3MC6A

Crystal structure of scdpl1
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
449
structure length
425
Chain Sequence
QLMNFPQLPSNGIPQDDVIEELNKLNDLIPHTQWKEGKVSGAVYHGGDDLIHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSDTGCGTTTSGGTESLLLACLSAKMYALHHRGITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNTVLLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKNLPLLDFRVPGVTSISCDTHYGFAPKGSSVIMYRNSDLRMHQYYVNPAWTGGLYGSPTLAGSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLDIMGNPRYSVISFSSKTLNIHELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEICDILRTTVQELKSEGVADKLIVGFLDALYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Function of Sphingosine-1-Phosphate Lyase, a Key Enzyme of Sphingolipid Metabolism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Lyase
molecule keywords Sphingosine-1-phosphate lyase
total genus 113
structure length 425
sequence length 449
ec nomenclature ec 4.1.2.27: Sphinganine-1-phosphate aldolase.
pdb deposition date 2010-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3mc6A03
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3mc6A02
3E77A 3FZ7A 3PDBA 1SZSA 3AEPA 4W1VA 4U2HA 3BCBA 1B5OA 2GSAA 2YKUA 1JG8A 1V72A 1MDOA 4ITXA 3II0A 4M2JA 1ASDA 2YRIA 4WYEA 4OT8A 1D7UA 1G7WA 3QI6A 2VMNA 5IWQA 3NX3A 2Z1ZA 1CQ6A 5I92A 3FTBA 1ZC9A 2ZJGA 4Y0HA 3VP6A 4W1XA 2AATA 1ASAA 1O61A 1LK9A 3WX9A 3LVKA 1G7XA 3CQ5A 4AH3A 4Q76A 2D64A 2Z9WA 1VP4A 4R2NA 1QIRA 4B9BA 4JEXA 1FC4A 2QA3A 3FZ6A 2XBNA 3RBLA 4I8AA 1SFFA 2WKAA 1LS3A 4JEWA 4TV7A 1Z3ZA 2OQXA 4XJLA 1N31A 2VMRA 2NMPA 3GR9A 4OYTA 3RCHA 3BWNC 2BWNA 3BB8A 3FVXA 1WSTA 2C7TA 3BS8A 4O6ZA 4BQ0A 1MDXA 2AY2A 1JF9A 4Q6RA 4EB7A 8AATA 1LC8A 2F8JA 4P7YA 4MQQA 4XJPA 1O4SA 1SZUA 1TPLA 4XQ2A 3D6KA 1AMQA 1ORDA 2D65A 4RAEA 1MGVA 2CH2A 1QITA 1CZEA 1C7GA 3FFHA 3MEBA 4Q31A 2ZP7A 1ARIA 3EI7A 5EIGB 1M4NA 1RVUA 2ZY4A 1LC7A 5EAAA 3BV0A 1YNUA 1P3WA 1YOOA 3VOMA 4AO9A 3I16A 4IXSA 1IVRA 2CTZA 2D61A 1N8PA 2W7KA 4GE4A 4Y0DA 4N0WA 4UHNA 2DR1A 2QMAA 4WXFA 4E1OA 3COGA 3MKJA 3PIUA 1MAQA 2ORDA 2BIEA 1GEWA 2TPLA 2VLFA 3G8MA 1QGNA 2HOXA 1GC3A 4JF1A 4EB5A 4XJOA 3ZZJA 2AEUA 4F5GA 1DTYA 4ATPA 5HHYA 1S07A 1UU2A 3FFRA 1S08A 1B9IA 3NU8A 3AEJC 3CQ4A 4LNMA 5DX5A 4HF8A 2DGKA 3E9KA 2AY3A 3G0TA 1J04A 1GDEA 3L8AA 2BI1A 2VMUA 1TASA 2W7MA 4CVQA 3GZDA 2D5YA 3ASBA 3EZ1A 3WCNA 5D5SA 2BWOA 3BWNA 3E2YA 2GQNA 1QJ5A 3B1DA 5E4ZA 1PMOA 4IX8A 1CQ7A 1KKJA 2HP2A 3UE8A 5E5IA 5EUEA 4PFFA 2D7YA 5G4JA 3NYSA 3DXVA 4WBTA 1AIAA 3GZCA 5EFSA 4HVKA 4AZKA 2W7HA 1GD9A 1B8GA 4WYCA 5J8QA 2R5CB 3QBOA 4H51A 1BKGA 3JU7A 5G2QA 2AY8A 3ZRRA 4J8LA 3DXWA 2G6WA 1TOIA 2HUIA 3LWSA 2V1PA 5F8VA 2VGZA 2BIGA 4WYFA 3WY7A 4Q75A 1YJSA 1X0MA 4ISYA 2VGUA 3H7FA 3UAKA 4UHMA 2O0RA 3EUCA 2W7IA 3WGBA 1CJ0A 3WCOA 2Z9XA 3AOVA 2JG2A 2PB2A 3GJUA 3PGYA 2E7IA 4GE9A 4IYOB 1FG7A 1S06A 3HLMA 2CINA 3FVUA 2HUFA 4IXZA 3F6TA 3USFA 2ZSLA 2VIBA 3ZRPA 1S0AA 3HT4A 1GBNA 2BI5A 1ECXA 4F5LA 3NTJA 2AY7A 1WYUA 3RBFA 3VK3A 1DJEA 1GEYA 3PA9A 3NNKA 3UWCA 5BJ3A 1YJZA 4JF0A 1AHGA 2JJEA 1GC2A 2O1BA 2VMTA 2VMYA 3QPGA 5C6UA 1MLYA 3JW9A 1V2DA 2Z1YA 2YRRA 3NUIA 2AY6A 4LW2A 1AAMA 1AICA 2DKBA 1G4XA 3PD6B 4PVFA 4F5JA 2HUUA 1BJNA 1WYVA 4WB0B 4OTLA 1WKGA 1X28A 1YIYA 3NDNA 2JJHA 1AMAA 4W8IA 5FT4A 2PO3A 4ZM4A 3ELEA 3R9AA 5HXXA 2HZPA 3N5MA 4GDYA 3FDDA 1SPAA 4U1TA 1SF2A 1RV3A 2FN6A 1DFOA 1M0NA 1YJYA 2VMVA 3F0HA 3KGXA 2W8TA 2OKJA 4OBUA 1ASEA 5LH9A 2GMSA 4A0FA 2AY4A 4A72A 2JJGA 4GEBA 3CQ6A 3K40A 1QISA 1IX8A 4UQVA 4AZJA 2CJHA 3KKIA 4B98A 2WK9A 1UU1A 2FQ6A 4IW7A 5EUDA 5BJ4A 4ZSYA 1OHWA 1BJ4A 3HMUA 3IHJA 1IX6A 3K7YA 1IAXA 4GRXA 3OKSA 1OHVA 2DOUA 5G0AA 1YIZA 4CBSA 1OHYA 2XH1A 4LNJA 1X2AA 5G2PA 1H1CA 2EH6A 1KL2A 5M49A 2VMSA 1W7LA 2ZUKA 3LY1A 3MBBA 3WKSA 1BT4A 4F5HA 2YCPA 2Q7WA 3GSBA 1ARTA 1MLZA 2JISA 2C44A 4AO4A 1IUGA 3AENA 3JWBA 3PPLA 2W8JA 2Z61A 2W7DA 3HDOA 1RV4A 1LW4A 4A00A 2HP1A 3FCRA 3WGCA 4QGRA 3T32A 3TCMA 2EZ2A 3TATA 1LKCA 1PFFA 3GWPA 3MC6A 1S09A 2D66A 2D63A 4RKDA 5EQCA 4EFFA 1M0OA 1VJOA 4ADCA 4CXQA 3RUYA 4ATQA 3BC8A 1AIBA 1AY8A 4WLHA 2BI9A 2PB0A 4MQPA 2VMOA 4RLGA 4A6TA 1EQBA 1TOGA 4ZDLA 1ASGA 2OATA 3BN1A 3G7QA 1ARSA 3ECDA 3EIBA 2W7FA 1PG8A 3CAIA 3QM2A 4WB0A 2BYLA 3FKDA 2V0YA 3M5UA 3FDBA 4JEZA 5G4IA 1GC0A 4ZWVA 2YHKA 4PIWA 2QLRA 4L0OA 1CQ8A 4ZSWA 4TMRA 1C7OA 2YOBA 2X5FA 4RJYA 1ZOBA 3QGUA 3N0LA 2BKWA 3DRDA 3GETA 3W1IA 2VI9A 2FNIA 3MADA 2YCTA 2DGMA 2ZC0A 2C81A 4E3QA 1BS0A 1PMMA 3I5TA 3ZRQA 1EG5A 3MAFB 4MSOA 3ATHA 3EIAA 3R4TA 1WYTA 2EZ1A 4F5FA 1AKCA 1ASCA 3E6GA 4IYOA 2ZY5A 1E5EA 3ELPA 2ZYJA 2VI8A 4CXRA 5FT8A 1RVYA 1H0CA 2E7UA 3H14A 1GCKA 4ADEA 1AY4A 1Y4IA 2JGTA 2VMWA 3P6KA 1D7VA 1OATA 2R0TA 4BMKA 4ZWMA 4M2MA 4EMYA 3W1JA 3N75A 4GE7A 3QHXA 4M2KA 4F5MA 4WXGA 4WXBA 3A9YA 2AY5A 4UHOA 2VGVA 5TF5A 4ZM3A 3AELA 1W23A 4UOYA 4DGTA 2E54A 4ITGA 3LG0A 4ZDOA 3I4JA 4ZAHA 5FT6A 1WYVB 4J5UA 1YAAA 4MQRA 3RI6A 3FSLA 1EJIA 2YCNA 2AY9A 4R5FA 1E5FA 3L44A 1C9CA 3FVSA 4WYAA 1CL2A 2HOYA 5D95A 2VMXA 4LW4A 4WD2A 2W7LA 5DJ1A 1AJRA 4MGRA 3W1HA 1B4XA 1JS6A 5K8BA 2WK7A 3DR4A 4A0HA 4XK1A 4XAUA 2R5EA 5HDMA 1Z7DA 3AV7A 1MAPA 4FFCA 4MKJA 5JAYA 1LC5A 3PDBB 4MY5A 3JTXA 3P1TA 3EI5A 3DODA 2X5DA 1WYTB 2HOZA 3K28A 2GB3A 1BQDA 3TQXA 2CY8A 1GC4A 4W91A 3HVYA 1ELUA 1SZKA 4N0BA 1T3IA 2W7GA 1UKJA 2QBTA 2VGWA 3F9TA 1V2EA 3LVLB 3WZFA 1KL1A 1AKAA 1ZODA 2BI2A 4KXKA 2CFBA 2Z9UA 1BJOB 5EAVA 1AHYA 2OGEA 3BCAA 2VGTA 3WKRA 2X3LA 3GZDC 2VMPA 2JJFA 3DR7A 1AMRA 4K2BA 4A6UA 1AY5A 4F5KA 1I43A 1I41A 1CL1A 2CH1A 2Z67A 3AENB 2ZY2A 4NOGA 4OBVA 4ADDA 1AHFA 2AEVA 4FL0A 4GSAA 5E3KA 1XEYA 2BWPA 2EO5A 3DZZA 5M4BA 1AMSA 2R5CA 2QB3A 3AEJA 4XEWA 5EUNA 4ZLVA 4JE5D 1TOEA 3AOWA 2BHXA 1IJIA 1W7MA 4JE5A 5DB5A 5EIGA 1O62A 3JWAA 3OP7A 1AJSA 3PJ0A 4E77A 3LVJA 1W3UA 4A6RA 2YKVA 1ASBA 3NUBA 3A9ZA 1J32A 1DKAA 1OXOA 3EZSA 1FG3A 2VIAA 3A8UX 4JEVA 3TFUA 3NRAA 1G4VA 3FZ8A 3A2BA 1DJ9A 4F4EA 2CSTA 2FM1A 4OC9A 2CJDA 3A9XA 7AATA 1WKHA 1TOJA 3RCHB 1AHXA 4CBRA 1W7NA 2R2NA 3ZZKA 1M6SA 1ASMA 1ASLA 1B5PA 5F9SA 