 1GBNA 4W1WA 3HMUA 2YKVA 5G4IA 3T32A 2Q7WA 2VI9A 1GCKA 2FNUA 4F5MA 3FTBA 4F5GA 3PD6A 2D5YA 1KMKA 1WYUB 4RJYA 2QB2A 1TOGA 2YKUA 2W7GA 1O62A 2HOZA 2OKKA 4XJOA 1JG8A 4F5KA 4WD2A 3ATHA 3WGCA 3N0LA 1X29A 3FDBA 1AHXA 4BHDA 1LC7A 3BCBA 2JJFA 3JZLA 1AHEA 2CANA 3FDDA 1CZEA 1W7NA 2BIGA 3RI6A 2E7UA 4EB5A 4I8AA 4IXZA 2R5EA 1O61A 4E3RA 1SZSA 4R5ZA 2WKAA 3GWPA 2VMZA 3A8UX 2VGUA 1S08A 4PVFA 2CFBA 2W8UA 2ZYJA 4JE5A 3H7FA 4UHMA 3AEMC 1YNUA 3NDNA 3IHJA 3TATA 1ECXA 2E54A 4AO9A 1TOIA 2VMSA 3A9YA 3EUCA 4QGRA 4TMRA 1YOOA 2C44A 2AY5A 4OMAA 2BIEA 2C7TA 2HUUA 3GSBA 1ASCA 5DB5A 4UHNA 1QGNA 2W8TA 4WXBA 1CL2A 1TOJA 3TCMA 2DKBA 1GEWA 1KKJA 1D7SA 1GC3A 2QB3A 4ZAHA 2VMNA 2BI1A 2JJGA 4MGRA 4Q75A 5EUNA 2QA3A 2CJDA 4WP0A 2R5CB 2W7JA 3MEBA 1ASNA 5LHAA 2VMWA 3MC6A 1U08A 2OATA
chains in the Genus database with same CATH superfamily
1E5EA 2VGZA 3GETA 4TN4A 5FT4A 3PJ0A 4CBSA 1OHVA 1ZODA 3JWAA 2VMTA 4KAMA 2BIAA 5EIGB 3DR4A 4W91A 1SPAA 4J8LA 3ECDA 3BC8A 3B1DA 3N4XA 4JEYA 2CINA 3W1IA 3FKDA 3RCHA 3W1HA 3B1CA 3ACZA 2EZ2A 4Y0IA 3WLXA 1OATA 7AATA 4H63Q 1BQDA 2CTZA 4RJ0A 2HP1A 2VGSA 1AY4A 5FT5A 5HXXA 1B9IA 2Z1YA 2VIBA 3G0TA 2HOXA 3COGA 3I16A 2F8JA 2W7KA 4WBTA 1RV3A 2CSTA 8AATA 4K05A 1IX8A 4ADEA 2BHXA 1AHYA 1BJOA 3LVKA 3LVJA 2Z9UA 2VYCA 4GE4A 2CY8A 3EI6A 4PFFA 5G2PA 3GBXA 3KKIA 4RIZA 1BQAA 4UOYA 3UE8A 5KTBA 5M49A 1MAPA 2VLHA 1JS3A 1AIAA 3EIBA 5J8QA 3DODA 4ZM3A 3FCRA 1AY8A 2BWNA 4JF0A 3NX3A 2W7HA 3QM2A 1E5FA 3LV2A 3QGUA 4P7YA 3K28A 3HT4A 3CQ4A 4RLGA 3B1EA 3DZZA 2YOBA 4JEZA 4LW4A 3DRDA 3TFUA 1LW4A 3LWSA 3GZCA 2EH6A 3FQ8A 4MQRA 2W7MA 1D2FA 3F6TA 3AATA 1QISA 5EAAA 4Y0HA 4WLHA 1LS3A 1JS6A 1B5PA 3VK3A 3ZRRA 3FZ7A 4DGTA 4OTLA 4JF1A 2O1BA 3WZFA 4A0FA 3ISLA 4JEWA 2YRIA 3N4SA 1G7WA 3BWOA 1MGVA 1G4XA 2EO5A 2VGTA 3EZSA 2AY9A 5M46A 1EG5A 4ZWVA 4MSOA 1P3WA 3BN1A 1ASBA 1GC4A 2VGVA 3BB8A 3GJUA 2HZPA 2D7YA 3PGYA 1ASGA 1Z7DA 3W1JA 4WB0B 3ELPA 4EFFA 1AHFA 2YKXA 2RFVA 2AY1A 1WKGA 2V0YA 1EQBA 1VJOA 2D7ZA 3ASAA 3BCXA 5EUDA 1N2TA 2A1VA 2GMSA 1IUGA 2EZ1A 5BJ3A 3R4TA 1CQ6A 3HBXA 4IYOB 2YCNA 2XH1A 4OT8A 3VK4A 1M6SA 2Z61A 3TQXA 3QHXA 4B98A 3MADA 2JJHA 3MKJA 1ZC9A 1PMMA 2BI3A 3JTXA 3L8AA 5D95A 1BJ4A 3FRKA 3EI8A 4ITGA 4ATQA 1C4KA 1UU2A 5EQCA 4ITXA 1O4SA 2WB6A 3VP6A 3NUBA 1AKAA 4KYOA 1SZUA 5IWQA 4XJLA 5HDMA 5C6UA 4R5FA 1O69A 5LH9A 3LVMA 2BI5A 3QBOA 1CZCA 3FFRA 2Z20A 3HLMA 4J5UA 3PD6B 2FNIA 3ZRQA 4DBCA 1MAQA 2HP2A 4ZDLA 2D61A 2D64A 2HUFA 3FZ8A 2VMUA 2GSAA 1VP4A 4AZJA 3MBBA 1TOKA 5G0AA 3WY7A 1AAWA 1W23A 1KMJA 2BKWA 3JWBA 3MAFB 3QI6A 1ARGA 4GDYA 4ATPA 2QSRA 4F5FA 5I92A 1DKAA 3HL2A 2ZJGA 3DXWA 1TARA 1M32A 2W7FA 4LNJA 2EYQA 4R8DA 5E3KA 1G7XA 1ARIA 2OGEA 2VMYA 1ASMA 4ZLVA 1DTYA 2DKJA 3FFHA 1AICA 1EJIA 2JJEA 2V1PA 4GRXA 2GB3A 3AEJA 4DQ6A 3FQ7A 1KL2A 4K2MA 4W1VA 2R0TA 1WYUA 3GR9A 4Q76A 4Q6RA 1ASAA 1AJRA 1D7RA 1M4NA 2ORDA 4ZDPA 4A00A 3AEMA 3QPGA 1WYTB 1BW0A 2AATA 1ELUA 4XJMA 3WCNA 3CBFA 1I41A 2CJHA 3B46A 4RITA 1J04A 4K2IA 4F5IA 2BWOA 1SFFA 2DGKA 3FVSA 3ZRPA 2AY4A 2AY8A 4N0WA 3E2YA 3PIUA 2VMRA 2VIAA 1W3UA 1GDEA 2ZC0A 3KGXA 3RUYA 3VAXA 3WX9A 3NU7A 1CS1A 2ZUKA 1AMQA 2VLFA 3N5MA 1AJSB 2HOYA 2HUIA 3OP7A 3PDBB 4BA4A 1I48A 5AX8A 3JU7A 3EI9A 3K40A 2R5CA 4HVKA 5G4JA 2OQXA 4WYGA 3RQ1A 3FD0A 1IX7A 1YJYA 3B8XA 2WK9A 4H51A 3ZZJA 4HF8A 4WYCA 1YAAA 4MQPA 4WXFA 5E5IA 4ZWMA 2VMVA 3MAFA 3FVXA 4JEXA 1S07A 3UAKA 4RAEA 2W8VA 1T3IA 2PB2A 4JE5D 4PIWA 3CQ6A 5FT8A 1DJ9A 3LG0A 1AKCA 4FL0A 1IBJA 3NUIA 1H0CA 2AEVA 2TPLA 3NNKA 1B9HA 5DJ1A 3NYTA 1TPLA 3AENA 2BI2A 3KE3A 3A9ZA 1MDZA 3FSLA 3AOVA 1BS0A 2ZY3A 2YCPA 4N0BA 2VMOA 3H9XA 3ZZKA 1ELQA 3RBFA 1BJNA 1DGDA 2X3LA 3G7QA 3E2ZA 3EIAA 3P6KA 1IVRA 3FQAA 3F9TA 4UHOA 2AY2A 3R9AA 1MLZA 4MY5A 1M0QA 3GZDA 4LNMA 2KFPA 3PPLA 1UKJA 3WGBA 5M4DA 3AV7A 1BT4A 2BYLA 4XEWA 1VEFA 1UU1A 4OCAA 4IXOA 2EPJA 2AY6A 1ZOBA 1GD9A 1ASDA 2DR1A 4Q31A 4F5HA 2ZY4A 4EB7A 2C0RA 1M7YA 3AENB 2W7LA 3DU4A 3HDOA 3QN6A 1M0OA 1WSTA 4GEBA 4RKDA 2EGYA 1X2AA 1FG3A 4RKCA 4IX8A 1Z3ZA 4E77A 1M0NA 4AOAA 2QLRA 2W8JA 5JAYA 3NRAA 2FN6A 4A72A 4AO4A 2R2NA 4U1TA 4A0RA 3A2BA 1SVVA 2YRRA 1ASEA 1BKGA 2O0RA 4XAUA 1PMOA 1W7MA 3ASBA 1V2DA 4ZSWA 1CQ7A 1IAYA 5DJ9A 2DGLA 3NTJA 5K8BA 3E9KA 4WYAA 1ARSA 1C7GA 2JISA 4EU1A 4M2KA 4WXGA 3L44A 3PDBA 3Q8NA 3DYDA 4E1OA 1AJSA 4F5JA 1G4VA 1LK9A 1QZ9A 2AY3A 1FC4A 3BV0A 1CQ8A 3E6GA 2VI8A 3I4JA 4UQVA 4ADDA 4BMKA 4M2MA 1IX6A 2C81A 2ZY2A 2GMUA 4WLJA 2W7DA 3KGWA 1S09A 1V72A 1WYVB 4FFCA 4BQ0A 1M0PA 2D65A 3BWNA 1OXPA 4F5LA 1TATA 4XK1A 3E77A 5EIGA 4AH3A 3CAIA 1XEYA 1OHWA 4W8IA 3USFA 2QBTA 2XBNA 4IXSA 2CJGA 3NU8A 2X8UA 4GE9A 1X28A 2JG2A 2QMAA 1OXOA 3PAAA 4NOGA 2G6WA 1DJUA 2X5DA 1MDXA 1W7LA 2YHKA 3JW9A 2WK7A 4OBVA 1N8PA 1D7UA 1AAMA 1RV4A 1TOEA 1QJ3A 4LW2A 1DGEA 2DOUA 1CJ0A 4ADBA 5M4BA 3EI7A 3K7YA 2HORA 3OKSA 1YIYA 1GC0A 1YIZA 2JGTA 4CVQA 3WKSA 3MAUA 5EUEA 3II0A 1AIBA 2Z1ZA 4MKJA 4OBUA 1AHGA 3N7NA 1MLYA 3DR7A 4MQQA 4O6ZA 5D5SA 1GEXA 1KKPA 1X0MA 4R2NA 4CXQA 4F4EA 4A6RA 5G2QA 3DXVA 4EMYA 3H14A 3RCHB 1D7VA 1DJEA 1PFFA 2E7IA 3D6KA 3HVYA 4LNLA 2NMPA 3PA9A 5EFSA 2VGWA 2W8WA 2D63A 4P3MA 1N31A 3HQTA 1QITA 1C0NA 1ARTA 1RVUA 3FZ6A 2OGAA 5F8VA 1B8GA 1BJWA 5E4ZA 2CB1A 2Z9VA 1C7NA 4XQ2A 4ZSYA 3ELEA 3AEJC 3IF2A 2AY7A 4IYOA 