3ISLA

Crystal structure of ureidoglycine-glyoxylate aminotransferase (pucg) from bacillus subtilis
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
405
structure length
387
Chain Sequence
RELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAFTGIMNETMEMLRELFQTKNRWAYPIDGTSRAGIEAVLASVIEPEDDVLIPIYGRFGYLLTEIAERYGANVHMLECEWGTVFDPEDIIREIKKVKPKIVAMVHGETSTGRIHPLKAIGEACRTEDALFIVDAVATIGGCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARNRPITSNYFDLSQLEDYWSERRLNHHTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSCKMPVVTCVEIPGGIDGESVRDMLLAQFGIEIASSFGPLAGKIWRIGTMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKALQAALDVYEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine catabolism protein pucG
publication title Amino acids from purines in GUT bacteria
rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 139
structure length 387
sequence length 405
chains with identical sequence B
ec nomenclature ec 2.6.1.112: (S)-ureidoglycine--glyoxylate transaminase.
pdb deposition date 2009-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3islA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3islA01
3II0A 3BWOA 4OMAA 2PB0A 3HVYA 1BW0A 4RAEA 2JJEA 1S09A 3WCNA 2CJDA 2VMXA 2VGVA 2VI8A 2D64A 3WLXA 1IAYA 3UAKA 4F5KA 4OCAA 3NU7A 1CL2A 2CSTA 4RLGA 4PFFA 2BI1A 3QM2A 1D7SA 5K8BA 3AEMC 3NDNA 3TFTA 2BI2A 2E7UA 1S0AA 2Z1ZA 3NU8A 3WX9A 2AY3A 1RVYA 3CQ4A 1M32A 2VI9A 1DFOA 2FNUA 4XEWA 3WGCA 1GEYA 3DXWA 3JW9A 3B1CA 3VK3A 1ASAA 1WYTB 3I5TA 2AY2A 1UU0A 3A9ZA 3GZDC 4TMRA 1LK9A 2QLRA 1CS1A 1U08A 3EZ1A 1SZUA 4Y0IA 1JS6A 2CH2A 2E54A 2HZPA 3MC6C 3E2ZB 1Z7DA 5EIGA 1QITA 2OQXA 5EUEA 4F5LA 5M4DA 1B5OA 1D7RA 1V2EA 2BHXA 3NRAA 1SZSA 2YKVA 3P6KA 4R5ZA 1WYUB 5E4ZA 3EZSA 1IX7A 3H7FA 2W8UA 4WYDA 1CQ6A 3GZCA 4HVKA 3PD6B 1TOKA 3PDXA 5G09A 3GJUA 4F5JA 1CZEA 2AY7A 2W8WA 1AY5A 1ASNA 1KMJA 3RBFA 3COGA 