2W8WA 1KMKA 3EI6A 1AHEA 2YKXA 4R5ZA 5FT5A 4XJMA 1D7SA 1GEXA 1MDZA 2VLHA 4A0GA 3AEMA 2OKKA 4W1WA 4LC3A 1ASFA 1U08A 4WP0A 3B46A 2D7ZA 2ZSMA 4E3RA 4RJ0A 4WYDA 2VGSA 3DYDA 1BJWA 4Y0IA 1O69A 1DGEA 3ACZA 5AX8A 2CB1A 2FYFA 9AATA 3B1CA 1DGDA 1BJOA 4IXOA 1VEFA 3KE3A 3E2ZB 3FQ7A 2AY1A 1AX4A 1C7NA 3NU7A 1KKPA 3B1EA 1WYUB 3BCXA 4P3MA 1D2FA 2YKYA 3AEOA 1ARHA 3VK4A 3NYUA 4K2MA 4K2IA 1TOKA 2DGLA 1CS1A 3VK2A 2BIAA 3DC1A 3PD6A 4JEYA 4PFNA 1QZ9A 2C0RA 3E2ZA 3B8XA 2CJGA 4DBCA 4AOAA 4W5KA 1BQAA 2VMQA 3RQ1A 3PAAA 2W7JA 4RITA 3WLXA 2BYJA 1C0NA 4F5IA 4WLJA 1V2FA 3CBFA 4BA5A 2RFVA 2OGAA 2BI3A 3FD0A 1CZCA 4KAMA 4OMAA 3BWOA 2X8UA 3LVMA 2CANA 3GBXA 3EI9A 4RIZA 1OXPA 1JS3A 2EGYA 3FQ8A 4RM1A 3E2FA 2W7EA 1M7YA 1IX7A 1N2TA 2EPJA 3DU4A 3HQTA 1UU0A 3LV2A 4MKKA 4EU1A 1AAWA 4OCAA 5M4DA 1IAYA 4A0RA 1X29A 1ASNA 3ISLA 1C4KA 3IF2A 3HBXA 4BA4A 1I29A 1IBJA 3QN6A 3PDXA 3AEMC 1XI9A 1AKBA 1M32A 1KMJA 1I48A 3Q8NA 3NYTA 2ZY3A 2E7JA 2HORA 4ZDPA 4R8DA 3TFTA 1DJUA 2Z9VA 2W8UA 2QB2A 1SVVA 2FNUA 1LW5A 5M46A 2Z20A 1BW0A 2O7CA 3FRKA 2GMUA 1AJSB 3MAUA 3HL2A 3MAFA 5G09A 4DQ6A 3KGWA 1B9HA 4ADBA 3VAXA 4LNLA 1TARA 1ELQA 1QJ3A 2W8VA 3MC6C 4KYOA 1D7RA 5LHAA 1M0QA 3EI8A 1M0PA 2DKJA 3AATA 3ASAA 4WYGA 4ZASA 2VMZA 1TATA 2VYCA 4IY7A 5DJ9A 3FQAA 3JZLA 4RKCA 4TN4A 4BHDA 1ARGA 2WK8A
chains in the Genus database with same CATH superfamily
3E77A 3FZ7A 3PDBA 2A1VA 1SZSA 3AEPA 4W1VA 4U2HA 3BCBA 1B5OA 2GSAA 2YKUA 1JG8A 1V72A 1MDOA 4ITXA 3II0A 4M2JA 1ASDA 2YRIA 4WYEA 4OT8A 1D7UA 1G7WA 3QI6A 2VMNA 5IWQA 3NX3A 2Z1ZA 1CQ6A 5I92A 3FTBA 1ZC9A 2ZJGA 4Y0HA 3VP6A 4W1XA 2AATA 1ASAA 1O61A 1LK9A 3WX9A 3LVKA 1G7XA 3CQ5A 4AH3A 4Q76A 2D64A 2Z9WA 1VP4A 4R2NA 1QIRA 4B9BA 4JEXA 1FC4A 2QA3A 3FZ6A 2XBNA 3RBLA 4I8AA 1SFFA 2WKAA 1LS3A 4JEWA 4TV7A 1Z3ZA 2OQXA 4XJLA 1N31A 2VMRA 2NMPA 3GR9A 4OYTA 3RCHA 1KAFA 3BWNC 2BWNA 2FKIA 3BB8A 3FVXA 1WSTA 2C7TA 3BS8A 4O6ZA 4BQ0A 1MDXA 2AY2A 1JF9A 4Q6RA 4EB7A 8AATA 1LC8A 2F8JA 4P7YA 4MQQA 4XJPA 1O4SA 1SZUA 1TPLA 4XQ2A 3D6KA 1AMQA 1ORDA 2D65A 4RAEA 1MGVA 2CH2A 1QITA 1CZEA 1C7GA 3FFHA 3MEBA 4Q31A 2ZP7A 1ARIA 3EI7A 5EIGB 1M4NA 1RVUA 2ZY4A 1LC7A 5EAAA 3BV0A 1YNUA 1P3WA 1YOOA 3VOMA 4AO9A 3I16A 4IXSA 1IVRA 2CTZA 2D61A 1N8PA 2W7KA 4GE4A 4Y0DA 4N0WA 3H9XA 4UHNA 2DR1A 2QMAA 4WXFA 4E1OA 3COGA 3MKJA 3PIUA 1MAQA 2ORDA 2BIEA 1GEWA 2TPLA 2VLFA 3G8MA 1QGNA 2HOXA 1GC3A 4JF1A 4EB5A 4XJOA 3ZZJA 2AEUA 4F5GA 1DTYA 4ATPA 5HHYA 1S07A 1UU2A 3FFRA 1S08A 1B9IA 3NU8A 3AEJC 3CQ4A 4LNMA 5DX5A 4HF8A 2DGKA 3E9KA 2AY3A 2EYQA 2WB6A 3G0TA 1J04A 1GDEA 3L8AA 2BI1A 2VMUA 1TASA 2W7MA 4CVQA 3GZDA 2D5YA 3ASBA 3EZ1A 3WCNA 5D5SA 2BWOA 3BWNA 3E2YA 2GQNA 1QJ5A 3B1DA 5E4ZA 1PMOA 4IX8A 1CQ7A 1KKJA 2HP2A 3UE8A 5E5IA 5EUEA 4PFFA 2D7YA 5G4JA 3NYSA 3DXVA 4WBTA 1AIAA 3GZCA 5EFSA 4HVKA 4AZKA 2W7HA 1GD9A 1B8GA 4WYCA 5J8QA 2R5CB 3QBOA 4H51A 1BKGA 3JU7A 5G2QA 2AY8A 3ZRRA 4J8LA 3DXWA 2G6WA 1TOIA 2HUIA 3LWSA 2V1PA 5F8VA 2VGZA 2BIGA 4WYFA 3WY7A 4Q75A 1YJSA 1X0MA 4ISYA 2VGUA 3H7FA 3UAKA 4UHMA 2O0RA 3EUCA 2W7IA 3WGBA 1CJ0A 3WCOA 2Z9XA 3AOVA 2JG2A 2PB2A 3GJUA 3PGYA 2E7IA 4GE9A 4IYOB 1FG7A 1S06A 3HLMA 2CINA 3FVUA 2HUFA 4IXZA 3F6TA 3USFA 2ZSLA 2VIBA 3ZRPA 1S0AA 3HT4A 1GBNA 2BI5A 1ECXA 4F5LA 3NTJA 2AY7A 1WYUA 3RBFA 3VK3A 1DJEA 1GEYA 3PA9A 3NNKA 3UWCA 5BJ3A 1YJZA 4JF0A 1AHGA 2JJEA 1GC2A 2O1BA 2VMTA 2VMYA 3QPGA 5C6UA 1MLYA 3JW9A 1V2DA 2Z1YA 2YRRA 3NUIA 2AY6A 4LW2A 1AAMA 1AICA 2DKBA 1G4XA 3PD6B 4PVFA 4F5JA 2HUUA 1BJNA 1WYVA 4WB0B 4OTLA 1WKGA 1X28A 1YIYA 3NDNA 2JJHA 1AMAA 4W8IA 5FT4A 2PO3A 4ZM4A 3ELEA 3R9AA 5HXXA 2HZPA 3N5MA 4GDYA 3FDDA 1SPAA 4U1TA 1SF2A 1RV3A 2FN6A 1DFOA 1M0NA 1YJYA 2VMVA 3F0HA 3KGXA 2W8TA 2OKJA 4OBUA 1ASEA 5LH9A 2GMSA 4A0FA 2AY4A 4A72A 2JJGA 4GEBA 3CQ6A 3N4SA 3K40A 1QISA 1IX8A 4UQVA 4AZJA 2CJHA 3KKIA 4B98A 2WK9A 1UU1A 2FQ6A 4IW7A 5EUDA 5BJ4A 4ZSYA 2G7JA 1OHWA 1BJ4A 3HMUA 3IHJA 1IX6A 3K7YA 1IAXA 4GRXA 3OKSA 1OHVA 2DOUA 5G0AA 1YIZA 4CBSA 1OHYA 2XH1A 4LNJA 1X2AA 5G2PA 1H1CA 2EH6A 1KL2A 5M49A 2VMSA 1W7LA 2ZUKA 3LY1A 3MBBA 3WKSA 1BT4A 4F5HA 2YCPA 2Q7WA 3GSBA 1ARTA 1MLZA 2JISA 2C44A 4AO4A 1IUGA 3AENA 3JWBA 3PPLA 2W8JA 2Z61A 2W7DA 3HDOA 1RV4A 1LW4A 4A00A 2HP1A 3FCRA 3WGCA 4QGRA 3T32A 3TCMA 2EZ2A 3N7NA 3TATA 1LKCA 1PFFA 3GWPA 3MC6A 1S09A 2D66A 2D63A 4RKDA 5EQCA 4EFFA 1M0OA 1VJOA 4ADCA 4CXQA 3RUYA 4ATQA 3BC8A 1AIBA 1AY8A 4WLHA 2BI9A 2PB0A 4MQPA 2VMOA 4RLGA 4A6TA 1EQBA 1TOGA 4ZDLA 1ASGA 2OATA 3BN1A 3G7QA 1ARSA 3ECDA 3EIBA 2W7FA 1PG8A 3CAIA 3QM2A 4WB0A 2BYLA 3FKDA 2V0YA 3M5UA 3FDBA 4JEZA 5G4IA 1GC0A 4ZWVA 2YHKA 4PIWA 2QLRA 4L0OA 1CQ8A 4ZSWA 4TMRA 1C7OA 2YOBA 2X5FA 4RJYA 1ZOBA 3QGUA 3N0LA 2BKWA 3DRDA 3GETA 3W1IA 2VI9A 2FNIA 3MADA 2YCTA 2DGMA 2ZC0A 2C81A 4E3QA 1BS0A 1PMMA 3I5TA 3ZRQA 1EG5A 3MAFB 4MSOA 3ATHA 3EIAA 3R4TA 1WYTA 2EZ1A 4F5FA 1AKCA 1ASCA 3E6GA 4IYOA 2ZY5A 4K05A 1E5EA 3ELPA 2ZYJA 2VI8A 4CXRA 5FT8A 1RVYA 1H0CA 2E7UA 3H14A 1GCKA 3N4XA 4ADEA 1AY4A 1Y4IA 2JGTA 2VMWA 3P6KA 1D7VA 1OATA 2R0TA 4BMKA 4ZWMA 4M2MA 4EMYA 3W1JA 3N75A 4GE7A 3QHXA 4M2KA 4F5MA 4WXGA 4WXBA 3A9YA 2AY5A 4UHOA 2VGVA 5TF5A 4ZM3A 3AELA 1W23A 4UOYA 4DGTA 2E54A 4ITGA 3LG0A 4ZDOA 3I4JA 4ZAHA 5FT6A 1WYVB 4J5UA 1YAAA 4MQRA 3RI6A 3FSLA 1EJIA 2YCNA 2AY9A 4R5FA 1E5FA 3L44A 1C9CA 3FVSA 5KTBA 4WYAA 1CL2A 2HOYA 5D95A 2VMXA 4LW4A 4WD2A 2W7LA 5DJ1A 1AJRA 4MGRA 3W1HA 1B4XA 1JS6A 5K8BA 2WK7A 3DR4A 4A0HA 4XK1A 4XAUA 2R5EA 5HDMA 1Z7DA 3AV7A 1MAPA 4FFCA 4MKJA 5JAYA 1LC5A 3PDBB 4MY5A 3JTXA 3P1TA 3EI5A 3DODA 2X5DA 1WYTB 2HOZA 3K28A 2GB3A 1BQDA 3TQXA 2CY8A 1GC4A 4W91A 3HVYA 1ELUA 1SZKA 4N0BA 1T3IA 2W7GA 1UKJA 2QBTA 2VGWA 3F9TA 1V2EA 3LVLB 3WZFA 1KL1A 2QSRA 1AKAA 1ZODA 2BI2A 4KXKA 2CFBA 2Z9UA 1BJOB 5EAVA 2KFPA 1AHYA 2OGEA 3BCAA 2VGTA 3WKRA 2X3LA 3GZDC 2VMPA 2JJFA 3DR7A 1AMRA 4K2BA 4A6UA 1AY5A 4F5KA 1I43A 1I41A 1CL1A 2CH1A 2Z67A 3AENB 2ZY2A 4NOGA 4OBVA 4ADDA 1AHFA 2AEVA 4FL0A 4GSAA 5E3KA 1XEYA 2BWPA 2EO5A 3DZZA 5M4BA 1AMSA 2R5CA 2QB3A 3AEJA 4XEWA 5EUNA 4ZLVA 4JE5D 1TOEA 3AOWA 2BHXA 1IJIA 1W7MA 4JE5A 5DB5A 5EIGA 1O62A 3JWAA 3OP7A 