1YJSA 5F9SA 2ZP7A 2BWPA 4WYDA 3EI5A 1BJOB 1I43A 2G7JA 1ASLA 1MDOA 4PFNA 2PO3A 4TV7A 2Z67A 1WYVA 2E7JA 2FYFA 3VK2A 3WKRA 1Y4IA 9AATA 1FG7A 1WYTA 1KAFA 4WYFA 2PB0A 4ADCA 2ZSLA 1C9CA 1V2EA 2DGMA 3AELA 4A0HA 1GEYA 2D66A 3G8MA 4K2BA 2VMQA 3A9XA 4WYEA 3AEPA 4L0OA 2W7IA 3WCOA 4GE7A 5G09A 2X5FA 1ARHA 1XI9A 3BS8A 1AKBA 1LC8A 4OC9A 4ZDOA 1QIRA 2WK8A 4IW7A 1LKCA 1PG8A 4MKKA 4OYTA 1KL1A 3PDXA 1LW5A 1S0AA 1AMSA 1C7OA 1GC2A 1SZKA 4BA5A 2AEUA 2ZSMA 3TFTA 4IY7A 1AMAA 4U2HA 1S06A 2YCTA 3LY1A 1ORDA 1UU0A 1AMRA 3DC1A 4W5KA 4ZASA 1I29A 4B9BA 4ZM4A 2VMXA 1IJIA 2BYJA 1V2FA 2FM1A 1H1CA 3E2ZB 3EZ1A 2GQNA 4AZKA 3AEOA 3UWCA 1RVYA 2FQ6A 2FKIA 1WKHA 4RM1A 4LC3A 1SF2A 2CH2A 3AOWA 3E2FA 2OKJA 2YKYA 3FVUA 4M2JA 1AX4A 1IAXA 4KXKA 4A0GA 3NYSA 1B4XA 1OHYA 2O7CA 2CH1A 2Z9WA 4WB0A 4A6TA 2W7EA 2Z9XA 4Y0DA 4JEVA 3I5TA 3P1TA 4CBRA 1AY5A 3MC6C 1YJZA 5FT6A 4XJPA 3VOMA 4GSAA 1JF9A 3LVLB 3F0HA 1DFOA 1CL1A 1J32A 3CQ5A 4ISYA 3RBLA 1TASA 3NYUA 3M5UA 4CXRA 3GZDC 2BI9A 1QJ5A 3N75A 5BJ4A 2ZY5A 1LC5A 5TF5A 1B5OA 2VMPA 3BWNC 5EAVA 3BCAA 4A6UA 1ASFA 4E3QA 4W1XA 5HHYA 5DX5A 1GBNA 4W1WA 3HMUA 2YKVA 5G4IA 3T32A 2Q7WA 2VI9A 1GCKA 2FNUA 4F5MA 3FTBA 4F5GA 3PD6A 2D5YA 1KMKA 1WYUB 4RJYA 2QB2A 1TOGA 2YKUA 2W7GA 1O62A 2HOZA 2OKKA 4XJOA 1JG8A 4F5KA 4WD2A 3ATHA 3WGCA 3N0LA 1X29A 3FDBA 1AHXA 4BHDA 1LC7A 3BCBA 2JJFA 3JZLA 1AHEA 2CANA 3FDDA 1CZEA 1W7NA 2BIGA 3RI6A 2E7UA 4EB5A 4I8AA 4IXZA 2R5EA 1O61A 4E3RA 1SZSA 4R5ZA 2WKAA 3GWPA 2VMZA 3A8UX 2VGUA 1S08A 4PVFA 2CFBA 2W8UA 2ZYJA 4JE5A 3H7FA 4UHMA 3N4RA 3AEMC 1YNUA 3NDNA 3IHJA 3TATA 1ECXA 2E54A 4AO9A 1TOIA 2VMSA 3A9YA 3EUCA 4QGRA 4TMRA 1YOOA 2C44A 2AY5A 4OMAA 2BIEA 2C7TA 2HUUA 3GSBA 1ASCA 5DB5A 4UHNA 1QGNA 2W8TA 4WXBA 1CL2A 1TOJA 3TCMA 2DKBA 1GEWA 1KKJA 1D7SA 1GC3A 2QB3A 4ZAHA 2VMNA 2BI1A 2JJGA 4MGRA 4Q75A 5EUNA 2QA3A 2CJDA 4WP0A 2R5CB 2W7JA 3MEBA 1ASNA 5LHAA 2VMWA 3MC6A 1U08A 2OATA
chains in the Genus database with same CATH topology
1E5EA 2VGZA 3GETA 4TN4A 5FT4A 3PJ0A 4CBSA 1OHVA 1ZODA 3JWAA 2VMTA 4KAMA 2BIAA 5EIGB 3DR4A 4W91A 1SPAA 4J8LA 3ECDA 3BC8A 3B1DA 3N4XA 4JEYA 2CINA 3W1IA 3FKDA 3RCHA 3W1HA 3B1CA 3ACZA 2EZ2A 4Y0IA 3WLXA 1OATA 7AATA 4H63Q 1BQDA 2CTZA 4RJ0A 2HP1A 2VGSA 1AY4A 5FT5A 5HXXA 1B9IA 2Z1YA 2VIBA 3G0TA 2HOXA 3COGA 3I16A 2F8JA 2W7KA 4WBTA 1RV3A 2CSTA 8AATA 4K05A 1IX8A 4ADEA 2BHXA 1AHYA 1BJOA 3LVKA 3LVJA 2Z9UA 2VYCA 4GE4A 2CY8A 3EI6A 4PFFA 5G2PA 3GBXA 3KKIA 4RIZA 1BQAA 4UOYA 3UE8A 5KTBA 5M49A 1MAPA 2VLHA 1JS3A 1AIAA 3EIBA 5J8QA 3DODA 4ZM3A 3FCRA 1AY8A 2BWNA 4JF0A 3NX3A 2W7HA 3QM2A 1E5FA 3LV2A 3QGUA 4P7YA 3K28A 3HT4A 3CQ4A 4RLGA 3B1EA 3DZZA 2YOBA 4JEZA 4LW4A 3DRDA 3TFUA 1LW4A 3LWSA 3GZCA 2EH6A 3FQ8A 4MQRA 2W7MA 1D2FA 3F6TA 3AATA 1QISA 5EAAA 4Y0HA 4WLHA 1LS3A 1JS6A 1B5PA 3VK3A 3ZRRA 3FZ7A 4DGTA 4OTLA 4JF1A 2O1BA 3WZFA 4A0FA 3ISLA 4JEWA 2YRIA 3N4SA 1G7WA 3BWOA 1MGVA 1G4XA 2EO5A 2VGTA 3EZSA 2AY9A 5M46A 1EG5A 4ZWVA 4MSOA 1P3WA 3BN1A 1ASBA 1GC4A 2VGVA 3BB8A 3GJUA 2HZPA 2D7YA 3PGYA 1ASGA 1Z7DA 3W1JA 4WB0B 3ELPA 4EFFA 1AHFA 2YKXA 2RFVA 2AY1A 1WKGA 2V0YA 1EQBA 1VJOA 2D7ZA 3ASAA 3BCXA 5EUDA 1N2TA 2A1VA 2GMSA 1IUGA 2EZ1A 5BJ3A 3R4TA 1CQ6A 3HBXA 4IYOB 2YCNA 2XH1A 4OT8A 3VK4A 1M6SA 2Z61A 3TQXA 3QHXA 4B98A 3MADA 2JJHA 3MKJA 1ZC9A 1PMMA 2BI3A 3JTXA 3L8AA 5D95A 1BJ4A 3FRKA 3EI8A 4ITGA 4ATQA 1C4KA 1UU2A 5EQCA 4ITXA 1O4SA 2WB6A 3VP6A 3NUBA 1AKAA 4KYOA 1SZUA 5IWQA 4XJLA 5HDMA 5C6UA 4R5FA 1O69A 5LH9A 3LVMA 2BI5A 3QBOA 1CZCA 3FFRA 2Z20A 3HLMA 4J5UA 3PD6B 2FNIA 3ZRQA 4DBCA 1MAQA 2HP2A 4ZDLA 2D61A 2D64A 2HUFA 3FZ8A 2VMUA 2GSAA 1VP4A 4AZJA 3MBBA 1TOKA 5G0AA 3WY7A 1AAWA 1W23A 1KMJA 2BKWA 3JWBA 3MAFB 3QI6A 1ARGA 4GDYA 4ATPA 2QSRA 4F5FA 5I92A 1DKAA 3HL2A 2ZJGA 3DXWA 1TARA 1M32A 2W7FA 4LNJA 2EYQA 4R8DA 5E3KA 1G7XA 1ARIA 2OGEA 2VMYA 1ASMA 4ZLVA 1DTYA 2DKJA 3FFHA 1AICA 1EJIA 2JJEA 2V1PA 4GRXA 2GB3A 3AEJA 4DQ6A 3FQ7A 1KL2A 4K2MA 4W1VA 2R0TA 1WYUA 3GR9A 4Q76A 4Q6RA 1ASAA 1AJRA 1D7RA 1M4NA 2ORDA 4ZDPA 4A00A 3AEMA 3QPGA 1WYTB 1BW0A 2AATA 1ELUA 4XJMA 3WCNA 3CBFA 1I41A 2CJHA 3B46A 4RITA 1J04A 4K2IA 4F5IA 2BWOA 1SFFA 2DGKA 3FVSA 3ZRPA 2AY4A 2AY8A 4N0WA 3E2YA 3PIUA 2VMRA 2VIAA 1W3UA 1GDEA 2ZC0A 3KGXA 3RUYA 3VAXA 3WX9A 3NU7A 1CS1A 2ZUKA 1AMQA 2VLFA 3N5MA 1AJSB 2HOYA 2HUIA 3OP7A 3PDBB 4BA4A 1I48A 5AX8A 3JU7A 3EI9A 3K40A 2R5CA 4HVKA 5G4JA 2OQXA 4WYGA 3RQ1A 3FD0A 1IX7A 1YJYA 3B8XA 2WK9A 4H51A 3ZZJA 4HF8A 4WYCA 1YAAA 4MQPA 4WXFA 5E5IA 4ZWMA 2VMVA 3MAFA 3FVXA 4JEXA 1S07A 3UAKA 4RAEA 2W8VA 1T3IA 2PB2A 4JE5D 4PIWA 3CQ6A 5FT8A 1DJ9A 3LG0A 1AKCA 4FL0A 1IBJA 3NUIA 1H0CA 2AEVA 2TPLA 3NNKA 1B9HA 5DJ1A 3NYTA 1TPLA 3AENA 2BI2A 3KE3A 3A9ZA 1MDZA 3FSLA 3AOVA 1BS0A 2ZY3A 2YCPA 4N0BA 2VMOA 3H9XA 3ZZKA 1ELQA 3RBFA 1BJNA 1DGDA 2X3LA 3G7QA 3E2ZA 3EIAA 3P6KA 1IVRA 3FQAA 3F9TA 4UHOA 2AY2A 3R9AA 1MLZA 4MY5A 1M0QA 3GZDA 4LNMA 2KFPA 3PPLA 1UKJA 3WGBA 5M4DA 3AV7A 1BT4A 2BYLA 4XEWA 1VEFA 1UU1A 4OCAA 4IXOA 2EPJA 2AY6A 1ZOBA 1GD9A 1ASDA 2DR1A 4Q31A 4F5HA 2ZY4A 4EB7A 2C0RA 1M7YA 3AENB 2W7LA 3DU4A 3HDOA 3QN6A 1M0OA 1WSTA 4GEBA 4RKDA 2EGYA 1X2AA 1FG3A 4RKCA 4IX8A 1Z3ZA 4E77A 1M0NA 4AOAA 2QLRA 2W8JA 5JAYA 3NRAA 2FN6A 4A72A 4AO4A 2R2NA 4U1TA 4A0RA 3A2BA 1SVVA 2YRRA 1ASEA 1BKGA 2O0RA 