5EUDA 1KKJA 2JGTA 4WB0B 3BC8A 3CQ6A 5DJ9A 4AZJA 4ZLVA 4DQ6A 1I29A 5C6UA 3FDDA 4ADCA 1WYUA 1I43A 4KYOA 1YJYA 2EZ2A 4NOGA 5E3KA 3AV7A 1B9HA 1CJ0A 3FKDA 3PD6A 2HUFA 1YJZA 4RKCA 1LW4A 4B98A 4JE5D 3ZRQA 3E77A 4E3QA 2X5FA 1AKBA 1ASFA 4FFCA 1GC3A 1MLZA 1TOEA 4MGRA 4Q31A 3QHXA 4PVFA 4OBUA 2VGSA 1PMMA 2C7TA 5G0AA 4OYTA 1AMRA 4WYGA 2VGZA 1IJIA 4W8IA 3VOMA 4A6RA 1C4KA 4BQ0A 4KAMA 4R2NA 4OT8A 2W7LA 2VMOA 1CZCA 4WXFA 4JF0A 3AELA 1LC7A 1YJSA 4BMKA 1QJ5A 2W7HA 3FZ6A 3HLMA 4EFFA 4MKKA 1TOJA 1WYVB 3W1JA 1KL1A 4RITA 4HF8A 4ZWMA 5DJ1A 4W1XA 3AENA 1J04A 3LVKA 5BJ3A 2BWNA 4R8DA 2Z1YA 3L44A 4A6UA 1VP4A 3JTXA 4XJMA 1ASEA 3M5UA 3CAIA 2W8VA 3ASBA 2ZUKA 2F8JA 4RJ0A 4F5IA 3MEBA 3WZFA 4LW4A 2ZYJA 5G4JA 1P3WA 1BJOA 3DR4A 4F5GA 3HQTA 4ZSWA 1BJWA 1OHYA 1AJRA 3F9TA 1AICA 1N8PA 3KKIA 1TOIA 4K2MA 1B8GA 1S06A 4FL0A 4WYFA 3E9KA 3PAAA 3RQ1A 2VMYA 4UOYA 4E3RA 5EAVA 4H51A 5EFSA 2X5DA 3LWSA 1G4XA 5FT5A 2VMRA 4EB5A 4BA4A 2YRIA 2QB3A 4XK1A 4AO4A 4U1TA 4P7YA 1AHEA 2FNIA 2GMSA 7AATA 1DJUA 1O61A 2D7YA 1C9CA 3BV0A 2XH1A 3T32A 3TQXA 5EUNA 4GDYA 3P1TA 3DODA 3USFA 2YKYA 4LW2A 1UKJA 1AKCA 2E7JA 3FSLA 2WK9A 2W7MA 4WD2A 2D63A 1FG3A 1S07A 5EQCA 4WYCA 3MADA 4O6ZA 1BJ4A 1MDZA 2E7IA 1KL2A 1BS0A 2V1PA 4MSOA 3AEJA 1OATA 5EIGB 4ZM3A 3FCRA 3ELPA 2YCTA 2AEUA 4QGRA 4R5FA 5G2QA 1TARA 3MAFB 3A8UX 3WGBA 2VMNA 5BJ4A 4WLJA 2Z20A 4AO9A 2DGKA 4ZWVA 4RIZA 4JE5A 3NYTA 4JEVA 3B8XA 3BN1A 3ASAA 4JEWA 3EI6A 5DX5A 3WY7A 1GC4A 2AEVA 2OKKA 3ELEA 3LG0A 4P3MA 1G7WA 4UHOA 3ZRPA 1V72A 3MAFA 4MQRA 4WXBA 4XAUA 4F5MA 2Z9WA 1LS3A 3ACZA 4WXGA 2VIBA 3B46A 2JJGA 4IYOB 3RI6A 4CXQA 3JWAA 3K28A 4J8LA 3NYUA 4DGTA 4F5HA 3H14A 3GBXA 3N0LA 1MLYA 1H1CA 2CANA 2GSAA 1ASGA 4EB7A 1AIAA 3EIAA 3PPLA 1ZODA 2PB2A 3BB8A 2CFBA 4MKJA 1AJSB 3NX3A 3DYDA 3FFRA 4JEZA 4GRXA 1RV4A 2QBTA 2WKAA 4MQQA 3BCAA 2W7IA 8AATA 2CJGA 3HMUA 4IYOA 3AOWA 2C0RA 2JJFA 2AY1A 1N2TA 4IY7A 2Z9VA 1WKGA 2ZSMA 