1AJSA 3PJ0A 4E77A 3LVJA 1W3UA 4A6RA 2YKVA 1ASBA 3NUBA 3A9ZA 1J32A 1DKAA 1OXOA 3EZSA 1FG3A 2VIAA 3A8UX 4JEVA 3TFUA 3NRAA 1G4VA 3FZ8A 3A2BA 1DJ9A 4F4EA 2CSTA 2FM1A 4OC9A 2CJDA 3A9XA 7AATA 1WKHA 1TOJA 3RCHB 1AHXA 4CBRA 1W7NA 2R2NA 3ZZKA 1M6SA 1ASMA 1ASLA 1B5PA 5F9SA 2W8WA 1KMKA 3EI6A 1AHEA 2YKXA 4R5ZA 5FT5A 4XJMA 1D7SA 1GEXA 1MDZA 2VLHA 4A0GA 3AEMA 2OKKA 4W1WA 4LC3A 1ASFA 1U08A 4WP0A 3B46A 2D7ZA 2ZSMA 4E3RA 4RJ0A 4WYDA 2VGSA 3DYDA 1BJWA 4Y0IA 1O69A 1DGEA 3ACZA 5AX8A 2CB1A 2FYFA 9AATA 3B1CA 1DGDA 1BJOA 4IXOA 1VEFA 3KE3A 3E2ZB 3FQ7A 2AY1A 1AX4A 1C7NA 3NU7A 1KKPA 3B1EA 1WYUB 3BCXA 4P3MA 1D2FA 2YKYA 3AEOA 1ARHA 3VK4A 3NYUA 4K2MA 4K2IA 3N4RA 1TOKA 2DGLA 1CS1A 3VK2A 2BIAA 3DC1A 3PD6A 4JEYA 4PFNA 1QZ9A 2C0RA 3E2ZA 3B8XA 2CJGA 4DBCA 4AOAA 4W5KA 1BQAA 2VMQA 3RQ1A 3PAAA 2W7JA 4RITA 3WLXA 2BYJA 1C0NA 4F5IA 4WLJA 1V2FA 3CBFA 4BA5A 2RFVA 2OGAA 2BI3A 3FD0A 1CZCA 4KAMA 4OMAA 3BWOA 2X8UA 3LVMA 2CANA 3GBXA 3EI9A 4RIZA 1OXPA 1JS3A 2EGYA 3FQ8A 4RM1A 3E2FA 2W7EA 1M7YA 1IX7A 1N2TA 2EPJA 3DU4A 3HQTA 1UU0A 3LV2A 4MKKA 4EU1A 1AAWA 4OCAA 5M4DA 1IAYA 4A0RA 1X29A 1ASNA 3ISLA 1C4KA 3IF2A 3HBXA 4BA4A 1I29A 1IBJA 3QN6A 3PDXA 3AEMC 1XI9A 1AKBA 1M32A 1KMJA 1I48A 3Q8NA 3NYTA 2ZY3A 2E7JA 2HORA 4ZDPA 4H63Q 4R8DA 3TFTA 1DJUA 2Z9VA 2W8UA 2QB2A 1SVVA 2FNUA 1LW5A 5M46A 2Z20A 1BW0A 2O7CA 3FRKA 2GMUA 1AJSB 3MAUA 3HL2A 3MAFA 5G09A 4DQ6A 3KGWA 1B9HA 4ADBA 3VAXA 4LNLA 1TARA 1ELQA 1QJ3A 2W8VA 3MC6C 4KYOA 1D7RA 5LHAA 1M0QA 3EI8A 1M0PA 2DKJA 3AATA 3ASAA 4WYGA 4ZASA 2VMZA 1TATA 2VYCA 4IY7A 5DJ9A 3FQAA 3JZLA 4RKCA 4TN4A 4BHDA 1ARGA 2WK8A
chains in the Genus database with same CATH topology
3E77A 3FZ7A 3PDBA 2A1VA 1SZSA 3AEPA 4W1VA 4U2HA 3BCBA 1B5OA 2GSAA 2YKUA 1JG8A 1V72A 1MDOA 4ITXA 3II0A 4M2JA 1ASDA 2YRIA 4WYEA 4OT8A 1D7UA 1G7WA 3QI6A 2VMNA 5IWQA 3NX3A 2Z1ZA 1CQ6A 5I92A 3FTBA 1ZC9A 2ZJGA 4Y0HA 3VP6A 4W1XA 2AATA 1ASAA 1O61A 1LK9A 3WX9A 3LVKA 1G7XA 3CQ5A 4AH3A 4Q76A 2D64A 2Z9WA 1VP4A 4R2NA 1QIRA 4B9BA 4JEXA 1FC4A 2QA3A 3FZ6A 2XBNA 3RBLA 4I8AA 1SFFA 2WKAA 1LS3A 4JEWA 4TV7A 1Z3ZA 2OQXA 4XJLA 1N31A 2VMRA 2NMPA 3GR9A 4OYTA 3RCHA 3BWNC 2BWNA 2FKIA 3BB8A 3FVXA 1WSTA 2C7TA 3BS8A 4O6ZA 4BQ0A 1MDXA 2AY2A 1JF9A 4Q6RA 4EB7A 8AATA 1LC8A 2F8JA 4P7YA 4MQQA 4XJPA 1O4SA 1SZUA 1TPLA 4XQ2A 3D6KA 1AMQA 1ORDA 2D65A 4RAEA 1MGVA 2CH2A 1QITA 1CZEA 1C7GA 3FFHA 3MEBA 4Q31A 2ZP7A 1ARIA 3EI7A 5EIGB 1M4NA 1RVUA 2ZY4A 1LC7A 5EAAA 3BV0A 1YNUA 1P3WA 1YOOA 3VOMA 4AO9A 3I16A 4IXSA 1IVRA 2CTZA 2D61A 1N8PA 2W7KA 4GE4A 4Y0DA 4N0WA 3H9XA 4UHNA 2DR1A 2QMAA 4WXFA 4E1OA 3COGA 3MKJA 3PIUA 1MAQA 2ORDA 2BIEA 1GEWA 2TPLA 2VLFA 3G8MA 1QGNA 2HOXA 1GC3A 4JF1A 4EB5A 4XJOA 3ZZJA 2AEUA 4F5GA 1DTYA 4ATPA 5HHYA 1S07A 1UU2A 3FFRA 1S08A 1B9IA 3NU8A 3AEJC 3CQ4A 4LNMA 5DX5A 4HF8A 2DGKA 3E9KA 2AY3A 2EYQA 2WB6A 3G0TA 1J04A 1GDEA 3L8AA 2BI1A 2VMUA 1TASA 2W7MA 4CVQA 3GZDA 2D5YA 3ASBA 3EZ1A 3WCNA 5D5SA 2BWOA 3BWNA 3E2YA 2GQNA 1QJ5A 3B1DA 5E4ZA 1PMOA 4IX8A 1CQ7A 1KKJA 2HP2A 3UE8A 5E5IA 5EUEA 4PFFA 2D7YA 5G4JA 3NYSA 3DXVA 4WBTA 1AIAA 3GZCA 5EFSA 4HVKA 4AZKA 2W7HA 1GD9A 1B8GA 4WYCA 5J8QA 2R5CB 3QBOA 4H51A 1BKGA 3JU7A 5G2QA 2AY8A 3ZRRA 4J8LA 3DXWA 2G6WA 1TOIA 2HUIA 3LWSA 2V1PA 5F8VA 2VGZA 2BIGA 4WYFA 3WY7A 4Q75A 1YJSA 1X0MA 4ISYA 2VGUA 3H7FA 3UAKA 4UHMA 2O0RA 3EUCA 2W7IA 3WGBA 1CJ0A 3WCOA 2Z9XA 3AOVA 2JG2A 2PB2A 3GJUA 3PGYA 2E7IA 4GE9A 4IYOB 1FG7A 1S06A 3HLMA 2CINA 3FVUA 2HUFA 4IXZA 3F6TA 3USFA 2ZSLA 2VIBA 3ZRPA 1S0AA 3HT4A 1GBNA 2BI5A 1ECXA 4F5LA 3NTJA 2AY7A 1WYUA 3RBFA 3VK3A 1DJEA 1GEYA 3PA9A 3NNKA 3UWCA 5BJ3A 1YJZA 4JF0A 1AHGA 2JJEA 1GC2A 2O1BA 2VMTA 2VMYA 3QPGA 5C6UA 1MLYA 3JW9A 1V2DA 2Z1YA 2YRRA 3NUIA 2AY6A 4LW2A 1AAMA 1AICA 2DKBA 1G4XA 3PD6B 4PVFA 4F5JA 2HUUA 1BJNA 1WYVA 4WB0B 4OTLA 1WKGA 1X28A 1YIYA 3NDNA 2JJHA 1AMAA 4W8IA 5FT4A 2PO3A 4ZM4A 3ELEA 3R9AA 5HXXA 2HZPA 3N5MA 4GDYA 3FDDA 1SPAA 4U1TA 1SF2A 1RV3A 2FN6A 1DFOA 1M0NA 1YJYA 2VMVA 3F0HA 3KGXA 2W8TA 2OKJA 4OBUA 1ASEA 5LH9A 2GMSA 4A0FA 2AY4A 4A72A 2JJGA 4GEBA 3CQ6A 3N4SA 3K40A 1QISA 1IX8A 4UQVA 4AZJA 2CJHA 3KKIA 4B98A 2WK9A 1UU1A 2FQ6A 4IW7A 5EUDA 5BJ4A 4ZSYA 2G7JA 1OHWA 1BJ4A 3HMUA 3IHJA 1IX6A 3K7YA 1IAXA 4GRXA 3OKSA 1OHVA 2DOUA 5G0AA 1YIZA 4CBSA 1OHYA 2XH1A 4LNJA 1X2AA 5G2PA 1H1CA 2EH6A 1KL2A 5M49A 2VMSA 1W7LA 2ZUKA 3LY1A 3MBBA 3WKSA 1BT4A 4F5HA 2YCPA 2Q7WA 3GSBA 1ARTA 1MLZA 2JISA 2C44A 4AO4A 1IUGA 3AENA 3JWBA 3PPLA 2W8JA 2Z61A 2W7DA 3HDOA 1RV4A 1LW4A 4A00A 2HP1A 3FCRA 3WGCA 4QGRA 3T32A 3TCMA 2EZ2A 3N7NA 3TATA 1LKCA 1PFFA 3GWPA 3MC6A 1S09A 2D66A 2D63A 4RKDA 5EQCA 4EFFA 1M0OA 1VJOA 4ADCA 4CXQA 3RUYA 4ATQA 3BC8A 1AIBA 1AY8A 4WLHA 2BI9A 2PB0A 4MQPA 2VMOA 4RLGA 4A6TA 1EQBA 1TOGA 4ZDLA 1ASGA 2OATA 3BN1A 3G7QA 1ARSA 3ECDA 3EIBA 2W7FA 1PG8A 3CAIA 3QM2A 4WB0A 2BYLA 3FKDA 2V0YA 3M5UA 3FDBA 4JEZA 5G4IA 1GC0A 4ZWVA 2YHKA 4PIWA 2QLRA 4L0OA 1CQ8A 4ZSWA 4TMRA 1C7OA 2YOBA 2X5FA 4RJYA 1ZOBA 3QGUA 3N0LA 2BKWA 3DRDA 3GETA 3W1IA 2VI9A 2FNIA 3MADA 2YCTA 2DGMA 2ZC0A 2C81A 4E3QA 1BS0A 1PMMA 3I5TA 3ZRQA 1EG5A 3MAFB 4MSOA 3ATHA 3EIAA 3R4TA 1WYTA 2EZ1A 4F5FA 1AKCA 1ASCA 3E6GA 4IYOA 2ZY5A 4K05A 1E5EA 3ELPA 2ZYJA 2VI8A 4CXRA 5FT8A 1RVYA 1H0CA 2E7UA 3H14A 1GCKA 3N4XA 4ADEA 1AY4A 1Y4IA 2JGTA 2VMWA 3P6KA 1D7VA 1OATA 2R0TA 4BMKA 4ZWMA 4M2MA 4EMYA 3W1JA 3N75A 4GE7A 3QHXA 4M2KA 4F5MA 4WXGA 4WXBA 3A9YA 2AY5A 4UHOA 2VGVA 5TF5A 4ZM3A 3AELA 1W23A 4UOYA 4DGTA 2E54A 4ITGA 3LG0A 4ZDOA 3I4JA 4ZAHA 5FT6A 1WYVB 4J5UA 1YAAA 4MQRA 3RI6A 3FSLA 1EJIA 2YCNA 2AY9A 4R5FA 1E5FA 3L44A 1C9CA 3FVSA 5KTBA 4WYAA 1CL2A 2HOYA 5D95A 2VMXA 4LW4A 4WD2A 2W7LA 5DJ1A 1AJRA 4MGRA 3W1HA 1B4XA 1JS6A 5K8BA 2WK7A 3DR4A 4A0HA 4XK1A 4XAUA 2R5EA 5HDMA 1Z7DA 3AV7A 1MAPA 4FFCA 4MKJA 5JAYA 1LC5A 3PDBB 4MY5A 3JTXA 3P1TA 3EI5A 3DODA 2X5DA 1WYTB 2HOZA 3K28A 2GB3A 1BQDA 3TQXA 2CY8A 1GC4A 4W91A 3HVYA 1ELUA 1SZKA 4N0BA 1T3IA 2W7GA 1UKJA 2QBTA 2VGWA 3F9TA 1V2EA 3LVLB 3WZFA 1KL1A 2QSRA 1AKAA 1ZODA 2BI2A 4KXKA 2CFBA 2Z9UA 1BJOB 5EAVA 2KFPA 1AHYA 2OGEA 3BCAA 2VGTA 3WKRA 2X3LA 3GZDC 2VMPA 2JJFA 