4XAUA 1PMOA 1W7MA 3ASBA 1V2DA 4ZSWA 1CQ7A 1IAYA 5DJ9A 2DGLA 3NTJA 5K8BA 3E9KA 4WYAA 1ARSA 1C7GA 2JISA 4EU1A 4M2KA 4WXGA 3L44A 3PDBA 3Q8NA 3DYDA 4E1OA 1AJSA 4F5JA 1G4VA 1LK9A 1QZ9A 2AY3A 1FC4A 3BV0A 1CQ8A 3E6GA 2VI8A 3I4JA 4UQVA 4ADDA 4BMKA 4M2MA 1IX6A 2C81A 2ZY2A 2GMUA 4WLJA 2W7DA 3KGWA 1S09A 1V72A 1WYVB 4FFCA 4BQ0A 1M0PA 2D65A 3BWNA 1OXPA 4F5LA 1TATA 4XK1A 3E77A 5EIGA 4AH3A 3CAIA 1XEYA 1OHWA 4W8IA 3USFA 2QBTA 2XBNA 4IXSA 2CJGA 3NU8A 2X8UA 4GE9A 1X28A 2JG2A 2QMAA 1OXOA 3PAAA 4NOGA 2G6WA 1DJUA 2X5DA 1MDXA 1W7LA 2YHKA 3JW9A 2WK7A 4OBVA 1N8PA 1D7UA 1AAMA 1RV4A 1TOEA 1QJ3A 4LW2A 1DGEA 2DOUA 1CJ0A 4ADBA 5M4BA 3EI7A 3K7YA 2HORA 3OKSA 1YIYA 1GC0A 1YIZA 2JGTA 4CVQA 3WKSA 3MAUA 5EUEA 3II0A 1AIBA 2Z1ZA 4MKJA 4OBUA 1AHGA 3N7NA 1MLYA 3DR7A 4MQQA 4O6ZA 5D5SA 1GEXA 1KKPA 1X0MA 4R2NA 4CXQA 4F4EA 4A6RA 5G2QA 3DXVA 4EMYA 3H14A 3RCHB 1D7VA 1DJEA 1PFFA 2E7IA 3D6KA 3HVYA 4LNLA 2NMPA 3PA9A 5EFSA 2VGWA 2W8WA 2D63A 4P3MA 1N31A 3HQTA 1QITA 1C0NA 1ARTA 1RVUA 3FZ6A 2OGAA 5F8VA 1B8GA 1BJWA 5E4ZA 2CB1A 2Z9VA 1C7NA 4XQ2A 4ZSYA 3ELEA 3AEJC 3IF2A 2AY7A 4IYOA 1YJSA 5F9SA 2ZP7A 2BWPA 4WYDA 3EI5A 1BJOB 1I43A 2G7JA 1ASLA 1MDOA 4PFNA 2PO3A 4TV7A 2Z67A 1WYVA 2E7JA 2FYFA 3VK2A 3WKRA 1Y4IA 9AATA 1FG7A 1WYTA 4WYFA 2PB0A 4ADCA 2ZSLA 1C9CA 1V2EA 2DGMA 3AELA 4A0HA 1GEYA 2D66A 3G8MA 4K2BA 2VMQA 3A9XA 4WYEA 3AEPA 4L0OA 2W7IA 3WCOA 4GE7A 5G09A 2X5FA 1ARHA 1XI9A 3BS8A 1AKBA 1LC8A 4OC9A 4ZDOA 1QIRA 2WK8A 4IW7A 1LKCA 1PG8A 4MKKA 4OYTA 1KL1A 3PDXA 1LW5A 1S0AA 1AMSA 1C7OA 1GC2A 1SZKA 4BA5A 2AEUA 2ZSMA 3TFTA 4IY7A 1AMAA 4U2HA 1S06A 2YCTA 3LY1A 1ORDA 1UU0A 1AMRA 3DC1A 4W5KA 4ZASA 1I29A 4B9BA 4ZM4A 2VMXA 1IJIA 2BYJA 1V2FA 2FM1A 1H1CA 3E2ZB 3EZ1A 2GQNA 4AZKA 3AEOA 3UWCA 1RVYA 2FQ6A 2FKIA 1WKHA 4RM1A 4LC3A 1SF2A 2CH2A 3AOWA 3E2FA 2OKJA 2YKYA 3FVUA 4M2JA 1AX4A 1IAXA 4KXKA 4A0GA 3NYSA 1B4XA 1OHYA 2O7CA 2CH1A 2Z9WA 4WB0A 4A6TA 2W7EA 2Z9XA 4Y0DA 4JEVA 3I5TA 3P1TA 4CBRA 1AY5A 3MC6C 1YJZA 5FT6A 4XJPA 3VOMA 4GSAA 1JF9A 3LVLB 3F0HA 1DFOA 1CL1A 1J32A 3CQ5A 4ISYA 3RBLA 1TASA 3NYUA 3M5UA 4CXRA 3GZDC 2BI9A 1QJ5A 3N75A 5BJ4A 2ZY5A 1LC5A 5TF5A 1B5OA 2VMPA 3BWNC 5EAVA 3BCAA 4A6UA 1ASFA 4E3QA 4W1XA 5HHYA 5DX5A 1GBNA 4W1WA 3HMUA 2YKVA 5G4IA 3T32A 2Q7WA 2VI9A 1GCKA 2FNUA 4F5MA 3FTBA 4F5GA 3PD6A 2D5YA 1KMKA 1WYUB 4RJYA 2QB2A 1TOGA 2YKUA 2W7GA 1O62A 2HOZA 2OKKA 4XJOA 1JG8A 4F5KA 4WD2A 3ATHA 3WGCA 3N0LA 1X29A 3FDBA 1AHXA 4BHDA 1LC7A 3BCBA 2JJFA 3JZLA 1AHEA 2CANA 3FDDA 1CZEA 1W7NA 2BIGA 3RI6A 2E7UA 4EB5A 4I8AA 4IXZA 2R5EA 1O61A 4E3RA 1SZSA 4R5ZA 2WKAA 3GWPA 2VMZA 3A8UX 2VGUA 1S08A 4PVFA 2CFBA 2W8UA 2ZYJA 4JE5A 3H7FA 4UHMA 3N4RA 3AEMC 1YNUA 3NDNA 3IHJA 3TATA 1ECXA 2E54A 4AO9A 1TOIA 2VMSA 3A9YA 3EUCA 4QGRA 4TMRA 1YOOA 2C44A 2AY5A 4OMAA 2BIEA 2C7TA 2HUUA 3GSBA 1ASCA 5DB5A 4UHNA 1QGNA 2W8TA 4WXBA 1CL2A 1TOJA 3TCMA 2DKBA 1GEWA 1KKJA 1D7SA 1GC3A 2QB3A 4ZAHA 2VMNA 2BI1A 2JJGA 4MGRA 4Q75A 5EUNA 2QA3A 2CJDA 4WP0A 2R5CB 2W7JA 3MEBA 1ASNA 5LHAA 2VMWA 3MC6A 1U08A 2OATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E5E A;  2VGZ A;  3GET A;  4TN4 A;  5FT4 A;  3PJ0 A;  4CBS A;  1OHV A;  1ZOD A;  3JWA A;  2VMT A;  4KAM A;  2BIA A;  5EIG B;  3DR4 A;  4W91 A;  1SPA A;  4J8L A;  3ECD A;  3BC8 A;  3B1D A;  4JEY A;  2CIN A;  3W1I A;  3FKD A;  3RCH A;  3W1H A;  3B1C A;  3ACZ A;  2EZ2 A;  4Y0I A;  3WLX A;  1OAT A;  7AAT A;  1BQD A;  2CTZ A;  4RJ0 A;  2HP1 A;  2VGS A;  1AY4 A;  5FT5 A;  5HXX A;  1B9I A;  2Z1Y A;  2VIB A;  3G0T A;  2HOX A;  3COG A;  3I16 A;  2F8J A;  2W7K A;  4WBT A;  1RV3 A;  2CST A;  8AAT A;  1IX8 A;  4ADE A;  2BHX A;  1AHY A;  1BJO A;  3LVK A;  3LVJ A;  2Z9U A;  2VYC A;  4GE4 A;  2CY8 A;  3EI6 A;  4PFF A;  5G2P A;  3GBX A;  3KKI A;  4RIZ A;  1BQA A;  4UOY A;  3UE8 A;  5M49 A;  1MAP A;  2VLH A;  1JS3 A;  1AIA A;  3EIB A;  5J8Q A;  3DOD A;  4ZM3 A;  3FCR A;  1AY8 A;  2BWN A;  4JF0 A;  3NX3 A;  2W7H A;  3QM2 A;  1E5F A;  3LV2 A;  3QGU A;  4P7Y A;  3K28 A;  3HT4 A;  3CQ4 A;  4RLG A;  3B1E A;  3DZZ A;  2YOB A;  4JEZ A;  4LW4 A;  3DRD A;  3TFU A;  1LW4 A;  3LWS A;  3GZC A;  2EH6 A;  3FQ8 A;  4MQR A;  2W7M A;  1D2F A;  3F6T A;  3AAT A;  1QIS A;  5EAA A;  4Y0H A;  4WLH A;  1LS3 A;  1JS6 A;  1B5P A;  3VK3 A;  3ZRR A;  3FZ7 A;  4DGT A;  4OTL A;  4JF1 A;  2O1B A;  3WZF A;  4A0F A;  3ISL A;  4JEW A;  2YRI A;  1G7W A;  3BWO A;  1MGV A;  1G4X A;  2EO5 A;  2VGT A;  3EZS A;  2AY9 A;  5M46 A;  1EG5 A;  4ZWV A;  4MSO A;  1P3W A;  3BN1 A;  1ASB A;  1GC4 A;  2VGV A;  3BB8 A;  3GJU A;  2HZP A;  2D7Y A;  3PGY A;  1ASG A;  1Z7D A;  3W1J A;  4WB0 B;  3ELP A;  4EFF A;  1AHF A;  2YKX A;  2RFV A;  2AY1 A;  1WKG A;  2V0Y A;  1EQB A;  1VJO A;  2D7Z A;  3ASA A;  3BCX A;  5EUD A;  1N2T A;  2GMS A;  1IUG A;  2EZ1 A;  5BJ3 A;  3R4T A;  1CQ6 A;  3HBX A;  4IYO B;  2YCN A;  2XH1 A;  4OT8 A;  3VK4 A;  1M6S A;  2Z61 A;  3TQX A;  3QHX A;  4B98 A;  3MAD A;  2JJH A;  3MKJ A;  1ZC9 A;  1PMM A;  2BI3 A;  3JTX A;  3L8A A;  5D95 A;  1BJ4 A;  3FRK A;  3EI8 A;  4ITG A;  4ATQ A;  1C4K A;  1UU2 A;  5EQC A;  4ITX A;  1O4S A;  3VP6 A;  3NUB A;  1AKA A;  4KYO A;  1SZU A;  5IWQ A;  4XJL A;  5HDM A;  5C6U A;  4R5F A;  1O69 A;  5LH9 