3WKSA 2YCNA 3AEOA 2AY6A 2VLHA 5F8VA 3FZ7A 3TFUA 1AMQA 2FYFA 2HORA 1X28A 4OTLA 1E5EA 2GMUA 4XQ2A 5JAYA 1M0NA 2VMQA 1AJSA 2R5EA 3A2BA 4GSAA 2CY8A 4Y0HA 4MQPA 1ASCA 1AHYA 2CJHA 2O1BA 3PJ0A 1LC8A 4RKDA 3ATHA 1CQ7A 3D6KA 4IXZA 1M0QA 2BI3A 4L0OA 2GB3A 3A9XA 2HP2A 4ZASA 3DRDA 4Q76A 4A72A 1X2AA 1H0CA 3AENB 1C0NA 1ELQA 2EPJA 1B4XA 3DZZA 1GD9A 2OATA 3AEJC 1AY8A 4E1OA 1S08A 4TN4A 1ARIA 1W7MA 2VMWA 3BS8A 3KGXA 3FVUA 4B9BA 1VJOA 3IF2A 3N5MA 3IHJA 3WKRA 3FFHA 2AY5A 4UHMA 2D7ZA 5HHYA 3VK2A 1B5PA 1EG5A 1MAPA 2VMTA 1BQDA 2RFVA 5FT4A 1YAAA 1IUGA 4W5KA 3GWPA 1BQAA 4J5UA 2WK7A 3L8AA 3F0HA 1BJOB 3LVLB 5HXXA 3I4JA 1ZC9A 1ORDA 2NMPA 2FM1A 1AHGA 1OHVA 3PDBB 3BWNA 2AY8A 4N0WA 4A0GA 4LC3A 5J8QA 1QZ9A 4PIWA 2TPLA 2WK8A 3CQ5A 1JF9A 1ECXA 2CH1A 4AOAA 2VGWA 1MDXA 3F6TA 3UE8A 1GC0A 5IWQA 2W7GA 1LC5A 3MKJA 3LY1A 4BHDA 1I41A 2EZ1A 3PDBA 2AY4A 1ASBA 2YRRA 3EI9A 1ARGA 1GBNA 4RJYA 1MDOA 2GQNA 4W1VA 1JG8A 2Z61A 1KMKA 3QBOA 4EU1A 2HOYA 2VMPA 3JZLA 4GE7A 4ATQA 1ARSA 1SZKA 2EGYA 3EI8A 3NUBA 1XEYA 4ITXA 4ZSYA 1DGDA 2VLFA 1ASLA 3AEPA 3VAXA 1M4NA 3E2FA 2VMVA 2VMZA 1CL1A 2HP1A 5LHAA 4LNJA 1WSTA 2O7CA 4A0HA 2XBNA 1PG8A 2FQ6A 4OBVA 1PMOA 3B1EA 2R5CA 3RBLA 2W7JA 2JJHA 3FD0A 1G4VA 4MY5A 1M7YA 2BWOA 2BI5A 2VIAA 2VGTA 1IVRA 3N75A 4M2KA 1AMSA 2DGMA 1IBJA 5F9SA 3DR7A 1DJ9A 1WKHA 1C7NA 2ZSLA 1Y4IA 3G0TA 2BIGA 4GE4A 2QA3A 1AMAA 3ISLA 4JEXA 3QN6A 3FRKA 2BKWA 3NNKA 2O0RA 4DBCA 2D66A 3B1DA 2CB1A 3BWNC 3W1IA 1GEXA 3LV2A 1AHFA 3DU4A 2Z9XA 4A0RA 2VMUA 4ZM4A 1M0PA 1TATA 3TATA 2YOBA 1GCKA 3E6GA 2FN6A 4I8AA 2HOZA 5EAAA 2HOXA 3HT4A 3FQ8A 2BWPA 1W23A 4GEBA 3QPGA 4RM1A 4ATPA 3LVMA 4K2BA 4Q6RA 1D7VA 4BA5A 2ZY5A 3MBBA 2BIEA 4UHNA 5AX8A 3E2YA 1AX4A 4TV7A 3CBFA 2W7FA 1SPAA 4A0FA 1ASMA 1SVVA 3QGUA 3BCBA 1GDEA 1AKAA 2ZP7A 1D7UA 2C44A 2W8TA 3EI7A 3FQ7A 2VMSA 3FZ8A 3R9AA 2VYCA 1QISA 1ASDA 3FVSA 1GC2A 4OC9A 3G7QA 5I92A 4ZDOA 3Q8NA 2Z67A 3AATA 4F5FA 4ZAHA 