3DR7A 1AMRA 4K2BA 4A6UA 1AY5A 4F5KA 1I43A 1I41A 1CL1A 2CH1A 2Z67A 3AENB 2ZY2A 4NOGA 4OBVA 4ADDA 1AHFA 2AEVA 4FL0A 4GSAA 5E3KA 1XEYA 2BWPA 2EO5A 3DZZA 5M4BA 1AMSA 2R5CA 2QB3A 3AEJA 4XEWA 5EUNA 4ZLVA 4JE5D 1TOEA 3AOWA 2BHXA 1IJIA 1W7MA 4JE5A 5DB5A 5EIGA 1O62A 3JWAA 3OP7A 1AJSA 3PJ0A 4E77A 3LVJA 1W3UA 4A6RA 2YKVA 1ASBA 3NUBA 3A9ZA 1J32A 1DKAA 1OXOA 3EZSA 1FG3A 2VIAA 3A8UX 4JEVA 3TFUA 3NRAA 1G4VA 3FZ8A 3A2BA 1DJ9A 4F4EA 2CSTA 2FM1A 4OC9A 2CJDA 3A9XA 7AATA 1WKHA 1TOJA 3RCHB 1AHXA 4CBRA 1W7NA 2R2NA 3ZZKA 1M6SA 1ASMA 1ASLA 1B5PA 5F9SA 2W8WA 1KMKA 3EI6A 1AHEA 2YKXA 4R5ZA 5FT5A 4XJMA 1D7SA 1GEXA 1MDZA 2VLHA 4A0GA 3AEMA 2OKKA 4W1WA 4LC3A 1ASFA 1U08A 4WP0A 3B46A 2D7ZA 2ZSMA 4E3RA 4RJ0A 4WYDA 2VGSA 3DYDA 1BJWA 4Y0IA 1O69A 1DGEA 3ACZA 5AX8A 2CB1A 2FYFA 9AATA 3B1CA 1DGDA 1BJOA 4IXOA 1VEFA 3KE3A 3E2ZB 3FQ7A 2AY1A 1AX4A 1C7NA 3NU7A 1KKPA 3B1EA 1WYUB 3BCXA 4P3MA 1D2FA 2YKYA 3AEOA 1ARHA 3VK4A 3NYUA 4K2MA 4K2IA 3N4RA 1TOKA 2DGLA 1CS1A 3VK2A 2BIAA 3DC1A 3PD6A 4JEYA 4PFNA 1QZ9A 2C0RA 3E2ZA 3B8XA 2CJGA 4DBCA 4AOAA 4W5KA 1BQAA 2VMQA 3RQ1A 3PAAA 2W7JA 4RITA 3WLXA 2BYJA 1C0NA 4F5IA 4WLJA 1V2FA 3CBFA 4BA5A 2RFVA 2OGAA 2BI3A 3FD0A 1CZCA 4KAMA 4OMAA 3BWOA 2X8UA 3LVMA 2CANA 3GBXA 3EI9A 4RIZA 1OXPA 1JS3A 2EGYA 3FQ8A 4RM1A 3E2FA 2W7EA 1M7YA 1IX7A 1N2TA 2EPJA 3DU4A 3HQTA 1UU0A 3LV2A 4MKKA 4EU1A 1AAWA 4OCAA 5M4DA 1IAYA 4A0RA 1X29A 1ASNA 3ISLA 1C4KA 3IF2A 3HBXA 4BA4A 1I29A 1IBJA 3QN6A 3PDXA 3AEMC 1XI9A 1AKBA 1M32A 1KMJA 1I48A 3Q8NA 3NYTA 2ZY3A 2E7JA 2HORA 4ZDPA 4H63Q 4R8DA 3TFTA 1DJUA 2Z9VA 2W8UA 2QB2A 1SVVA 2FNUA 1LW5A 5M46A 2Z20A 1BW0A 2O7CA 3FRKA 2GMUA 1AJSB 3MAUA 3HL2A 3MAFA 5G09A 4DQ6A 3KGWA 1B9HA 4ADBA 3VAXA 4LNLA 1TARA 1ELQA 1QJ3A 2W8VA 3MC6C 4KYOA 1D7RA 5LHAA 1M0QA 3EI8A 1M0PA 2DKJA 3AATA 3ASAA 4WYGA 4ZASA 2VMZA 1TATA 2VYCA 4IY7A 5DJ9A 3FQAA 3JZLA 4RKCA 4TN4A 4BHDA 1ARGA 2WK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E77 A;  3FZ7 A;  3PDB A;  1SZS A;  3AEP A;  4W1V A;  4U2H A;  3BCB A;  1B5O A;  2GSA A;  2YKU A;  1JG8 A;  1V72 A;  1MDO A;  4ITX A;  3II0 A;  4M2J A;  1ASD A;  2YRI A;  4WYE A;  4OT8 A;  1D7U A;  1G7W A;  3QI6 A;  2VMN A;  5IWQ A;  3NX3 A;  2Z1Z A;  1CQ6 A;  5I92 A;  3FTB A;  1ZC9 A;  2ZJG A;  4Y0H A;  3VP6 A;  4W1X A;  2AAT A;  1ASA A;  1O61 A;  1LK9 A;  3WX9 A;  3LVK A;  1G7X A;  3CQ5 A;  4AH3 A;  4Q76 A;  2D64 A;  2Z9W A;  1VP4 A;  4R2N A;  1QIR A;  4B9B A;  4JEX A;  1FC4 A;  2QA3 A;  3FZ6 A;  2XBN A;  3RBL A;  4I8A A;  1SFF A;  2WKA A;  1LS3 A;  4JEW A;  4TV7 A;  1Z3Z A;  2OQX A;  4XJL A;  1N31 A;  2VMR A;  2NMP A;  3GR9 A;  4OYT A;  3RCH A;  3BWN C;  2BWN A;  3BB8 A;  3FVX A;  1WST A;  2C7T A;  3BS8 A;  4O6Z A;  4BQ0 A;  1MDX A;  2AY2 A;  1JF9 A;  4Q6R A;  4EB7 A;  8AAT A;  1LC8 A;  2F8J A;  4P7Y A;  4MQQ A;  4XJP A;  1O4S A;  1SZU A;  1TPL A;  4XQ2 A;  3D6K A;  1AMQ A;  1ORD A;  2D65 A;  4RAE A;  1MGV A;  2CH2 A;  1QIT A;  1CZE A;  1C7G A;  3FFH A;  3MEB A;  4Q31 A;  2ZP7 A;  1ARI A;  3EI7 A;  5EIG B;  1M4N A;  1RVU A;  2ZY4 A;  1LC7 A;  5EAA A;  3BV0 A;  1YNU A;  1P3W A;  1YOO A;  3VOM A;  4AO9 A;  3I16 A;  4IXS A;  1IVR A;  2CTZ A;  2D61 A;  1N8P A;  2W7K A;  4GE4 A;  4Y0D A;  4N0W A;  4UHN A;  2DR1 A;  2QMA A;  4WXF A;  4E1O A;  3COG A;  3MKJ A;  3PIU A;  1MAQ A;  2ORD A;  2BIE A;  1GEW A;  2TPL A;  2VLF A;  3G8M A;  1QGN A;  2HOX A;  1GC3 A;  4JF1 A;  4EB5 A;  4XJO A;  3ZZJ A;  2AEU A;  4F5G A;  1DTY A;  4ATP A;  5HHY A;  1S07 A;  1UU2 A;  3FFR A;  1S08 A;  1B9I A;  3NU8 A;  3AEJ C;  3CQ4 A;  4LNM A;  5DX5 A;  4HF8 A;  2DGK A;  3E9K A;  2AY3 A;  3G0T A;  1J04 A;  1GDE A;  3L8A A;  2BI1 A;  2VMU A;  1TAS A;  2W7M A;  4CVQ A;  3GZD A;  2D5Y A;  3ASB A;  3EZ1 A;  3WCN A;  5D5S A;  2BWO A;  3BWN A;  3E2Y A;  2GQN A;  1QJ5 A;  3B1D A;  5E4Z A;  1PMO A;  4IX8 A;  1CQ7 A;  1KKJ A;  2HP2 A;  3UE8 A;  5E5I A;  5EUE A;  4PFF A;  2D7Y A;  5G4J A;  3NYS A;  3DXV A;  4WBT A;  1AIA A;  3GZC A;  5EFS A;  4HVK A;  4AZK A;  2W7H A;  1GD9 A;  1B8G A;  4WYC A;  5J8Q A;  2R5C B;  3QBO A;  4H51 A;  1BKG A;  3JU7 A;  5G2Q A;  2AY8 A;  3ZRR A;  4J8L A;  3DXW A;  2G6W A;  1TOI A;  2HUI A;  3LWS A;  2V1P A;  5F8V A;  2VGZ A;  2BIG A;  4WYF A;  3WY7 A;  4Q75 A;  1YJS A;  1X0M A;  4ISY A;  2VGU A;  3H7F A;  3UAK A;  4UHM A;  2O0R A;  3EUC A;  2W7I A;  3WGB A;  1CJ0 A;  3WCO A;  2Z9X A;  3AOV A;  2JG2 A;  2PB2 A;  3GJU A;  3PGY A;  2E7I A;  4GE9 A;  4IYO B;  1FG7 A;  1S06 A;  3HLM A;  2CIN A;  3FVU A;  2HUF A;  4IXZ A;  3F6T A;  3USF A;  2ZSL A;  2VIB A;  3ZRP A;  1S0A A;  3HT4 A;  1GBN A;  2BI5 A;  1ECX A;  4F5L A;  3NTJ A;  2AY7 A;  1WYU A;  3RBF A;  3VK3 A;  1DJE A;  1GEY A;  3PA9 A;  3NNK A;  3UWC A;  5BJ3 A;  1YJZ A;  4JF0 A;  1AHG A;  2JJE A;  1GC2 A;  2O1B A;  2VMT A;  2VMY A;  3QPG A;  5C6U A;  1MLY A;  3JW9 A;  1V2D A;  2Z1Y A;  2YRR A;  3NUI A;  2AY6 A;  4LW2 A;  1AAM A;  1AIC A;  2DKB A;  1G4X A;  3PD6 B;  4PVF A;  4F5J A;  2HUU A;  1BJN A;  1WYV A;  4WB0 B;  4OTL A;  1WKG A;  1X28 A;  1YIY A;  3NDN A;  2JJH A;  1AMA A;  4W8I A;  5FT4 A;  2PO3 A;  4ZM4 A;  3ELE A;  3R9A A;  5HXX A;  2HZP A;  3N5M A;  4GDY A;  3FDD A;  1SPA A;  4U1T A;  1SF2 A;  1RV3 A;  2FN6 A;  1DFO A;  1M0N A;  1YJY A;  2VMV A;  3F0H A;  3KGX A;  2W8T A;  2OKJ A;  4OBU A;  1ASE A;  5LH9 A;  2GMS A;  4A0F A;  2AY4 A;  4A72 A;  2JJG A;  4GEB A;  3CQ6 A;  3K40 A;  1QIS A;  1IX8 A;  4UQV A;  4AZJ A;  2CJH A;  3KKI A;  4B98 A;  2WK9 A;  1UU1 A;  2FQ6 A;  4IW7 A;  5EUD A;  5BJ4 A;  4ZSY A;  1OHW A;  1BJ4 A;  3HMU A;  3IHJ A;  1IX6 A;  3K7Y A;  1IAX A;  4GRX A;  3OKS A;  1OHV A;  2DOU A;  5G0A A;  1YIZ A;  4CBS A;  1OHY A;  2XH1 A;  4LNJ A;  1X2A A;  5G2P A;  1H1C A;  2EH6 A;  1KL2 A;  5M49 A;  2VMS A;  1W7L A;  2ZUK A;  3LY1 A;  3MBB A;  3WKS A;  1BT4 A;  4F5H A;  2YCP A;  2Q7W A;  3GSB A;  1ART A;  1MLZ A;  2JIS A;  2C44 A;  4AO4 A;  1IUG A;  3AEN A;  3JWB A;  3PPL A;  2W8J A;  2Z61 A;  2W7D A;  3HDO A;  