A;  3LVM A;  2BI5 A;  3QBO A;  1CZC A;  3FFR A;  2Z20 A;  3HLM A;  4J5U A;  3PD6 B;  2FNI A;  3ZRQ A;  4DBC A;  1MAQ A;  2HP2 A;  4ZDL A;  2D61 A;  2D64 A;  2HUF A;  3FZ8 A;  2VMU A;  2GSA A;  1VP4 A;  4AZJ A;  3MBB A;  1TOK A;  5G0A A;  3WY7 A;  1AAW A;  1W23 A;  1KMJ A;  2BKW A;  3JWB A;  3MAF B;  3QI6 A;  1ARG A;  4GDY A;  4ATP A;  4F5F A;  5I92 A;  1DKA A;  3HL2 A;  2ZJG A;  3DXW A;  1TAR A;  1M32 A;  2W7F A;  4LNJ A;  4R8D A;  5E3K A;  1G7X A;  1ARI A;  2OGE A;  2VMY A;  1ASM A;  4ZLV A;  1DTY A;  2DKJ A;  3FFH A;  1AIC A;  1EJI A;  2JJE A;  2V1P A;  4GRX A;  2GB3 A;  3AEJ A;  4DQ6 A;  3FQ7 A;  1KL2 A;  4K2M A;  4W1V A;  2R0T A;  1WYU A;  3GR9 A;  4Q76 A;  4Q6R A;  1ASA A;  1AJR A;  1D7R A;  1M4N A;  2ORD A;  4ZDP A;  4A00 A;  3AEM A;  3QPG A;  1WYT B;  1BW0 A;  2AAT A;  1ELU A;  4XJM A;  3WCN A;  3CBF A;  1I41 A;  2CJH A;  3B46 A;  4RIT A;  1J04 A;  4K2I A;  4F5I A;  2BWO A;  1SFF A;  2DGK A;  3FVS A;  3ZRP A;  2AY4 A;  2AY8 A;  4N0W A;  3E2Y A;  3PIU A;  2VMR A;  2VIA A;  1W3U A;  1GDE A;  2ZC0 A;  3KGX A;  3RUY A;  3VAX A;  3WX9 A;  3NU7 A;  1CS1 A;  2ZUK A;  1AMQ A;  2VLF A;  3N5M A;  1AJS B;  2HOY A;  2HUI A;  3OP7 A;  3PDB B;  4BA4 A;  1I48 A;  5AX8 A;  3JU7 A;  3EI9 A;  3K40 A;  2R5C A;  4HVK A;  5G4J A;  2OQX A;  4WYG A;  3RQ1 A;  3FD0 A;  1IX7 A;  1YJY A;  3B8X A;  2WK9 A;  4H51 A;  3ZZJ A;  4HF8 A;  4WYC A;  1YAA A;  4MQP A;  4WXF A;  5E5I A;  4ZWM A;  2VMV A;  3MAF A;  3FVX A;  4JEX A;  1S07 A;  3UAK A;  4RAE A;  2W8V A;  1T3I A;  2PB2 A;  4JE5 D;  4PIW A;  3CQ6 A;  5FT8 A;  1DJ9 A;  3LG0 A;  1AKC A;  4FL0 A;  1IBJ A;  3NUI A;  1H0C A;  2AEV A;  2TPL A;  3NNK A;  1B9H A;  5DJ1 A;  3NYT A;  1TPL A;  3AEN A;  2BI2 A;  3KE3 A;  3A9Z A;  1MDZ A;  3FSL A;  3AOV A;  1BS0 A;  2ZY3 A;  2YCP A;  4N0B A;  2VMO A;  3ZZK A;  1ELQ A;  3RBF A;  1BJN A;  1DGD A;  2X3L A;  3G7Q A;  3E2Z A;  3EIA A;  3P6K A;  1IVR A;  3FQA A;  3F9T A;  4UHO A;  2AY2 A;  3R9A A;  1MLZ A;  4MY5 A;  1M0Q A;  3GZD A;  4LNM A;  3PPL A;  1UKJ A;  3WGB A;  5M4D A;  3AV7 A;  1BT4 A;  2BYL A;  4XEW A;  1VEF A;  1UU1 A;  4OCA A;  4IXO A;  2EPJ A;  2AY6 A;  1ZOB A;  1GD9 A;  1ASD A;  2DR1 A;  4Q31 A;  4F5H A;  2ZY4 A;  4EB7 A;  2C0R A;  1M7Y A;  3AEN B;  2W7L A;  3DU4 A;  3HDO A;  3QN6 A;  1M0O A;  1WST A;  4GEB A;  4RKD A;  2EGY A;  1X2A A;  1FG3 A;  4RKC A;  4IX8 A;  1Z3Z A;  4E77 A;  1M0N A;  4AOA A;  2QLR A;  2W8J A;  5JAY A;  3NRA A;  2FN6 A;  4A72 A;  4AO4 A;  2R2N A;  4U1T A;  4A0R A;  3A2B A;  1SVV A;  2YRR A;  1ASE A;  1BKG A;  2O0R A;  4XAU A;  1PMO A;  1W7M A;  3ASB A;  1V2D A;  4ZSW A;  1CQ7 A;  1IAY A;  5DJ9 A;  2DGL A;  3NTJ A;  5K8B A;  3E9K A;  4WYA A;  1ARS A;  1C7G A;  2JIS A;  4EU1 A;  4M2K A;  4WXG A;  3L44 A;  3PDB A;  3Q8N A;  3DYD A;  4E1O A;  1AJS A;  4F5J A;  1G4V A;  1LK9 A;  1QZ9 A;  2AY3 A;  1FC4 A;  3BV0 A;  1CQ8 A;  3E6G A;  2VI8 A;  3I4J A;  4UQV A;  4ADD A;  4BMK A;  4M2M A;  1IX6 A;  2C81 A;  2ZY2 A;  2GMU A;  4WLJ A;  2W7D A;  3KGW A;  1S09 A;  1V72 A;  1WYV B;  4FFC A;  4BQ0 A;  1M0P A;  2D65 A;  3BWN A;  1OXP A;  4F5L A;  1TAT A;  4XK1 A;  3E77 A;  5EIG A;  4AH3 A;  3CAI A;  1XEY A;  1OHW A;  4W8I A;  3USF A;  2QBT A;  2XBN A;  4IXS A;  2CJG A;  3NU8 A;  2X8U A;  4GE9 A;  1X28 A;  2JG2 A;  2QMA A;  1OXO A;  3PAA A;  4NOG A;  2G6W A;  1DJU A;  2X5D A;  1MDX A;  1W7L A;  2YHK A;  3JW9 A;  2WK7 A;  4OBV A;  1N8P A;  1D7U A;  1AAM A;  1RV4 A;  1TOE A;  1QJ3 A;  4LW2 A;  1DGE A;  2DOU A;  1CJ0 A;  4ADB A;  5M4B A;  3EI7 A;  3K7Y A;  2HOR A;  3OKS A;  1YIY A;  1GC0 A;  1YIZ A;  2JGT A;  4CVQ A;  3WKS A;  3MAU A;  5EUE A;  3II0 A;  1AIB A;  2Z1Z A;  4MKJ A;  4OBU A;  1AHG A;  1MLY A;  3DR7 A;  4MQQ A;  4O6Z A;  5D5S A;  1GEX A;  1KKP A;  1X0M A;  4R2N A;  4CXQ A;  4F4E A;  4A6R A;  5G2Q A;  3DXV A;  4EMY A;  3H14 A;  3RCH B;  1D7V A;  1DJE A;  1PFF A;  2E7I A;  3D6K A;  3HVY A;  4LNL A;  2NMP A;  3PA9 A;  5EFS A;  2VGW A;  2W8W A;  2D63 A;  4P3M A;  1N31 A;  3HQT A;  1QIT A;  1C0N A;  1ART A;  1RVU A;  3FZ6 A;  2OGA A;  5F8V A;  1B8G A;  1BJW A;  5E4Z A;  2CB1 A;  2Z9V A;  1C7N A;  4XQ2 A;  4ZSY A;  3ELE A;  3AEJ C;  3IF2 A;  2AY7 A;  4IYO A;  1YJS A;  5F9S A;  2ZP7 A;  2BWP A;  4WYD A;  3EI5 A;  1BJO B;  1I43 A;  1ASL A;  1MDO A;  4PFN A;  2PO3 A;  4TV7 A;  2Z67 A;  1WYV A;  2E7J A;  2FYF A;  3VK2 A;  3WKR A;  1Y4I A;  9AAT A;  1FG7 A;  1WYT A;  4WYF A;  2PB0 A;  4ADC A;  2ZSL A;  1C9C A;  1V2E A;  2DGM A;  3AEL A;  4A0H A;  1GEY A;  2D66 A;  3G8M A;  4K2B A;  2VMQ A;  3A9X A;  4WYE A;  3AEP A;  4L0O A;  2W7I A;  3WCO A;  4GE7 A;  5G09 A;  2X5F A;  1ARH A;  1XI9 A;  3BS8 A;  1AKB A;  1LC8 A;  4OC9 A;  4ZDO A;  1QIR A;  2WK8 A;  4IW7 A;  1LKC A;  1PG8 A;  4MKK A;  4OYT A;  1KL1 A;  3PDX A;  1LW5 A;  1S0A A;  1AMS A;  1C7O A;  1GC2 A;  1SZK A;  4BA5 A;  2AEU A;  2ZSM A;  3TFT A;  4IY7 A;  1AMA A;  4U2H A;  1S06 A;  2YCT A;  3LY1 A;  1ORD A;  1UU0 A;  1AMR A;  3DC1 A;  4W5K A;  4ZAS A;  1I29 A;  4B9B A;  4ZM4 A;  2VMX A;  1IJI A;  2BYJ A;  1V2F A;  2FM1 A;  1H1C A;  3E2Z B;  3EZ1 A;  2GQN A;  4AZK A;  3AEO