4W1WA 1OHWA 1IX8A 4A6TA 2C81A 9AATA 2EO5A 1WYTA 2W7KA 3FVXA 1ARHA 3JWBA 2HUUA 2CINA 4IX8A 4XJPA 1O69A 5D95A 1W3UA 2BYJA 1O62A 5M46A 4WBTA 4Y0DA 3DC1A 2AY9A 2ZC0A 3E2ZA 3NUIA 3KGWA 3NYSA 2BI9A 4XJOA 2G6WA 1YIYA 2QB2A 3A9YA 3BCXA 1DJEA 2PO3A 1LW5A 1SFFA 3G8MA 1FC4A 1RVUA 2DKJA 5G4IA 3AOVA 3RCHB 2W7EA 5TF5A 3WCOA 3R4TA 1SF2A 3PIUA 3ZRRA 4ADBA 1E5FA 1C7OA 2JG2A 4LNLA 2R2NA 2CTZA 3DXVA 2BIAA 4PFNA 3K40A 4ADDA 4F4EA 3EIBA 3FQAA 2ZY2A 1KKPA 1DGEA 1O4SA 1YIZA 1IX6A 1I48A 1TASA 3FDBA 4UQVA 4WB0A 2D61A 3NTJA 3HL2A 1V2FA 1C7GA 1D2FA 4IXSA 4LNMA 3RCHA 3GR9A 1IAXA 1LKCA 5LH9A 1W7NA 2OKJA 4WYEA 1BJNA 1T3IA 5D5SA 4EMYA 5M4BA 1M6SA 1CQ8A 1TPLA 3GETA 4CBRA 1N31A 1X29A 3UWCA 2ORDA 2AATA 3W1HA 1ARTA 1MGVA 4ZDPA 1DKAA 4U2HA 2ZY3A 2YKUA 4AH3A 1BT4A 1UU1A 2R0TA 2ZY4A 2ZJGA 2HUIA 3PA9A 4W91A 3VK4A 3FTBA 4M2MA 1FG7A 1VEFA 2Q7WA 3PGYA 4WLHA 1ZOBA 2OGEA 4GE9A 3GSBA 1AIBA 1Z3ZA 2EH6A 2YKXA 3AEMA 1QGNA 3LVJA 5FT6A 4A00A 4AZKA 3VP6A 1EJIA 2QMAA 3ZZKA 2VGUA 1G7XA 2YCPA 3ECDA 1V2DA 3K7YA 3GZDA 4M2JA 1XI9A 1WYVA 5DB5A 1ELUA 2D65A 1AY4A 1QIRA 1RV3A 2DOUA 2Z9UA 1B9IA 3MC6A 4WYAA 5E5IA 3KE3A 2R5CB 4ADEA 3EI5A 3OKSA 1AAWA 2BYLA 1EQBA 4JF1A 4E77A 2JISA 4ITGA 1W7LA 1YNUA 2V0YA 1MAQA 4KXKA 4K2IA 3RUYA 2OGAA 2W7DA 3I16A 1QJ3A 2DKBA 4CBSA 1OXOA 3TCMA 1AHXA 1JS3A 2DR1A 5G2PA 1M0OA 4ZDLA 4CVQA 1BKGA 3ZZJA 1AAMA 5FT8A 1PFFA 3OP7A 2X3LA 3HDOA 4N0BA 4XJLA 4CXRA 1TOGA 1UU2A 4ISYA 1YOOA 4IXOA 1DTYA 1J32A 5M49A 2YHKA 3QI6A 3JU7A 3MAUA 4IW7A 1OXPA 1X0MA 3EUCA 4JEYA 4Q75A 2X8UA 2D5YA 1GEWA 5HDMA 3HBXA 2DGLA 4WP0A 2W8JA
chains in the Genus database with same CATH superfamily