1RV4 A;  1LW4 A;  4A00 A;  2HP1 A;  3FCR A;  3WGC A;  4QGR A;  3T32 A;  3TCM A;  2EZ2 A;  3TAT A;  1LKC A;  1PFF A;  3GWP A;  3MC6 A;  1S09 A;  2D66 A;  2D63 A;  4RKD A;  5EQC A;  4EFF A;  1M0O A;  1VJO A;  4ADC A;  4CXQ A;  3RUY A;  4ATQ A;  3BC8 A;  1AIB A;  1AY8 A;  4WLH A;  2BI9 A;  2PB0 A;  4MQP A;  2VMO A;  4RLG A;  4A6T A;  1EQB A;  1TOG A;  4ZDL A;  1ASG A;  2OAT A;  3BN1 A;  3G7Q A;  1ARS A;  3ECD A;  3EIB A;  2W7F A;  1PG8 A;  3CAI A;  3QM2 A;  4WB0 A;  2BYL A;  3FKD A;  2V0Y A;  3M5U A;  3FDB A;  4JEZ A;  5G4I A;  1GC0 A;  4ZWV A;  2YHK A;  4PIW A;  2QLR A;  4L0O A;  1CQ8 A;  4ZSW A;  4TMR A;  1C7O A;  2YOB A;  2X5F A;  4RJY A;  1ZOB A;  3QGU A;  3N0L A;  2BKW A;  3DRD A;  3GET A;  3W1I A;  2VI9 A;  2FNI A;  3MAD A;  2YCT A;  2DGM A;  2ZC0 A;  2C81 A;  4E3Q A;  1BS0 A;  1PMM A;  3I5T A;  3ZRQ A;  1EG5 A;  3MAF B;  4MSO A;  3ATH A;  3EIA A;  3R4T A;  1WYT A;  2EZ1 A;  4F5F A;  1AKC A;  1ASC A;  3E6G A;  4IYO A;  2ZY5 A;  1E5E A;  3ELP A;  2ZYJ A;  2VI8 A;  4CXR A;  5FT8 A;  1RVY A;  1H0C A;  2E7U A;  3H14 A;  1GCK A;  4ADE A;  1AY4 A;  1Y4I A;  2JGT A;  2VMW A;  3P6K A;  1D7V A;  1OAT A;  2R0T A;  4BMK A;  4ZWM A;  4M2M A;  4EMY A;  3W1J A;  3N75 A;  4GE7 A;  3QHX A;  4M2K A;  4F5M A;  4WXG A;  4WXB A;  3A9Y A;  2AY5 A;  4UHO A;  2VGV A;  5TF5 A;  4ZM3 A;  3AEL A;  1W23 A;  4UOY A;  4DGT A;  2E54 A;  4ITG A;  3LG0 A;  4ZDO A;  3I4J A;  4ZAH A;  5FT6 A;  1WYV B;  4J5U A;  1YAA A;  4MQR A;  3RI6 A;  3FSL A;  1EJI A;  2YCN A;  2AY9 A;  4R5F A;  1E5F A;  3L44 A;  1C9C A;  3FVS A;  4WYA A;  1CL2 A;  2HOY A;  5D95 A;  2VMX A;  4LW4 A;  4WD2 A;  2W7L A;  5DJ1 A;  1AJR A;  4MGR A;  3W1H A;  1B4X A;  1JS6 A;  5K8B A;  2WK7 A;  3DR4 A;  4A0H A;  4XK1 A;  4XAU A;  2R5E A;  5HDM A;  1Z7D A;  3AV7 A;  1MAP A;  4FFC A;  4MKJ A;  5JAY A;  1LC5 A;  3PDB B;  4MY5 A;  3JTX A;  3P1T A;  3EI5 A;  3DOD A;  2X5D A;  1WYT B;  2HOZ A;  3K28 A;  2GB3 A;  1BQD A;  3TQX A;  2CY8 A;  1GC4 A;  4W91 A;  3HVY A;  1ELU A;  1SZK A;  4N0B A;  1T3I A;  2W7G A;  1UKJ A;  2QBT A;  2VGW A;  3F9T A;  1V2E A;  3LVL B;  3WZF A;  1KL1 A;  1AKA A;  1ZOD A;  2BI2 A;  4KXK A;  2CFB A;  2Z9U A;  1BJO B;  5EAV A;  1AHY A;  2OGE A;  3BCA A;  2VGT A;  3WKR A;  2X3L A;  3GZD C;  2VMP A;  2JJF A;  3DR7 A;  1AMR A;  4K2B A;  4A6U A;  1AY5 A;  4F5K A;  1I43 A;  1I41 A;  1CL1 A;  2CH1 A;  2Z67 A;  3AEN B;  2ZY2 A;  4NOG A;  4OBV A;  4ADD A;  1AHF A;  2AEV A;  4FL0 A;  4GSA A;  5E3K A;  1XEY A;  2BWP A;  2EO5 A;  3DZZ A;  5M4B A;  1AMS A;  2R5C A;  2QB3 A;  3AEJ A;  4XEW A;  5EUN A;  4ZLV A;  4JE5 D;  1TOE A;  3AOW A;  2BHX A;  1IJI A;  1W7M A;  4JE5 A;  5DB5 A;  5EIG A;  1O62 A;  3JWA A;  3OP7 A;  1AJS A;  3PJ0 A;  4E77 A;  3LVJ A;  1W3U A;  4A6R A;  2YKV A;  1ASB A;  3NUB A;  3A9Z A;  1J32 A;  1DKA A;  1OXO A;  3EZS A;  1FG3 A;  2VIA A;  3A8U X;  4JEV A;  3TFU A;  3NRA A;  1G4V A;  3FZ8 A;  3A2B A;  1DJ9 A;  4F4E A;  2CST A;  2FM1 A;  4OC9 A;  2CJD A;  3A9X A;  7AAT A;  1WKH A;  1TOJ A;  3RCH B;  1AHX A;  4CBR A;  1W7N A;  2R2N A;  3ZZK A;  1M6S A;  1ASM A;  1ASL A;  1B5P A;  5F9S A;  2W8W A;  1KMK A;  3EI6 A;  1AHE A;  2YKX A;  4R5Z A;  5FT5 A;  4XJM A;  1D7S A;  1GEX A;  1MDZ A;  2VLH A;  4A0G A;  3AEM A;  2OKK A;  4W1W A;  4LC3 A;  1ASF A;  1U08 A;  4WP0 A;  3B46 A;  2D7Z A;  2ZSM A;  4E3R A;  4RJ0 A;  4WYD A;  2VGS A;  3DYD A;  1BJW A;  4Y0I A;  1O69 A;  1DGE A;  3ACZ A;  5AX8 A;  2CB1 A;  2FYF A;  9AAT A;  3B1C A;  1DGD A;  1BJO A;  4IXO A;  1VEF A;  3KE3 A;  3E2Z B;  3FQ7 A;  2AY1 A;  1AX4 A;  1C7N A;  3NU7 A;  1KKP A;  3B1E A;  1WYU B;  3BCX A;  4P3M A;  1D2F A;  2YKY A;  3AEO A;  1ARH A;  3VK4 A;  3NYU A;  4K2M A;  4K2I A;  1TOK A;  2DGL A;  1CS1 A;  3VK2 A;  2BIA A;  3DC1 A;  3PD6 A;  4JEY A;  4PFN A;  1QZ9 A;  2C0R A;  3E2Z A;  3B8X A;  2CJG A;  4DBC A;  4AOA A;  4W5K A;  1BQA A;  2VMQ A;  3RQ1 A;  3PAA A;  2W7J A;  4RIT A;  3WLX A;  2BYJ A;  1C0N A;  4F5I A;  4WLJ A;  1V2F A;  3CBF A;  4BA5 A;  2RFV A;  2OGA A;  2BI3 A;  3FD0 A;  1CZC A;  4KAM A;  4OMA A;  3BWO A;  2X8U A;  3LVM A;  2CAN A;  3GBX A;  3EI9 A;  4RIZ A;  1OXP A;  1JS3 A;  2EGY A;  3FQ8 A;  4RM1 A;  3E2F A;  2W7E A;  1M7Y A;  1IX7 A;  1N2T A;  2EPJ A;  3DU4 A;  3HQT A;  1UU0 A;  3LV2 A;  4MKK A;  4EU1 A;  1AAW A;  4OCA A;  5M4D A;  1IAY A;  4A0R A;  1X29 A;  1ASN A;  3ISL A;  1C4K A;  3IF2 A;  3HBX A;  4BA4 A;  1I29 A;  1IBJ A;  3QN6 A;  3PDX A;  3AEM C;  1XI9 A;  1AKB A;  1M32 A;  1KMJ A;  1I48 A;  3Q8N A;  3NYT A;  2ZY3 A;  2E7J A;  2HOR A;  4ZDP A;  4R8D A;  3TFT A;  1DJU A;  2Z9V A;  2W8U A;  2QB2 A;  1SVV A;  2FNU A;  1LW5 A;  5M46 A;  2Z20 A;  1BW0 A;  2O7C A;  3FRK A;  2GMU A;  1AJS B;  3MAU A;  3HL2 A;  3MAF A;  5G09 A;  4DQ6 A;  3KGW A;  1B9H A;  4ADB A;  3VAX A;  4LNL A;  1TAR A;  1ELQ A;  1QJ3 A;  2W8V A;  3MC6 C;  4KYO A;  1D7R A;  5LHA A;  1M0Q A;  3EI8 A;  1M0P A;  2DKJ A;  3AAT A;  3ASA A;  4WYG A;  4ZAS A;  2VMZ A;  1TAT A;  2VYC A;  4IY7 A;  5DJ9 A;  3FQA A;  3JZL A;  4RKC A;  4TN4 A;  4BHD A;  1ARG A;  2WK8 A; 
#chains in the Genus database with same CATH topology