A;  3UWC A;  1RVY A;  2FQ6 A;  1WKH A;  4RM1 A;  4LC3 A;  1SF2 A;  2CH2 A;  3AOW A;  3E2F A;  2OKJ A;  2YKY A;  3FVU A;  4M2J A;  1AX4 A;  1IAX A;  4KXK A;  4A0G A;  3NYS A;  1B4X A;  1OHY A;  2O7C A;  2CH1 A;  2Z9W A;  4WB0 A;  4A6T A;  2W7E A;  2Z9X A;  4Y0D A;  4JEV A;  3I5T A;  3P1T A;  4CBR A;  1AY5 A;  3MC6 C;  1YJZ A;  5FT6 A;  4XJP A;  3VOM A;  4GSA A;  1JF9 A;  3LVL B;  3F0H A;  1DFO A;  1CL1 A;  1J32 A;  3CQ5 A;  4ISY A;  3RBL A;  1TAS A;  3NYU A;  3M5U A;  4CXR A;  3GZD C;  2BI9 A;  1QJ5 A;  3N75 A;  5BJ4 A;  2ZY5 A;  1LC5 A;  5TF5 A;  1B5O A;  2VMP A;  3BWN C;  5EAV A;  3BCA A;  4A6U A;  1ASF A;  4E3Q A;  4W1X A;  5HHY A;  5DX5 A;  1GBN A;  4W1W A;  3HMU A;  2YKV A;  5G4I A;  3T32 A;  2Q7W A;  2VI9 A;  1GCK A;  2FNU A;  4F5M A;  3FTB A;  4F5G A;  3PD6 A;  2D5Y A;  1KMK A;  1WYU B;  4RJY A;  2QB2 A;  1TOG A;  2YKU A;  2W7G A;  1O62 A;  2HOZ A;  2OKK A;  4XJO A;  1JG8 A;  4F5K A;  4WD2 A;  3ATH A;  3WGC A;  3N0L A;  1X29 A;  3FDB A;  1AHX A;  4BHD A;  1LC7 A;  3BCB A;  2JJF A;  3JZL A;  1AHE A;  2CAN A;  3FDD A;  1CZE A;  1W7N A;  2BIG A;  3RI6 A;  2E7U A;  4EB5 A;  4I8A A;  4IXZ A;  2R5E A;  1O61 A;  4E3R A;  1SZS A;  4R5Z A;  2WKA A;  3GWP A;  2VMZ A;  3A8U X;  2VGU A;  1S08 A;  4PVF A;  2CFB A;  2W8U A;  2ZYJ A;  4JE5 A;  3H7F A;  4UHM A;  3AEM C;  1YNU A;  3NDN A;  3IHJ A;  3TAT A;  1ECX A;  2E54 A;  4AO9 A;  1TOI A;  2VMS A;  3A9Y A;  3EUC A;  4QGR A;  4TMR A;  1YOO A;  2C44 A;  2AY5 A;  4OMA A;  2BIE A;  2C7T A;  2HUU A;  3GSB A;  1ASC A;  5DB5 A;  4UHN A;  1QGN A;  2W8T A;  4WXB A;  1CL2 A;  1TOJ A;  3TCM A;  2DKB A;  1GEW A;  1KKJ A;  1D7S A;  1GC3 A;  2QB3 A;  4ZAH A;  2VMN A;  2BI1 A;  2JJG A;  4MGR A;  4Q75 A;  5EUN A;  2QA3 A;  2CJD A;  4WP0 A;  2R5C B;  2W7J A;  3MEB A;  1ASN A;  5LHA A;  2VMW A;  3MC6 A;  1U08 A;  2OAT A; 
#chains in the Genus database with same CATH topology
 1E5E A;  2VGZ A;  3GET A;  4TN4 A;  5FT4 A;  3PJ0 A;  4CBS A;  1OHV A;  1ZOD A;  3JWA A;  2VMT A;  4KAM A;  2BIA A;  5EIG B;  3DR4 A;  4W91 A;  1SPA A;  4J8L A;  3ECD A;  3BC8 A;  3B1D A;  3N4X A;  4JEY A;  2CIN A;  3W1I A;  3FKD A;  3RCH A;  3W1H A;  3B1C A;  3ACZ A;  2EZ2 A;  4Y0I A;  3WLX A;  1OAT A;  7AAT A;  4H63 Q;  1BQD A;  2CTZ A;  4RJ0 A;  2HP1 A;  2VGS A;  1AY4 A;  5FT5 A;  5HXX A;  1B9I A;  2Z1Y A;  2VIB A;  3G0T A;  2HOX A;  3COG A;  3I16 A;  2F8J A;  2W7K A;  4WBT A;  1RV3 A;  2CST A;  8AAT A;  4K05 A;  1IX8 A;  4ADE A;  2BHX A;  1AHY A;  1BJO A;  3LVK A;  3LVJ A;  2Z9U A;  2VYC A;  4GE4 A;  2CY8 A;  3EI6 A;  4PFF A;  5G2P A;  3GBX A;  3KKI A;  4RIZ A;  1BQA A;  4UOY A;  3UE8 A;  5KTB A;  5M49 A;  1MAP A;  2VLH A;  1JS3 A;  1AIA A;  3EIB A;  5J8Q A;  3DOD A;  4ZM3 A;  3FCR A;  1AY8 A;  2BWN A;  4JF0 A;  3NX3 A;  2W7H A;  3QM2 A;  1E5F A;  3LV2 A;  3QGU A;  4P7Y A;  3K28 A;  3HT4 A;  3CQ4 A;  4RLG A;  3B1E A;  3DZZ A;  2YOB A;  4JEZ A;  4LW4 A;  3DRD A;  3TFU A;  1LW4 A;  3LWS A;  3GZC A;  2EH6 A;  3FQ8 A;  4MQR A;  2W7M A;  1D2F A;  3F6T A;  3AAT A;  1QIS A;  5EAA A;  4Y0H A;  4WLH A;  1LS3 A;  1JS6 A;  1B5P A;  3VK3 A;  3ZRR A;  3FZ7 A;  4DGT A;  4OTL A;  4JF1 A;  2O1B A;  3WZF A;  4A0F A;  3ISL A;  4JEW A;  2YRI A;  3N4S A;  1G7W A;  3BWO A;  1MGV A;  1G4X A;  2EO5 A;  2VGT A;  3EZS A;  2AY9 A;  5M46 A;  1EG5 A;  4ZWV A;  4MSO A;  1P3W A;  3BN1 A;  1ASB A;  1GC4 A;  2VGV A;  3BB8 A;  3GJU A;  2HZP A;  2D7Y A;  3PGY A;  1ASG A;  1Z7D A;  3W1J A;  4WB0 B;  3ELP A;  4EFF A;  1AHF A;  2YKX A;  2RFV A;  2AY1 A;  1WKG A;  2V0Y A;  1EQB A;  1VJO A;  2D7Z A;  3ASA A;  3BCX A;  5EUD A;  1N2T A;  2A1V A;  2GMS A;  1IUG A;  2EZ1 A;  5BJ3 A;  3R4T A;  1CQ6 A;  3HBX A;  4IYO B;  2YCN A;  2XH1 A;  4OT8 A;  3VK4 A;  1M6S A;  2Z61 A;  3TQX A;  3QHX A;  4B98 A;  3MAD A;  2JJH A;  3MKJ A;  1ZC9 A;  1PMM A;  2BI3 A;  3JTX A;  3L8A A;  5D95 A;  1BJ4 A;  3FRK A;  3EI8 A;  4ITG A;  4ATQ A;  1C4K A;  1UU2 A;  5EQC A;  4ITX A;  1O4S A;  2WB6 A;  3VP6 A;  3NUB A;  1AKA A;  4KYO A;  1SZU A;  5IWQ A;  4XJL A;  5HDM A;  5C6U A;  4R5F A;  1O69 A;  5LH9 A;  3LVM A;  2BI5 A;  3QBO A;  1CZC A;  3FFR A;  2Z20 A;  3HLM A;  4J5U A;  3PD6 B;  2FNI A;  3ZRQ A;  4DBC A;  1MAQ A;  2HP2 A;  4ZDL A;  2D61 A;  2D64 A;  2HUF A;  3FZ8 A;  2VMU A;  2GSA A;  1VP4 A;  4AZJ A;  3MBB A;  1TOK A;  5G0A A;  3WY7 A;  1AAW A;  1W23 A;  1KMJ A;  2BKW A;  3JWB A;  3MAF B;  3QI6 A;  1ARG A;  4GDY A;  4ATP A;  2QSR A;  4F5F A;  5I92 A;  1DKA A;  3HL2 A;  2ZJG A;  3DXW A;  1TAR A;  1M32 A;  2W7F A;  4LNJ A;  2EYQ A;  4R8D A;  5E3K A;  1G7X A;  1ARI A;  2OGE A;  2VMY A;  1ASM A;  4ZLV A;  1DTY A;  2DKJ A;  3FFH A;  1AIC A;  1EJI A;  2JJE A;  2V1P A;  4GRX A;  2GB3 A;  3AEJ A;  4DQ6 A;  3FQ7 A;  1KL2 A;  4K2M A;  4W1V A;  2R0T A;  1WYU A;  3GR9 A;  4Q76 A;  4Q6R A;  1ASA A;  1AJR A;  1D7R A;  1M4N A;  2ORD A;  4ZDP A;  4A00 A;  3AEM A;  3QPG A;  1WYT B;  1BW0 A;  2AAT A;  1ELU A;  4XJM A;  3WCN A;  3CBF A;  1I41 A;  2CJH A;  3B46 A;  4RIT A;  1J04 A;  4K2I A;  4F5I A;  2BWO A;  1SFF A;  2DGK A;  3FVS A;  3ZRP A;  2AY4 A;  2AY8 A;  4N0W A;  3E2Y A;  3PIU A;  2VMR A;  2VIA A;  1W3U A;  1GDE A;  2ZC0 A;  3KGX A;  3RUY A;  3VAX A;  3WX9 A;  3NU7 A;  1CS1 A;  2ZUK A;  1AMQ A;  2VLF A;  3N5M A;  1AJS B;  2HOY A;  2HUI A;  3OP7 A;  3PDB B;  4BA4 A;  1I48 A;  5AX8 A;  3JU7 A;  3EI9 A;  3K40 A;  2R5C A;  4HVK A;  5G4J A;  2OQX A;  4WYG A;  3RQ1 A;  3FD0 A;  1IX7 A;  1YJY A;  3B8X A;  2WK9 A;  4H51 A;  3ZZJ A;  4HF8 A;  4WYC A;  1YAA A;  4MQP A;  4WXF A;  5E5I A;  4ZWM A;  2VMV A;  3MAF A;  3FVX A;  4JEX A;  1S07 A;  3UAK A;  4RAE A;  2W8V A;  1T3I A;  2PB2 A;  4JE5 D;  4PIW A;  3CQ6 A;  5FT8 A;  1DJ9 A;  3LG0 A;  1AKC A;  4FL0 A;  1IBJ A;  3NUI A;  1H0C A;  2AEV A;  2TPL A;  3NNK A;  1B9H A;  5DJ1 A;  3NYT A;  1TPL A;  3AEN A;  2BI2 A;  3KE3 A;  3A9Z A;  1MDZ A;  3FSL A;  3AOV A;  1BS0 A;  2ZY3 A;  2YCP A;  4N0B A;  2VMO A;  3H9X A;  3ZZK A;  1ELQ A;  3RBF A;  1BJN A;  1DGD A;  2X3L A;  3G7Q A;  3E2Z A;  3EIA A;  3P6K A;  1IVR A;  3FQA A;  3F9T A;  4UHO A;  2AY2 A;  3R9A A;  1MLZ A;  4MY5 A;  1M0Q A;  3GZD A;  4LNM A;  2KFP A;  3PPL A;  1UKJ A;  3WGB A;  5M4D A;  3AV7 A;  1BT4 A;  2BYL A;  4XEW A;  1VEF A;  1UU1 A;  4OCA A;  4IXO A;  2EPJ A;  2AY6 A;  1ZOB A;  1GD9 A;  1ASD A;  2DR1 A;  4Q31 A;  4F5H A;  2ZY4 A;  4EB7 A;  2C0R A;  1M7Y A;  3AEN B;  2W7L A;  3DU4 A;  3HDO A;  3QN6 A;  1M0O A;  1WST A;  4GEB A;  4RKD A;  2EGY A;  1X2A A;  1FG3 A;  4RKC A;  4IX8 A;  1Z3Z A;  4E77 A;  1M0N A;  4AOA A;  2QLR A;  2W8J A;  5JAY A;  3NRA A;  2FN6 A;  4A72 A;  4AO4 A;  2R2N A;  4U1T A;  4A0R A;  3A2B A;  1SVV A;  2YRR A;  1ASE A;  1BKG A;  2O0R A;  4XAU A;  1PMO A;  1W7M A;  3ASB A;  1V2D A;  4ZSW A;  1CQ7 A;  1IAY A;  5DJ9 A;  2DGL A;  3NTJ A;  5K8B A;  3E9K A;  4WYA A;  1ARS A;  1C7G A;  2JIS A;  4EU1 A;  4M2K A;  4WXG A;  3L44 A;  3PDB A;  3Q8N A;  3DYD A;  4E1O A;  1AJS A;  4F5J A;  1G4V A;  1LK9 A;  1QZ9 A;  2AY3 A;  1FC4 A;  3BV0 A;  1CQ8 A;  3E6G A;  2VI8 A;  3I4J A;  4UQV A;  4ADD A;  4BMK A;  4M2M A;  1IX6 A;  2C81 A;  2ZY2 A;  2GMU A;  4WLJ A;  2W7D A;  3KGW A;  1S09 A;  1V72 A;  1WYV B;  4FFC A;  4BQ0 A;  1M0P A;  2D65 A;  3BWN A;  1OXP A;  4F5L A;  1TAT A;  4XK1 A;  3E77 A;  5EIG A;  4AH3 A;  3CAI A;  1XEY A;  1OHW A;  4W8I A;  3USF A;  2QBT A;  2XBN A;  4IXS A;  2CJG A;  3NU8 A;  2X8U A;  4GE9 A;  1X28 A;  2JG2 A;  2QMA A;  1OXO A;  3PAA A;  4NOG A;  2G6W A;  1DJU A;  2X5D A;  1MDX A;  1W7L A;  2YHK A;  3JW9 A;  2WK7 A;  4OBV A;  1N8P A;  1D7U A;  1AAM A;  1RV4 A;  1TOE A;  1QJ3 A;  4LW2 A;  1DGE A;  2DOU A;  1CJ0 A;  4ADB A;  5M4B A;  3EI7 A;  3K7Y A;  2HOR A;  3OKS A;  1YIY A;  1GC0 A;  1YIZ A;  2JGT A;  4CVQ A;  3WKS A;  3MAU A;  5EUE A;  3II0 A;  1AIB A;  2Z1Z A;  4MKJ A;  4OBU A;  1AHG A;  3N7N A;  1MLY A;  3DR7 A;  4MQQ A;  4O6Z A;  5D5S A;  1GEX A;  1KKP A;  1X0M A;  4R2N A;  4CXQ A;  4F4E A;  4A6R A;  5G2Q A;  3DXV A;  4EMY A;  3H14 A;  3RCH B;  1D7V A;  1DJE A;  1PFF A;  2E7I A;  3D6K A;  3HVY A;  4LNL A;  2NMP A;  3PA9 A;  5EFS A;  2VGW A;  2W8W A;  2D63 A;  4P3M A;  1N31 A;  3HQT A;  1QIT A;  1C0N A;  1ART A;  1RVU A;  3FZ6 A;  2OGA A;  5F8V A;  1B8G A;  1BJW A;  5E4Z A;  2CB1 A;  2Z9V A;  1C7N A;  4XQ2 A;  4ZSY A;  3ELE A;  3AEJ C;  3IF2 A;  2AY7 A;  4IYO A;  1YJS A;  5F9S A;  2ZP7 A;  2BWP A;  4WYD A;  3EI5 A;  1BJO B;  1I43 A;  2G7J A;  1ASL A;  1MDO A;  4PFN A;  2PO3 A;  4TV7 A;  2Z67 A;  1WYV A;  2E7J A;  2FYF A;  3VK2 A;  3WKR A;  1Y4I A;  9AAT A;  1FG7 A;  1WYT A;  1KAF A;  4WYF A;  2PB0 A;  4ADC A;  2ZSL A;  1C9C A;  1V2E A;  2DGM A;  3AEL A;  4A0H A;  1GEY A;  2D66 A;  3G8M A;  4K2B A;  2VMQ A;  3A9X A;  4WYE A;  3AEP A;  4L0O A;  2W7I A;  3WCO A;  4GE7 A;  5G09 A;  2X5F A;  1ARH A;  1XI9 A;  3BS8 A;  1AKB A;  1LC8 A;  4OC9 A;  4ZDO A;  1QIR A;  2WK8 A;  4IW7 A;  1LKC A;  1PG8 A;  4MKK A;  4OYT A;  1KL1 A;  3PDX A;  1LW5 A;  1S0A A;  1AMS A;  1C7O A;  1GC2 A;  1SZK A;  4BA5 A;  2AEU A;  2ZSM A;  3TFT A;  4IY7 A;  1AMA A;  4U2H A;  1S06 A;  2YCT A;  3LY1 A;  1ORD A;  1UU0 A;  1AMR A;  3DC1 A;  4W5K A;  4ZAS A;  1I29 A;  4B9B A;  4ZM4 A;  2VMX A;  1IJI A;  2BYJ A;  1V2F A;  2FM1 A;  1H1C A;  3E2Z B;  3EZ1 A;  2GQN A;  4AZK A;  3AEO A;  3UWC A;  1RVY A;  2FQ6 A;  2FKI A;  1WKH A;  4RM1 A;  4LC3 A;  1SF2 A;  2CH2 A;  3AOW A;  3E2F A;  2OKJ A;  2YKY A;  3FVU A;  4M2J A;  1AX4 A;  1IAX A;  4KXK A;  4A0G A;  3NYS A;  1B4X A;  1OHY A;  2O7C A;  2CH1 A;  2Z9W A;  4WB0 A;  4A6T A;  2W7E A;  2Z9X A;  4Y0D A;  4JEV A;  3I5T A;  3P1T A;  4CBR A;  1AY5 A;  3MC6 C;  1YJZ A;  5FT6 A;  4XJP A;  3VOM A;  4GSA A;  1JF9 A;  3LVL B;  3F0H A;  1DFO A;  1CL1 A;  1J32 A;  3CQ5 A;  4ISY A;  3RBL A;  1TAS A;  3NYU A;  3M5U A;  4CXR A;  3GZD C;  2BI9 A;  1QJ5 A;  3N75 A;  5BJ4 A;  2ZY5 A;  1LC5 A;  5TF5 A;  1B5O A;  2VMP A;  3BWN C;  5EAV A;  3BCA A;  4A6U A;  1ASF A;  4E3Q A;  4W1X A;  5HHY A;  5DX5 A;  1GBN A;  4W1W A;  3HMU A;  2YKV A;  5G4I A;  3T32 A;  2Q7W A;  2VI9 A;  1GCK A;  2FNU A;  4F5M A;  3FTB A;  4F5G A;  3PD6 A;  2D5Y A;  1KMK A;  1WYU B;  4RJY A;  2QB2 A;  1TOG A;  2YKU A;  2W7G A;  1O62 A;  2HOZ A;  2OKK A;  4XJO A;  1JG8 A;  4F5K A;  4WD2 A;  3ATH