3II0A 3N4SA 3BWOA 4OMAA 2PB0A 3HVYA 1BW0A 4RAEA 2JJEA 1S09A 3WCNA 2CJDA 2VMXA 2VGVA 2VI8A 2EYQA 2D64A 3WLXA 1IAYA 3UAKA 4F5KA 4OCAA 3NU7A 1CL2A 2CSTA 4RLGA 4PFFA 2BI1A 3QM2A 1D7SA 5K8BA 3AEMC 3NDNA 3TFTA 2BI2A 2E7UA 1S0AA 2Z1ZA 3NU8A 3WX9A 2AY3A 1RVYA 3CQ4A 1M32A 2VI9A 1DFOA 2FNUA 4XEWA 3WGCA 1GEYA 3DXWA 3JW9A 3B1CA 3VK3A 1ASAA 1WYTB 3I5TA 2AY2A 1UU0A 3A9ZA 3GZDC 4TMRA 1LK9A 2QLRA 1CS1A 1U08A 3EZ1A 1SZUA 4Y0IA 1JS6A 2CH2A 2E54A 2HZPA 3MC6C 3E2ZB 1Z7DA 5EIGA 1QITA 2OQXA 5EUEA 4F5LA 5M4DA 1B5OA 1D7RA 1V2EA 2BHXA 3NRAA 1SZSA 2YKVA 3P6KA 4R5ZA 1WYUB 5E4ZA 3EZSA 3H9XA 1IX7A 3H7FA 2W8UA 4WYDA 1CQ6A 3GZCA 4HVKA 3PD6B 1TOKA 3PDXA 5G09A 3GJUA 4F5JA 1CZEA 2AY7A 2W8WA 1AY5A 1ASNA 1KMJA 3RBFA 3COGA 5EUDA 1KKJA 2JGTA 4WB0B 3BC8A 3CQ6A 5DJ9A 4AZJA 4ZLVA 4DQ6A 1I29A 5C6UA 3FDDA 4ADCA 1WYUA 1I43A 4KYOA 1YJYA 2EZ2A 4NOGA 5E3KA 3AV7A 4H63Q 1B9HA 1CJ0A 3FKDA 3PD6A 2HUFA 2FKIA 1YJZA 4RKCA 1LW4A 4B98A 4JE5D 3ZRQA 3E77A 4E3QA 2X5FA 1AKBA 1ASFA 4FFCA 1GC3A 1MLZA 1TOEA 4MGRA 4Q31A 3QHXA 4PVFA 4OBUA 2VGSA 2QSRA 1PMMA 2C7TA 5G0AA 4OYTA 1AMRA 4WYGA 2VGZA 1IJIA 4W8IA 3VOMA 4A6RA 1C4KA 4BQ0A 4KAMA 4R2NA 4OT8A 2W7LA 2VMOA 1CZCA 4WXFA 4JF0A 3AELA 1LC7A 1YJSA 4BMKA 2G7JA 1QJ5A 2W7HA 3FZ6A 3HLMA 4EFFA 4MKKA 1TOJA 1WYVB 3W1JA 1KL1A 4RITA 4HF8A 4ZWMA 5DJ1A 4W1XA 3AENA 1J04A 3LVKA 5BJ3A 2BWNA 3N4XA 5KTBA 4R8DA 2Z1YA 3L44A 4A6UA 1VP4A 3JTXA 4XJMA 1ASEA 3M5UA 3CAIA 2W8VA 3ASBA 2ZUKA 2F8JA 4RJ0A 4F5IA 3MEBA 3WZFA 4LW4A 2ZYJA 5G4JA 1P3WA 1BJOA 3DR4A 4F5GA 3HQTA 4ZSWA 1BJWA 1OHYA 1AJRA 3F9TA 1AICA 1N8PA 3KKIA 1TOIA 4K2MA 1B8GA 1S06A 4FL0A 4WYFA 3E9KA 3PAAA 3RQ1A 2VMYA 4UOYA 4E3RA 5EAVA 4H51A 5EFSA 2X5DA 3LWSA 1G4XA 5FT5A 2VMRA 4EB5A 4BA4A 2YRIA 2QB3A 4XK1A 4AO4A 4U1TA 4P7YA 1AHEA 2FNIA 2GMSA 7AATA 1DJUA 1O61A 2D7YA 1C9CA 3BV0A 2XH1A 3T32A 3TQXA 5EUNA 4GDYA 3P1TA 3DODA 3USFA 2YKYA 4LW2A 1UKJA 1AKCA 2E7JA 3FSLA 2WK9A 2W7MA 4WD2A 2D63A 1FG3A 1S07A 5EQCA 4WYCA 3MADA 4O6ZA 1BJ4A 1MDZA 2E7IA 1KL2A 1BS0A 2V1PA 4MSOA 3AEJA 1OATA 5EIGB 4ZM3A 3FCRA 3ELPA 2YCTA 2AEUA 4QGRA 4R5FA 5G2QA 1TARA 3MAFB 3A8UX 3WGBA 2VMNA 5BJ4A 4WLJA 2Z20A 4AO9A 2DGKA 4ZWVA 4RIZA 4JE5A 3NYTA 4JEVA 3B8XA 