 3E77 A;  3FZ7 A;  3PDB A;  2A1V A;  1SZS A;  3AEP A;  4W1V A;  4U2H A;  3BCB A;  1B5O A;  2GSA A;  2YKU A;  1JG8 A;  1V72 A;  1MDO A;  4ITX A;  3II0 A;  4M2J A;  1ASD A;  2YRI A;  4WYE A;  4OT8 A;  1D7U A;  1G7W A;  3QI6 A;  2VMN A;  5IWQ A;  3NX3 A;  2Z1Z A;  1CQ6 A;  5I92 A;  3FTB A;  1ZC9 A;  2ZJG A;  4Y0H A;  3VP6 A;  4W1X A;  2AAT A;  1ASA A;  1O61 A;  1LK9 A;  3WX9 A;  3LVK A;  1G7X A;  3CQ5 A;  4AH3 A;  4Q76 A;  2D64 A;  2Z9W A;  1VP4 A;  4R2N A;  1QIR A;  4B9B A;  4JEX A;  1FC4 A;  2QA3 A;  3FZ6 A;  2XBN A;  3RBL A;  4I8A A;  1SFF A;  2WKA A;  1LS3 A;  4JEW A;  4TV7 A;  1Z3Z A;  2OQX A;  4XJL A;  1N31 A;  2VMR A;  2NMP A;  3GR9 A;  4OYT A;  3RCH A;  1KAF A;  3BWN C;  2BWN A;  2FKI A;  3BB8 A;  3FVX A;  1WST A;  2C7T A;  3BS8 A;  4O6Z A;  4BQ0 A;  1MDX A;  2AY2 A;  1JF9 A;  4Q6R A;  4EB7 A;  8AAT A;  1LC8 A;  2F8J A;  4P7Y A;  4MQQ A;  4XJP A;  1O4S A;  1SZU A;  1TPL A;  4XQ2 A;  3D6K A;  1AMQ A;  1ORD A;  2D65 A;  4RAE A;  1MGV A;  2CH2 A;  1QIT A;  1CZE A;  1C7G A;  3FFH A;  3MEB A;  4Q31 A;  2ZP7 A;  1ARI A;  3EI7 A;  5EIG B;  1M4N A;  1RVU A;  2ZY4 A;  1LC7 A;  5EAA A;  3BV0 A;  1YNU A;  1P3W A;  1YOO A;  3VOM A;  4AO9 A;  3I16 A;  4IXS A;  1IVR A;  2CTZ A;  2D61 A;  1N8P A;  2W7K A;  4GE4 A;  4Y0D A;  4N0W A;  3H9X A;  4UHN A;  2DR1 A;  2QMA A;  4WXF A;  4E1O A;  3COG A;  3MKJ A;  3PIU A;  1MAQ A;  2ORD A;  2BIE A;  1GEW A;  2TPL A;  2VLF A;  3G8M A;  1QGN A;  2HOX A;  1GC3 A;  4JF1 A;  4EB5 A;  4XJO A;  3ZZJ A;  2AEU A;  4F5G A;  1DTY A;  4ATP A;  5HHY A;  1S07 A;  1UU2 A;  3FFR A;  1S08 A;  1B9I A;  3NU8 A;  3AEJ C;  3CQ4 A;  4LNM A;  5DX5 A;  4HF8 A;  2DGK A;  3E9K A;  2AY3 A;  2EYQ A;  2WB6 A;  3G0T A;  1J04 A;  1GDE A;  3L8A A;  2BI1 A;  2VMU A;  1TAS A;  2W7M A;  4CVQ A;  3GZD A;  2D5Y A;  3ASB A;  3EZ1 A;  3WCN A;  5D5S A;  2BWO A;  3BWN A;  3E2Y A;  2GQN A;  1QJ5 A;  3B1D A;  5E4Z A;  1PMO A;  4IX8 A;  1CQ7 A;  1KKJ A;  2HP2 A;  3UE8 A;  5E5I A;  5EUE A;  4PFF A;  2D7Y A;  5G4J A;  3NYS A;  3DXV A;  4WBT A;  1AIA A;  3GZC A;  5EFS A;  4HVK A;  4AZK A;  2W7H A;  1GD9 A;  1B8G A;  4WYC A;  5J8Q A;  2R5C B;  3QBO A;  4H51 A;  1BKG A;  3JU7 A;  5G2Q A;  2AY8 A;  3ZRR A;  4J8L A;  3DXW A;  2G6W A;  1TOI A;  2HUI A;  3LWS A;  2V1P A;  5F8V A;  2VGZ A;  2BIG A;  4WYF A;  3WY7 A;  4Q75 A;  1YJS A;  1X0M A;  4ISY A;  2VGU A;  3H7F A;  3UAK A;  4UHM A;  2O0R A;  3EUC A;  2W7I A;  3WGB A;  1CJ0 A;  3WCO A;  2Z9X A;  3AOV A;  2JG2 A;  2PB2 A;  3GJU A;  3PGY A;  2E7I A;  4GE9 A;  4IYO B;  1FG7 A;  1S06 A;  3HLM A;  2CIN A;  3FVU A;  2HUF A;  4IXZ A;  3F6T A;  3USF A;  2ZSL A;  2VIB A;  3ZRP A;  1S0A A;  3HT4 A;  1GBN A;  2BI5 A;  1ECX A;  4F5L A;  3NTJ A;  2AY7 A;  1WYU A;  3RBF A;  3VK3 A;  1DJE A;  1GEY A;  3PA9 A;  3NNK A;  3UWC A;  5BJ3 A;  1YJZ A;  4JF0 A;  1AHG A;  2JJE A;  1GC2 A;  2O1B A;  2VMT A;  2VMY A;  3QPG A;  5C6U A;  1MLY A;  3JW9 A;  1V2D A;  2Z1Y A;  2YRR A;  3NUI A;  2AY6 A;  4LW2 A;  1AAM A;  1AIC A;  2DKB A;  1G4X A;  3PD6 B;  4PVF A;  4F5J A;  2HUU A;  1BJN A;  1WYV A;  4WB0 B;  4OTL A;  1WKG A;  1X28 A;  1YIY A;  3NDN A;  2JJH A;  1AMA A;  4W8I A;  5FT4 A;  2PO3 A;  4ZM4 A;  3ELE A;  3R9A A;  5HXX A;  2HZP A;  3N5M A;  4GDY A;  3FDD A;  1SPA A;  4U1T A;  1SF2 A;  1RV3 A;  2FN6 A;  1DFO A;  1M0N A;  1YJY A;  2VMV A;  3F0H A;  3KGX A;  2W8T A;  2OKJ A;  4OBU A;  1ASE A;  5LH9 A;  2GMS A;  4A0F A;  2AY4 A;  4A72 A;  2JJG A;  4GEB A;  3CQ6 A;  3N4S A;  3K40 A;  1QIS A;  1IX8 A;  4UQV A;  4AZJ A;  2CJH A;  3KKI A;  4B98 A;  2WK9 A;  1UU1 A;  2FQ6 A;  4IW7 A;  5EUD A;  5BJ4 A;  4ZSY A;  2G7J A;  1OHW A;  1BJ4 A;  3HMU A;  3IHJ A;  1IX6 A;  3K7Y A;  1IAX A;  4GRX A;  3OKS A;  1OHV A;  2DOU A;  5G0A A;  1YIZ A;  4CBS A;  1OHY A;  2XH1 A;  4LNJ A;  1X2A A;  5G2P A;  1H1C A;  2EH6 A;  1KL2 A;  5M49 A;  2VMS A;  1W7L A;  2ZUK A;  3LY1 A;  3MBB A;  3WKS A;  1BT4 A;  4F5H A;  2YCP A;  2Q7W A;  3GSB A;  1ART A;  1MLZ A;  2JIS A;  2C44 A;  4AO4 A;  1IUG A;  3AEN A;  3JWB A;  3PPL A;  2W8J A;  2Z61 A;  2W7D A;  3HDO A;  1RV4 A;  1LW4 A;  4A00 A;  2HP1 A;  3FCR A;  3WGC A;  4QGR A;  3T32 A;  3TCM A;  2EZ2 A;  3N7N A;  3TAT A;  1LKC A;  1PFF A;  3GWP A;  3MC6 A;  1S09 A;  2D66 A;  2D63 A;  4RKD A;  5EQC A;  4EFF A;  1M0O A;  1VJO A;  4ADC A;  4CXQ A;  3RUY A;  4ATQ A;  3BC8 A;  1AIB A;  1AY8 A;  4WLH A;  2BI9 A;  2PB0 A;  4MQP A;  2VMO A;  4RLG A;  4A6T A;  1EQB A;  1TOG A;  4ZDL A;  1ASG A;  2OAT A;  3BN1 A;  3G7Q A;  1ARS A;  3ECD A;  3EIB A;  2W7F A;  1PG8 A;  3CAI A;  3QM2 A;  4WB0 A;  2BYL A;  3FKD A;  2V0Y A;  3M5U A;  3FDB A;  4JEZ A;  5G4I A;  1GC0 A;  4ZWV A;  2YHK A;  4PIW A;  2QLR A;  4L0O A;  1CQ8 A;  4ZSW A;  4TMR A;  1C7O A;  2YOB A;  2X5F A;  4RJY A;  1ZOB A;  3QGU A;  3N0L A;  2BKW A;  3DRD A;  3GET A;  3W1I A;  2VI9 A;  2FNI A;  3MAD A;  2YCT A;  2DGM A;  2ZC0 A;  2C81 A;  4E3Q A;  1BS0 A;  1PMM A;  3I5T A;  3ZRQ A;  1EG5 A;  3MAF B;  4MSO A;  3ATH A;  3EIA A;  3R4T A;  1WYT A;  2EZ1 A;  4F5F A;  1AKC A;  1ASC A;  3E6G A;  4IYO A;  2ZY5 A;  4K05 A;  1E5E A;  3ELP A;  2ZYJ A;  2VI8 A;  4CXR A;  5FT8 A;  1RVY A;  1H0C A;  2E7U A;  3H14 A;  1GCK A;  3N4X A;  4ADE A;  1AY4 A;  1Y4I A;  2JGT A;  2VMW A;  3P6K A;  1D7V A;  1OAT A;  2R0T A;  4BMK A;  4ZWM A;  4M2M A;  4EMY A;  3W1J A;  3N75 A;  4GE7 A;  3QHX A;  4M2K A;  4F5M A;  4WXG A;  4WXB A;  3A9Y A;  2AY5 A;  4UHO A;  2VGV A;  5TF5 A;  4ZM3 A;  3AEL A;  1W23 A;  4UOY A;  4DGT A;  2E54 A;  4ITG A;  3LG0 A;  4ZDO A;  3I4J A;  4ZAH A;  5FT6 A;  1WYV B;  4J5U A;  1YAA A;  4MQR A;  3RI6 A;  3FSL A;  1EJI A;  2YCN A;  2AY9 A;  4R5F A;  1E5F A;  3L44 A;  1C9C A;  3FVS A;  5KTB A;  4WYA A;  1CL2 A;  2HOY A;  5D95 A;  2VMX A;  4LW4 A;  4WD2 A;  2W7L A;  5DJ1 A;  1AJR A;  4MGR A;  3W1H A;  1B4X A;  1JS6 A;  5K8B A;  2WK7 A;  3DR4 A;  4A0H A;  4XK1 A;  4XAU A;  2R5E A;  5HDM A;  1Z7D A;  3AV7 A;  1MAP A;  4FFC A;  4MKJ A;  5JAY A;  1LC5 A;  3PDB B;  4MY5 A;  3JTX A;  3P1T A;  3EI5 A;  3DOD A;  2X5D A;  1WYT B;  2HOZ A;  3K28 A;  2GB3 A;  1BQD A;  3TQX A;  2CY8 A;  1GC4 A;  4W91 A;  3HVY A;  1ELU A;  1SZK A;  4N0B A;  1T3I A;  2W7G A;  1UKJ A;  2QBT A;  2VGW A;  3F9T A;  1V2E A;  3LVL B;  3WZF A;  1KL1 A;  2QSR A;  1AKA A;  1ZOD A;  2BI2 A;  4KXK A;  2CFB A;  2Z9U A;  1BJO B;  5EAV A;  2KFP A;  1AHY A;  2OGE A;  3BCA A;  2VGT A;  3WKR A;  2X3L A;  3GZD C;  2VMP A;  2JJF A;  3DR7 A;  1AMR A;  4K2B A;  4A6U A;  1AY5 A;  4F5K A;  1I43 A;  1I41 A;  1CL1 A;  2CH1 A;  2Z67 A;  3AEN B;  2ZY2 A;  4NOG A;  4OBV A;  4ADD A;  1AHF A;  2AEV A;  4FL0 A;  4GSA A;  5E3K A;  1XEY A;  2BWP A;  2EO5 A;  3DZZ A;  5M4B A;  1AMS A;  2R5C A;  2QB3 A;  3AEJ A;  4XEW A;  5EUN A;  4ZLV A;  4JE5 D;  1TOE A;  3AOW A;  2BHX A;  1IJI A;  1W7M A;  4JE5 A;  5DB5 A;  5EIG A;  1O62 A;  3JWA A;  3OP7 A;  1AJS A;  3PJ0 A;  4E77 A;  3LVJ A;  1W3U A;  4A6R A;  2YKV A;  1ASB A;  3NUB A;  3A9Z A;  1J32 A;  1DKA A;  1OXO A;  3EZS A;  1FG3 A;  2VIA A;  3A8U X;  4JEV A;  3TFU A;  3NRA A;  1G4V A;  3FZ8 A;  3A2B A;  1DJ9 A;  4F4E A;  2CST A;  2FM1 A;  4OC9 A;  2CJD A;  3A9X A;  7AAT A;  1WKH A;  1TOJ A;  3RCH B;  1AHX A;  4CBR A;  1W7N A;  2R2N A;  3ZZK A;  1M6S A;  1ASM A;  1ASL A;  1B5P A;  5F9S A;  2W8W A;  1KMK A;  3EI6 A;  1AHE A;  2YKX A;  4R5Z A;  5FT5 A;  4XJM A;  1D7S A;  1GEX A;  1MDZ A;  2VLH A;  4A0G A;  3AEM A;  2OKK A;  4W1W A;  4LC3 A;  1ASF A;  1U08 A;  4WP0 A;  3B46 A;  2D7Z A;  2ZSM A;  4E3R A;  4RJ0 A;  4WYD A;  2VGS A;  3DYD A;  1BJW A;  4Y0I A;  1O69 A;  1DGE A;  3ACZ A;  5AX8 A;  2CB1 A;  2FYF A;  9AAT A;  3B1C A;  1DGD A;  1BJO A;  4IXO A;  1VEF A;  3KE3 A;  3E2Z B;  3FQ7 A;  2AY1 A;  1AX4 A;  1C7N A;  3NU7 A;  1KKP A;  3B1E A;  1WYU B;  3BCX A;  4P3M A;  1D2F A;  2YKY A;  3AEO A;  1ARH A;  3VK4 A;  3NYU A;  4K2M A;  4K2I A;  3N4R A;  1TOK A;  2DGL A;  1CS1 A;  3VK2 A;  2BIA A;  3DC1 A;  3PD6 A;  4JEY A;  4PFN A;  1QZ9 A;  2C0R A;  3E2Z A;  3B8X A;  2CJG A;  4DBC A;  4AOA A;  4W5K A;  1BQA A;  2VMQ A;  3RQ1 A;  3PAA A;  2W7J A;  4RIT A;  3WLX A;  2BYJ A;  1C0N A;  4F5I A;  4WLJ A;  1V2F A;  3CBF A;  4BA5 A;  2RFV A;  2OGA A;  2BI3 A;  3FD0 A;  1CZC A;  4KAM A;  4OMA A;  3BWO A;  2X8U A;  3LVM A;  2CAN A;  3GBX A;  3EI9 A;  4RIZ A;  1OXP A;  1JS3 A;  2EGY A;  3FQ8 A;  4RM1 A;  3E2F A;  2W7E A;  1M7Y A;  1IX7 A;  1N2T A;  2EPJ A;  3DU4 A;  3HQT A;  1UU0 A;  3LV2 A;  4MKK A;  4EU1 A;  1AAW A;  4OCA A;  5M4D A;  1IAY A;  4A0R A;  1X29 A;  1ASN A;  3ISL A;  1C4K A;  3IF2 A;  3HBX A;  4BA4 A;  1I29 A;  1IBJ A;  3QN6 A;  3PDX A;  3AEM C;  1XI9 A;  1AKB A;  1M32 A;  1KMJ A;  1I48 A;  3Q8N A;  3NYT A;  2ZY3 A;  2E7J A;  2HOR A;  4ZDP A;  4H63 Q;  4R8D A;  3TFT A;  1DJU A;  2Z9V A;  2W8U A;  2QB2 A;  1SVV A;  2FNU A;  1LW5 A;  5M46 A;  2Z20 A;  1BW0 A;  2O7C A;  3FRK A;  2GMU A;  1AJS B;  3MAU A;  3HL2 A;  3MAF A;  5G09 A;  4DQ6 A;  3KGW A;  1B9H A;  4ADB A;  3VAX A;  4LNL A;  1TAR A;  1ELQ A;  1QJ3 A;  2W8V A;  3MC6 C;  4KYO A;  1D7R A;  5LHA A;  1M0Q A;  3EI8 A;  1M0P A;  2DKJ A;  3AAT A;  3ASA A;  4WYG A;  4ZAS A;  2VMZ A;  1TAT A;  2VYC A;  4IY7 A;  5DJ9 A;  3FQA A;  3JZL A;  4RKC A;  4TN4 A;  4BHD A;  1ARG A;  2WK8 A; 
#chains in the Genus database with same CATH homology
 3E77 A;  3FZ7 A;  3PDB A;  2A1V A;  1SZS A;  3AEP A;  4W1V A;  4U2H A;  3BCB A;  1B5O A;  2GSA A;  2YKU A;  1JG8 A;  1V72 A;  1MDO A;  4ITX A;  3II0 A;  4M2J A;  1ASD A;  2YRI A;  4WYE A;  4OT8 A;  1D7U A;  1G7W A;  3QI6 A;  2VMN A;  5IWQ A;  3NX3 A;  2Z1Z A;  1CQ6 A;  5I92 A;  3FTB A;  1ZC9 A;  2ZJG A;  4Y0H A;  3VP6 A;  4W1X A;  2AAT A;  1ASA A;  1O61 A;  1LK9 A;  3WX9 A;  3LVK A;  1G7X A;  3CQ5 A;  4AH3 A;  4Q76 A;  2D64 A;  2Z9W A;  1VP4 A;  4R2N A;  1QIR A;  4B9B A;  4JEX A;  1FC4 A;  2QA3 A;  3FZ6 A;  2XBN A;  3RBL A;  4I8A A;  1SFF A;  2WKA A;  1LS3 A;  4JEW A;  4TV7 A;  1Z3Z A;  2OQX A;  4XJL A;  1N31 A;  2VMR A;  2NMP A;  3GR9 A;  4OYT A;  3RCH A;  3BWN C;  2BWN A;  2FKI A;  3BB8 A;  3FVX A;  1WST A;  2C7T A;  3BS8 A;  4O6Z A;  4BQ0 A;  1MDX A;  2AY2 A;  1JF9 A;  4Q6R A;  4EB7 A;  8AAT A;  1LC8 A;  2F8J A;  4P7Y A;  4MQQ A;  4XJP A;  1O4S A;  1SZU A;  1TPL A;  4XQ2 A;  3D6K A;  1AMQ A;  1ORD A;  2D65 A;  4RAE A;  1MGV A;  2CH2 A;  1QIT A;  1CZE A;  1C7G A;  3FFH A;  3MEB A;  4Q31 A;  2ZP7 A;  1ARI A;  3EI7 A;  5EIG B;  1M4N A;  1RVU A;  2ZY4 A;  1LC7 A;  5EAA A;  3BV0 A;  1YNU A;  1P3W A;  1YOO A;  3VOM A;  4AO9 A;  3I16 A;  4IXS A;  1IVR A;  2CTZ A;  2D61 A;  1N8P A;  2W7K A;  4GE4 A;  4Y0D A;  4N0W A;  3H9X A;  4UHN A;  2DR1 A;  2QMA A;  4WXF A;  4E1O A;  3COG A;  3MKJ A;  3PIU A;  1MAQ A;  2ORD A;  2BIE A;  1GEW A;  2TPL A;  2VLF A;  3G8M A;  1QGN A;  2HOX A;  1GC3 A;  4JF1 A;  4EB5 A;  4XJO A;  3ZZJ A;  2AEU A;  4F5G A;  1DTY A;  4ATP A;  5HHY A;  1S07 A;  1UU2 A;  3FFR A;  1S08 A;  1B9I A;  3NU8 A;  3AEJ C;  3CQ4 A;  4LNM A;  5DX5 A;  4HF8 A;  2DGK A;  3E9K A;  2AY3 A;  2EYQ A;  2WB6 A;  3G0T A;  1J04 A;  1GDE A;  3L8A A;  2BI1 A;  2VMU A;  1TAS A;  2W7M A;  4CVQ A;  3GZD A;  2D5Y A;  3ASB A;  3EZ1 A;  3WCN A;  5D5S A;  2BWO A;  3BWN A;  3E2Y A;  2GQN A;  1QJ5 A;  3B1D A;  5E4Z A;  1PMO A;  4IX8 A;  1CQ7 A;  1KKJ A;  2HP2 A;  3UE8 A;  5E5I A;  5EUE A;  4PFF A;  2D7Y A;  5G4J A;  3NYS A;  3DXV A;  4WBT A;  1AIA A;  3GZC A;  5EFS A;  4HVK A;  4AZK A;  2W7H A;  1GD9 A;  1B8G A;  4WYC A;  5J8Q A;  2R5C B;  3QBO A;  4H51 A;  1BKG A;  3JU7 A;  5G2Q A;  2AY8 A;  3ZRR A;  4J8L A;  3DXW A;  2G6W A;  1TOI A;  2HUI A;  3LWS A;  2V1P A;  5F8V A;  2VGZ A;  2BIG A;  4WYF A;  3WY7 A;  4Q75 A;  1YJS A;  1X0M A;  4ISY A;  2VGU A;  3H7F A;  3UAK A;  4UHM A;  2O0R A;  3EUC A;  2W7I A;  3WGB A;  1CJ0 A;  3WCO A;  2Z9X A;  3AOV A;  2JG2 A;  2PB2 A;  3GJU A;  3PGY A;  2E7I A;  4GE9 A;  4IYO B;  1FG7 A;  1S06 A;  3HLM A;  2CIN A;  3FVU A;  2HUF A;  4IXZ A;  3F6T A;  3USF A;  2ZSL A;  2VIB A;  3ZRP A;  1S0A A;  3HT4 A;  1GBN A;  2BI5 A;  1ECX A;  4F5L A;  3NTJ A;  2AY7 A;  1WYU A;  3RBF A;  3VK3 A;  1DJE A;  1GEY A;  3PA9 A;  3NNK A;  3UWC A;  5BJ3 A;  1YJZ A;  4JF0 A;  1AHG A;  2JJE A;  1GC2 A;  2O1B A;  2VMT A;  2VMY A;  3QPG A;  5C6U A;  1MLY A;  3JW9 A;  1V2D A;  2Z1Y A;  2YRR A;  3NUI A;  2AY6 A;  4LW2 A;  1AAM A;  1AIC A;  2DKB A;  1G4X A;  3PD6 B;  4PVF A;  4F5J A;  2HUU A;  1BJN A;  1WYV A;  4WB0 B;  4OTL A;  1WKG A;  1X28 A;  1YIY A;  3NDN A;  2JJH A;  1AMA A;  4W8I A;  5FT4 A;  2PO3 A;  4ZM4 A;  3ELE A;  3R9A A;  5HXX A;  2HZP A;  3N5M A;  4GDY A;  3FDD A;  1SPA A;  4U1T A;  1SF2 A;  1RV3 A;  2FN6 A;  1DFO A;  1M0N A;  1YJY A;  2VMV A;  3F0H A;  