A;  3WGC A;  3N0L A;  1X29 A;  3FDB A;  1AHX A;  4BHD A;  1LC7 A;  3BCB A;  2JJF A;  3JZL A;  1AHE A;  2CAN A;  3FDD A;  1CZE A;  1W7N A;  2BIG A;  3RI6 A;  2E7U A;  4EB5 A;  4I8A A;  4IXZ A;  2R5E A;  1O61 A;  4E3R A;  1SZS A;  4R5Z A;  2WKA A;  3GWP A;  2VMZ A;  3A8U X;  2VGU A;  1S08 A;  4PVF A;  2CFB A;  2W8U A;  2ZYJ A;  4JE5 A;  3H7F A;  4UHM A;  3N4R A;  3AEM C;  1YNU A;  3NDN A;  3IHJ A;  3TAT A;  1ECX A;  2E54 A;  4AO9 A;  1TOI A;  2VMS A;  3A9Y A;  3EUC A;  4QGR A;  4TMR A;  1YOO A;  2C44 A;  2AY5 A;  4OMA A;  2BIE A;  2C7T A;  2HUU A;  3GSB A;  1ASC A;  5DB5 A;  4UHN A;  1QGN A;  2W8T A;  4WXB A;  1CL2 A;  1TOJ A;  3TCM A;  2DKB A;  1GEW A;  1KKJ A;  1D7S A;  1GC3 A;  2QB3 A;  4ZAH A;  2VMN A;  2BI1 A;  2JJG A;  4MGR A;  4Q75 A;  5EUN A;  2QA3 A;  2CJD A;  4WP0 A;  2R5C B;  2W7J A;  3MEB A;  1ASN A;  5LHA A;  2VMW A;  3MC6 A;  1U08 A;  2OAT A; 
#chains in the Genus database with same CATH homology
 1E5E A;  2VGZ A;  3GET A;  4TN4 A;  5FT4 A;  3PJ0 A;  4CBS A;  1OHV A;  1ZOD A;  3JWA A;  2VMT A;  4KAM A;  2BIA A;  5EIG B;  3DR4 A;  4W91 A;  1SPA A;  4J8L A;  3ECD A;  3BC8 A;  3B1D A;  3N4X A;  4JEY A;  2CIN A;  3W1I A;  3FKD A;  3RCH A;  3W1H A;  3B1C A;  3ACZ A;  2EZ2 A;  4Y0I A;  3WLX A;  1OAT A;  7AAT A;  4H63 Q;  1BQD A;  2CTZ A;  4RJ0 A;  2HP1 A;  2VGS A;  1AY4 A;  5FT5 A;  5HXX A;  1B9I A;  2Z1Y A;  2VIB A;  3G0T A;  2HOX A;  3COG A;  3I16 A;  2F8J A;  2W7K A;  4WBT A;  1RV3 A;  2CST A;  8AAT A;  4K05 A;  1IX8 A;  4ADE A;  2BHX A;  1AHY A;  1BJO A;  3LVK A;  3LVJ A;  2Z9U A;  2VYC A;  4GE4 A;  2CY8 A;  3EI6 A;  4PFF A;  5G2P A;  3GBX A;  3KKI A;  4RIZ A;  1BQA A;  4UOY A;  3UE8 A;  5KTB A;  5M49 A;  1MAP A;  2VLH A;  1JS3 A;  1AIA A;  3EIB A;  5J8Q A;  3DOD A;  4ZM3 A;  3FCR A;  1AY8 A;  2BWN A;  4JF0 A;  3NX3 A;  2W7H A;  3QM2 A;  1E5F A;  3LV2 A;  3QGU A;  4P7Y A;  3K28 A;  3HT4 A;  3CQ4 A;  4RLG A;  3B1E A;  3DZZ A;  2YOB A;  4JEZ A;  4LW4 A;  3DRD A;  3TFU A;  1LW4 A;  3LWS A;  3GZC A;  2EH6 A;  3FQ8 A;  4MQR A;  2W7M A;  1D2F A;  3F6T A;  3AAT A;  1QIS A;  5EAA A;  4Y0H A;  4WLH A;  1LS3 A;  1JS6 A;  1B5P A;  3VK3 A;  3ZRR A;  3FZ7 A;  4DGT A;  4OTL A;  4JF1 A;  2O1B A;  3WZF A;  4A0F A;  3ISL A;  4JEW A;  2YRI A;  3N4S A;  1G7W A;  3BWO A;  1MGV A;  1G4X A;  2EO5 A;  2VGT A;  3EZS A;  2AY9 A;  5M46 A;  1EG5 A;  4ZWV A;  4MSO A;  1P3W A;  3BN1 A;  1ASB A;  1GC4 A;  2VGV A;  3BB8 A;  3GJU A;  2HZP A;  2D7Y A;  3PGY A;  1ASG A;  1Z7D A;  3W1J A;  4WB0 B;  3ELP A;  4EFF A;  1AHF A;  2YKX A;  2RFV A;  2AY1 A;  1WKG A;  2V0Y A;  1EQB A;  1VJO A;  2D7Z A;  3ASA A;  3BCX A;  5EUD A;  1N2T A;  2A1V A;  2GMS A;  1IUG A;  2EZ1 A;  5BJ3 A;  3R4T A;  1CQ6 A;  3HBX A;  4IYO B;  2YCN A;  2XH1 A;  4OT8 A;  3VK4 A;  1M6S A;  2Z61 A;  3TQX A;  3QHX A;  4B98 A;  3MAD A;  2JJH A;  3MKJ A;  1ZC9 A;  1PMM A;  2BI3 A;  3JTX A;  3L8A A;  5D95 A;  1BJ4 A;  3FRK A;  3EI8 A;  4ITG A;  4ATQ A;  1C4K A;  1UU2 A;  5EQC A;  4ITX A;  1O4S A;  2WB6 A;  3VP6 A;  3NUB A;  1AKA A;  4KYO A;  1SZU A;  5IWQ A;  4XJL A;  5HDM A;  5C6U A;  4R5F A;  1O69 A;  5LH9 A;  3LVM A;  2BI5 A;  3QBO A;  1CZC A;  3FFR A;  2Z20 A;  3HLM A;  4J5U A;  3PD6 B;  2FNI A;  3ZRQ A;  4DBC A;  1MAQ A;  2HP2 A;  4ZDL A;  2D61 A;  2D64 A;  2HUF A;  3FZ8 A;  2VMU A;  2GSA A;  1VP4 A;  4AZJ A;  3MBB A;  1TOK A;  5G0A A;  3WY7 A;  1AAW A;  1W23 A;  1KMJ A;  2BKW A;  3JWB A;  3MAF B;  3QI6 A;  1ARG A;  4GDY A;  4ATP A;  2QSR A;  4F5F A;  5I92 A;  1DKA A;  3HL2 A;  2ZJG A;  3DXW A;  1TAR A;  1M32 A;  2W7F A;  4LNJ A;  2EYQ A;  4R8D A;  5E3K A;  1G7X A;  1ARI A;  2OGE A;  2VMY A;  1ASM A;  4ZLV A;  1DTY A;  2DKJ A;  3FFH A;  1AIC A;  1EJI A;  2JJE A;  2V1P A;  4GRX A;  2GB3 A;  3AEJ A;  4DQ6 A;  3FQ7 A;  1KL2 A;  4K2M A;  4W1V A;  2R0T A;  1WYU A;  3GR9 A;  4Q76 A;  4Q6R A;  1ASA A;  1AJR A;  1D7R A;  1M4N A;  2ORD A;  4ZDP A;  4A00 A;  3AEM A;  3QPG A;  1WYT B;  1BW0 A;  2AAT A;  1ELU A;  4XJM A;  3WCN A;  3CBF A;  1I41 A;  2CJH A;  3B46 A;  4RIT A;  1J04 A;  4K2I A;  4F5I A;  2BWO A;  1SFF A;  2DGK A;  3FVS A;  3ZRP A;  2AY4 A;  2AY8 A;  4N0W A;  3E2Y A;  3PIU A;  2VMR A;  2VIA A;  1W3U A;  1GDE A;  2ZC0 A;  3KGX A;  3RUY A;  3VAX A;  3WX9 A;  3NU7 A;  1CS1 A;  2ZUK A;  1AMQ A;  2VLF A;  3N5M A;  1AJS B;  2HOY A;  2HUI A;  3OP7 A;  3PDB B;  4BA4 A;  1I48 A;  5AX8 A;  3JU7 A;  3EI9 A;  3K40 A;  2R5C A;  4HVK A;  5G4J A;  2OQX A;  4WYG A;  3RQ1 A;  3FD0 A;  1IX7 A;  1YJY A;  3B8X A;  2WK9 A;  4H51 A;  3ZZJ A;  4HF8 A;  4WYC A;  1YAA A;  4MQP A;  4WXF A;  5E5I A;  4ZWM A;  2VMV A;  3MAF A;  3FVX A;  4JEX A;  1S07 A;  3UAK A;  4RAE A;  2W8V A;  1T3I A;  2PB2 A;  4JE5 D;  4PIW A;  3CQ6 A;  5FT8 A;  1DJ9 A;  3LG0 A;  1AKC A;  4FL0 A;  1IBJ A;  3NUI A;  1H0C A;  2AEV A;  2TPL A;  3NNK A;  1B9H A;  5DJ1 A;  3NYT A;  1TPL A;  3AEN A;  2BI2 A;  3KE3 A;  3A9Z A;  1MDZ A;  3FSL A;  3AOV A;  1BS0 A;  2ZY3 A;  2YCP A;  4N0B A;  2VMO A;  3H9X A;  3ZZK A;  1ELQ A;  3RBF A;  1BJN A;  1DGD A;  2X3L A;  3G7Q A;  3E2Z A;  3EIA A;  3P6K A;  1IVR A;  3FQA A;  3F9T A;  4UHO A;  2AY2 A;  3R9A A;  1MLZ A;  4MY5 A;  1M0Q A;  3GZD A;  4LNM A;  2KFP A;  3PPL A;  1UKJ A;  3WGB A;  5M4D A;  3AV7 A;  1BT4 A;  2BYL A;  4XEW A;  1VEF A;  1UU1 A;  4OCA A;  4IXO A;  2EPJ A;  2AY6 A;  1ZOB A;  1GD9 A;  1ASD A;  2DR1 A;  4Q31 A;  4F5H A;  2ZY4 A;  4EB7 A;  2C0R A;  1M7Y A;  3AEN B;  2W7L A;  3DU4 A;  3HDO A;  3QN6 A;  1M0O A;  1WST A;  4GEB A;  4RKD A;  2EGY A;  1X2A A;  1FG3 A;  4RKC A;  4IX8 A;  1Z3Z A;  4E77 A;  1M0N A;  4AOA A;  2QLR A;  2W8J A;  5JAY A;  3NRA A;  2FN6 A;  4A72 A;  4AO4 A;  2R2N A;  4U1T A;  4A0R A;  3A2B A;  1SVV A;  2YRR A;  1ASE A;  1BKG A;  2O0R A;  4XAU A;  1PMO A;  1W7M A;  3ASB A;  1V2D A;  4ZSW A;  1CQ7 A;  1IAY A;  5DJ9 A;  2DGL A;  3NTJ A;  5K8B A;  3E9K A;  4WYA A;  1ARS A;  1C7G A;  2JIS A;  4EU1 A;  4M2K A;  4WXG A;  3L44 A;  3PDB A;  3Q8N A;  3DYD A;  4E1O A;  1AJS A;  4F5J A;  1G4V A;  1LK9 A;  1QZ9 A;  2AY3 A;  1FC4 A;  3BV0 A;  1CQ8 A;  3E6G A;  2VI8 A;  3I4J A;  4UQV A;  4ADD A;  4BMK A;  4M2M A;  1IX6 A;  2C81 A;  2ZY2 A;  2GMU A;  4WLJ A;  2W7D A;  3KGW A;  1S09 A;  1V72 A;  1WYV B;  4FFC A;  4BQ0 A;  1M0P A;  2D65 A;  3BWN A;  1OXP A;  4F5L A;  1TAT A;  4XK1 A;  3E77 A;  5EIG A;  4AH3 A;  3CAI A;  1XEY A;  1OHW A;  4W8I A;  3USF A;  2QBT A;  2XBN A;  4IXS A;  2CJG A;  3NU8 A;  2X8U A;  4GE9 A;  1X28 A;  2JG2 A;  2QMA A;  1OXO A;  3PAA A;  4NOG A;  2G6W A;  1DJU A;  2X5D A;  1MDX A;  1W7L A;  2YHK A;  3JW9 A;  2WK7 A;  4OBV A;  1N8P A;  1D7U A;  1AAM A;  1RV4 A;  1TOE A;  1QJ3 A;  4LW2 A;  1DGE A;  2DOU A;  1CJ0 A;  4ADB A;  5M4B A;  3EI7 A;  3K7Y A;  2HOR A;  3OKS A;  1YIY A;  1GC0 A;  1YIZ A;  2JGT A;  4CVQ A;  3WKS A;  3MAU A;  5EUE A;  3II0 A;  1AIB A;  2Z1Z A;  4MKJ A;  4OBU A;  1AHG A;  3N7N A;  1MLY A;  3DR7 A;  4MQQ A;  4O6Z A;  5D5S A;  1GEX A;  1KKP A;  1X0M A;  4R2N A;  4CXQ A;  4F4E A;  4A6R A;  5G2Q A;  3DXV A;  4EMY A;  3H14 A;  3RCH B;  1D7V A;  1DJE A;  1PFF A;  2E7I A;  3D6K A;  3HVY A;  4LNL A;  2NMP A;  3PA9 A;  5EFS A;  2VGW A;  2W8W A;  2D63 A;  4P3M A;  1N31 A;  3HQT A;  1QIT A;  1C0N A;  1ART A;  1RVU A;  3FZ6 A;  2OGA A;  5F8V A;  1B8G A;  1BJW A;  5E4Z A;  2CB1 A;  2Z9V A;  1C7N A;  4XQ2 A;  4ZSY A;  3ELE A;  3AEJ C;  3IF2 A;  2AY7 A;  4IYO A;  1YJS A;  5F9S A;  2ZP7 A;  2BWP A;  4WYD A;  3EI5 A;  1BJO B;  1I43 A;  2G7J A;  1ASL A;  1MDO A;  4PFN A;  2PO3 A;  4TV7 A;  2Z67 A;  1WYV A;  2E7J A;  2FYF A;  3VK2 A;  3WKR A;  1Y4I A;  9AAT A;  1FG7 A;  1WYT A;  4WYF A;  2PB0 A;  4ADC A;  2ZSL A;  1C9C A;  1V2E A;  2DGM A;  3AEL A;  4A0H A;  1GEY A;  2D66 A;  3G8M A;  4K2B A;  2VMQ A;  3A9X A;  4WYE A;  3AEP A;  4L0O A;  2W7I A;  3WCO A;  4GE7 A;  5G09 A;  2X5F A;  1ARH A;  1XI9 A;  3BS8 A;  1AKB A;  1LC8 A;  4OC9 A;  4ZDO A;  1QIR A;  2WK8 A;  4IW7 A;  1LKC A;  1PG8 A;  4MKK A;  4OYT A;  1KL1 A;  3PDX A;  1LW5 A;  1S0A A;  1AMS A;  1C7O A;  1GC2 A;  1SZK A;  4BA5 A;  2AEU A;  2ZSM A;  3TFT A;  4IY7 A;  1AMA A;  4U2H A;  1S06 A;  2YCT A;  3LY1 A;  1ORD A;  1UU0 A;  1AMR A;  3DC1 A;  4W5K A;  4ZAS A;  1I29 A;  4B9B A;  4ZM4 A;  2VMX A;  1IJI A;  2BYJ A;  1V2F A;  2FM1 A;  1H1C A;  3E2Z B;  3EZ1 A;  2GQN A;  4AZK A;  3AEO A;  3UWC A;  1RVY A;  2FQ6 A;  2FKI A;  1WKH A;  4RM1 A;  4LC3 A;  1SF2 A;  2CH2 A;  3AOW A;  3E2F A;  2OKJ A;  2YKY A;  3FVU A;  4M2J A;  1AX4 A;  1IAX A;  4KXK A;  4A0G A;  3NYS A;  1B4X A;  1OHY A;  2O7C A;  2CH1 A;  2Z9W A;  4WB0 A;  4A6T A;  2W7E A;  2Z9X A;  4Y0D A;  4JEV A;  3I5T A;  3P1T A;  4CBR A;  1AY5 A;  3MC6 C;  1YJZ A;  5FT6 A;  4XJP A;  3VOM A;  4GSA A;  1JF9 A;  3LVL B;  3F0H A;  1DFO A;  1CL1 A;  1J32 A;  3CQ5 A;  4ISY A;  3RBL A;  1TAS A;  3NYU A;  3M5U A;  4CXR A;  3GZD C;  2BI9 A;  1QJ5 A;  3N75 A;  5BJ4 A;  2ZY5 A;  1LC5 A;  5TF5 A;  1B5O A;  2VMP A;  3BWN C;  5EAV A;  3BCA A;  4A6U A;  1ASF A;  4E3Q A;  4W1X A;  5HHY A;  5DX5 A;  1GBN A;  4W1W A;  3HMU A;  2YKV A;  5G4I A;  3T32 A;  2Q7W A;  2VI9 A;  1GCK A;  2FNU A;  4F5M A;  3FTB A;  4F5G A;  3PD6 A;  2D5Y A;  1KMK A;  1WYU B;  4RJY A;  2QB2 A;  1TOG A;  2YKU A;  2W7G A;  1O62 A;  2HOZ A;  2OKK A;  4XJO A;  1JG8 A;  4F5K A;  4WD2 A;  3ATH A;  3WGC A;  3N0L A;  1X29 A;  3FDB A;  1AHX A;  4BHD A;  1LC7 A;  3BCB A;  2JJF A;  3JZL A;  1AHE A;  2CAN A;  3FDD A;  1CZE A;  1W7N A;  2BIG A;  3RI6 A;  2E7U A;  4EB5 A;  4I8A A;  4IXZ A;  2R5E A;  1O61 A;  4E3R A;  1SZS A;  4R5Z A;  2WKA A;  3GWP A;  2VMZ A;  3A8U X;  2VGU A;  1S08 A;  4PVF A;  2CFB A;  2W8U A;  2ZYJ A;  4JE5 A;  3H7F A;  4UHM A;  3N4R A;  3AEM C;  1YNU A;  3NDN A;  3IHJ A;  3TAT A;  1ECX A;  2E54 A;  4AO9 A;  1TOI A;  2VMS A;  3A9Y A;  3EUC A;  4QGR A;  4TMR A;  1YOO A;  2C44 A;  2AY5 A;  4OMA A;  2BIE A;  2C7T A;  2HUU A;  3GSB A;  1ASC A;  5DB5 A;  4UHN A;  1QGN A;  2W8T A;  4WXB A;  1CL2 A;  1TOJ A;  3TCM A;  2DKB A;  1GEW A;  1KKJ A;  1D7S A;  1GC3 A;  2QB3 A;  4ZAH A;  2VMN A;  2BI1 A;  2JJG A;  4MGR A;  4Q75 A;  5EUN A;  2QA3 A;  2CJD A;  4WP0 A;  2R5C B;  2W7J A;  3MEB A;  1ASN A;  5LHA A;  2VMW A;  3MC6 A;  1U08 A;  2OAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...