3KGX A;  2W8T A;  2OKJ A;  4OBU A;  1ASE A;  5LH9 A;  2GMS A;  4A0F A;  2AY4 A;  4A72 A;  2JJG A;  4GEB A;  3CQ6 A;  3N4S A;  3K40 A;  1QIS A;  1IX8 A;  4UQV A;  4AZJ A;  2CJH A;  3KKI A;  4B98 A;  2WK9 A;  1UU1 A;  2FQ6 A;  4IW7 A;  5EUD A;  5BJ4 A;  4ZSY A;  2G7J A;  1OHW A;  1BJ4 A;  3HMU A;  3IHJ A;  1IX6 A;  3K7Y A;  1IAX A;  4GRX A;  3OKS A;  1OHV A;  2DOU A;  5G0A A;  1YIZ A;  4CBS A;  1OHY A;  2XH1 A;  4LNJ A;  1X2A A;  5G2P A;  1H1C A;  2EH6 A;  1KL2 A;  5M49 A;  2VMS A;  1W7L A;  2ZUK A;  3LY1 A;  3MBB A;  3WKS A;  1BT4 A;  4F5H A;  2YCP A;  2Q7W A;  3GSB A;  1ART A;  1MLZ A;  2JIS A;  2C44 A;  4AO4 A;  1IUG A;  3AEN A;  3JWB A;  3PPL A;  2W8J A;  2Z61 A;  2W7D A;  3HDO A;  1RV4 A;  1LW4 A;  4A00 A;  2HP1 A;  3FCR A;  3WGC A;  4QGR A;  3T32 A;  3TCM A;  2EZ2 A;  3N7N A;  3TAT A;  1LKC A;  1PFF A;  3GWP A;  3MC6 A;  1S09 A;  2D66 A;  2D63 A;  4RKD A;  5EQC A;  4EFF A;  1M0O A;  1VJO A;  4ADC A;  4CXQ A;  3RUY A;  4ATQ A;  3BC8 A;  1AIB A;  1AY8 A;  4WLH A;  2BI9 A;  2PB0 A;  4MQP A;  2VMO A;  4RLG A;  4A6T A;  1EQB A;  1TOG A;  4ZDL A;  1ASG A;  2OAT A;  3BN1 A;  3G7Q A;  1ARS A;  3ECD A;  3EIB A;  2W7F A;  1PG8 A;  3CAI A;  3QM2 A;  4WB0 A;  2BYL A;  3FKD A;  2V0Y A;  3M5U A;  3FDB A;  4JEZ A;  5G4I A;  1GC0 A;  4ZWV A;  2YHK A;  4PIW A;  2QLR A;  4L0O A;  1CQ8 A;  4ZSW A;  4TMR A;  1C7O A;  2YOB A;  2X5F A;  4RJY A;  1ZOB A;  3QGU A;  3N0L A;  2BKW A;  3DRD A;  3GET A;  3W1I A;  2VI9 A;  2FNI A;  3MAD A;  2YCT A;  2DGM A;  2ZC0 A;  2C81 A;  4E3Q A;  1BS0 A;  1PMM A;  3I5T A;  3ZRQ A;  1EG5 A;  3MAF B;  4MSO A;  3ATH A;  3EIA A;  3R4T A;  1WYT A;  2EZ1 A;  4F5F A;  1AKC A;  1ASC A;  3E6G A;  4IYO A;  2ZY5 A;  4K05 A;  1E5E A;  3ELP A;  2ZYJ A;  2VI8 A;  4CXR A;  5FT8 A;  1RVY A;  1H0C A;  2E7U A;  3H14 A;  1GCK A;  3N4X A;  4ADE A;  1AY4 A;  1Y4I A;  2JGT A;  2VMW A;  3P6K A;  1D7V A;  1OAT A;  2R0T A;  4BMK A;  4ZWM A;  4M2M A;  4EMY A;  3W1J A;  3N75 A;  4GE7 A;  3QHX A;  4M2K A;  4F5M A;  4WXG A;  4WXB A;  3A9Y A;  2AY5 A;  4UHO A;  2VGV A;  5TF5 A;  4ZM3 A;  3AEL A;  1W23 A;  4UOY A;  4DGT A;  2E54 A;  4ITG A;  3LG0 A;  4ZDO A;  3I4J A;  4ZAH A;  5FT6 A;  1WYV B;  4J5U A;  1YAA A;  4MQR A;  3RI6 A;  3FSL A;  1EJI A;  2YCN A;  2AY9 A;  4R5F A;  1E5F A;  3L44 A;  1C9C A;  3FVS A;  5KTB A;  4WYA A;  1CL2 A;  2HOY A;  5D95 A;  2VMX A;  4LW4 A;  4WD2 A;  2W7L A;  5DJ1 A;  1AJR A;  4MGR A;  3W1H A;  1B4X A;  1JS6 A;  5K8B A;  2WK7 A;  3DR4 A;  4A0H A;  4XK1 A;  4XAU A;  2R5E A;  5HDM A;  1Z7D A;  3AV7 A;  1MAP A;  4FFC A;  4MKJ A;  5JAY A;  1LC5 A;  3PDB B;  4MY5 A;  3JTX A;  3P1T A;  3EI5 A;  3DOD A;  2X5D A;  1WYT B;  2HOZ A;  3K28 A;  2GB3 A;  1BQD A;  3TQX A;  2CY8 A;  1GC4 A;  4W91 A;  3HVY A;  1ELU A;  1SZK A;  4N0B A;  1T3I A;  2W7G A;  1UKJ A;  2QBT A;  2VGW A;  3F9T A;  1V2E A;  3LVL B;  3WZF A;  1KL1 A;  2QSR A;  1AKA A;  1ZOD A;  2BI2 A;  4KXK A;  2CFB A;  2Z9U A;  1BJO B;  5EAV A;  2KFP A;  1AHY A;  2OGE A;  3BCA A;  2VGT A;  3WKR A;  2X3L A;  3GZD C;  2VMP A;  2JJF A;  3DR7 A;  1AMR A;  4K2B A;  4A6U A;  1AY5 A;  4F5K A;  1I43 A;  1I41 A;  1CL1 A;  2CH1 A;  2Z67 A;  3AEN B;  2ZY2 A;  4NOG A;  4OBV A;  4ADD A;  1AHF A;  2AEV A;  4FL0 A;  4GSA A;  5E3K A;  1XEY A;  2BWP A;  2EO5 A;  3DZZ A;  5M4B A;  1AMS A;  2R5C A;  2QB3 A;  3AEJ A;  4XEW A;  5EUN A;  4ZLV A;  4JE5 D;  1TOE A;  3AOW A;  2BHX A;  1IJI A;  1W7M A;  4JE5 A;  5DB5 A;  5EIG A;  1O62 A;  3JWA A;  3OP7 A;  1AJS A;  3PJ0 A;  4E77 A;  3LVJ A;  1W3U A;  4A6R A;  2YKV A;  1ASB A;  3NUB A;  3A9Z A;  1J32 A;  1DKA A;  1OXO A;  3EZS A;  1FG3 A;  2VIA A;  3A8U X;  4JEV A;  3TFU A;  3NRA A;  1G4V A;  3FZ8 A;  3A2B A;  1DJ9 A;  4F4E A;  2CST A;  2FM1 A;  4OC9 A;  2CJD A;  3A9X A;  7AAT A;  1WKH A;  1TOJ A;  3RCH B;  1AHX A;  4CBR A;  1W7N A;  2R2N A;  3ZZK A;  1M6S A;  1ASM A;  1ASL A;  1B5P A;  5F9S A;  2W8W A;  1KMK A;  3EI6 A;  1AHE A;  2YKX A;  4R5Z A;  5FT5 A;  4XJM A;  1D7S A;  1GEX A;  1MDZ A;  2VLH A;  4A0G A;  3AEM A;  2OKK A;  4W1W A;  4LC3 A;  1ASF A;  1U08 A;  4WP0 A;  3B46 A;  2D7Z A;  2ZSM A;  4E3R A;  4RJ0 A;  4WYD A;  2VGS A;  3DYD A;  1BJW A;  4Y0I A;  1O69 A;  1DGE A;  3ACZ A;  5AX8 A;  2CB1 A;  2FYF A;  9AAT A;  3B1C A;  1DGD A;  1BJO A;  4IXO A;  1VEF A;  3KE3 A;  3E2Z B;  3FQ7 A;  2AY1 A;  1AX4 A;  1C7N A;  3NU7 A;  1KKP A;  3B1E A;  1WYU B;  3BCX A;  4P3M A;  1D2F A;  2YKY A;  3AEO A;  1ARH A;  3VK4 A;  3NYU A;  4K2M A;  4K2I A;  3N4R A;  1TOK A;  2DGL A;  1CS1 A;  3VK2 A;  2BIA A;  3DC1 A;  3PD6 A;  4JEY A;  4PFN A;  1QZ9 A;  2C0R A;  3E2Z A;  3B8X A;  2CJG A;  4DBC A;  4AOA A;  4W5K A;  1BQA A;  2VMQ A;  3RQ1 A;  3PAA A;  2W7J A;  4RIT A;  3WLX A;  2BYJ A;  1C0N A;  4F5I A;  4WLJ A;  1V2F A;  3CBF A;  4BA5 A;  2RFV A;  2OGA A;  2BI3 A;  3FD0 A;  1CZC A;  4KAM A;  4OMA A;  3BWO A;  2X8U A;  3LVM A;  2CAN A;  3GBX A;  3EI9 A;  4RIZ A;  1OXP A;  1JS3 A;  2EGY A;  3FQ8 A;  4RM1 A;  3E2F A;  2W7E A;  1M7Y A;  1IX7 A;  1N2T A;  2EPJ A;  3DU4 A;  3HQT A;  1UU0 A;  3LV2 A;  4MKK A;  4EU1 A;  1AAW A;  4OCA A;  5M4D A;  1IAY A;  4A0R A;  1X29 A;  1ASN A;  3ISL A;  1C4K A;  3IF2 A;  3HBX A;  4BA4 A;  1I29 A;  1IBJ A;  3QN6 A;  3PDX A;  3AEM C;  1XI9 A;  1AKB A;  1M32 A;  1KMJ A;  1I48 A;  3Q8N A;  3NYT A;  2ZY3 A;  2E7J A;  2HOR A;  4ZDP A;  4H63 Q;  4R8D A;  3TFT A;  1DJU A;  2Z9V A;  2W8U A;  2QB2 A;  1SVV A;  2FNU A;  1LW5 A;  5M46 A;  2Z20 A;  1BW0 A;  2O7C A;  3FRK A;  2GMU A;  1AJS B;  3MAU A;  3HL2 A;  3MAF A;  5G09 A;  4DQ6 A;  3KGW A;  1B9H A;  4ADB A;  3VAX A;  4LNL A;  1TAR A;  1ELQ A;  1QJ3 A;  2W8V A;  3MC6 C;  4KYO A;  1D7R A;  5LHA A;  1M0Q A;  3EI8 A;  1M0P A;  2DKJ A;  3AAT A;  3ASA A;  4WYG A;  4ZAS A;  2VMZ A;  1TAT A;  2VYC A;  4IY7 A;  5DJ9 A;  3FQA A;  3JZL A;  4RKC A;  4TN4 A;  4BHD A;  1ARG A;  2WK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...