3BN1A 3ASAA 4JEWA 3EI6A 5DX5A 3WY7A 1GC4A 2AEVA 2OKKA 3ELEA 3LG0A 4P3MA 1G7WA 4UHOA 3ZRPA 1V72A 3MAFA 4MQRA 4WXBA 4XAUA 4F5MA 2Z9WA 1LS3A 3ACZA 4WXGA 2VIBA 3B46A 2JJGA 4IYOB 3RI6A 4CXQA 3JWAA 3K28A 4J8LA 3NYUA 4DGTA 4F5HA 3H14A 3GBXA 3N0LA 1MLYA 1H1CA 2CANA 2GSAA 1ASGA 4EB7A 1AIAA 3EIAA 3PPLA 1ZODA 2PB2A 3BB8A 2CFBA 4MKJA 1AJSB 3NX3A 3DYDA 3FFRA 4JEZA 4GRXA 1RV4A 2QBTA 2WKAA 4MQQA 3BCAA 2W7IA 8AATA 2CJGA 3HMUA 4IYOA 3AOWA 2C0RA 2JJFA 2AY1A 1N2TA 4IY7A 2Z9VA 1WKGA 2ZSMA 3WKSA 2YCNA 3AEOA 2AY6A 2VLHA 5F8VA 3FZ7A 3TFUA 1AMQA 2FYFA 2HORA 1X28A 4OTLA 1E5EA 2GMUA 4XQ2A 5JAYA 1M0NA 2VMQA 1AJSA 2R5EA 3A2BA 4GSAA 2CY8A 4Y0HA 4MQPA 1ASCA 1AHYA 2CJHA 2O1BA 3PJ0A 1LC8A 4RKDA 3ATHA 1CQ7A 3D6KA 4IXZA 1M0QA 2BI3A 4L0OA 2GB3A 3A9XA 2KFPA 2HP2A 4ZASA 2WB6A 3DRDA 4Q76A 4A72A 1X2AA 1H0CA 3AENB 1C0NA 1ELQA 2EPJA 1B4XA 3DZZA 1GD9A 2OATA 3AEJC 1AY8A 4E1OA 1S08A 3N7NA 4TN4A 1ARIA 1W7MA 2VMWA 3BS8A 3KGXA 3FVUA 4B9BA 1VJOA 3IF2A 3N5MA 3IHJA 3WKRA 3FFHA 2AY5A 4UHMA 2D7ZA 5HHYA 3VK2A 1B5PA 1EG5A 1MAPA 2VMTA 1BQDA 2RFVA 5FT4A 1YAAA 1IUGA 4W5KA 3GWPA 1BQAA 4J5UA 2WK7A 3L8AA 3F0HA 1BJOB 3LVLB 5HXXA 3I4JA 1ZC9A 1ORDA 2NMPA 2FM1A 1AHGA 1OHVA 3PDBB 3BWNA 2AY8A 4N0WA 4A0GA 4LC3A 5J8QA 1QZ9A 4PIWA 2TPLA 2WK8A 3CQ5A 1JF9A 1ECXA 2CH1A 4AOAA 2VGWA 1MDXA 3F6TA 3UE8A 1GC0A 5IWQA 2W7GA 1LC5A 3MKJA 3LY1A 4BHDA 1I41A 2EZ1A 3PDBA 2AY4A 1ASBA 2YRRA 3EI9A 1ARGA 1GBNA 4RJYA 1MDOA 2GQNA 4W1VA 1JG8A 2Z61A 1KMKA 3QBOA 4EU1A 2HOYA 2VMPA 3JZLA 4GE7A 4ATQA 1ARSA 1SZKA 2EGYA 3EI8A 3NUBA 1XEYA 4ITXA 4ZSYA 1DGDA 2VLFA 1ASLA 3AEPA 3VAXA 1M4NA 3E2FA 2VMVA 2VMZA 1CL1A 2HP1A 5LHAA 4LNJA 1WSTA 2O7CA 4A0HA 2XBNA 2A1VA 1PG8A 2FQ6A 4OBVA 1PMOA 3B1EA 2R5CA 3RBLA 2W7JA 2JJHA 3FD0A 1G4VA 4MY5A 1M7YA 2BWOA 2BI5A 2VIAA 2VGTA 1IVRA 3N75A 4M2KA 1AMSA 2DGMA 1IBJA 5F9SA 3DR7A 1DJ9A 1WKHA 1C7NA 2ZSLA 1Y4IA 3G0TA 2BIGA 4GE4A 2QA3A 1AMAA 3ISLA 4JEXA 3QN6A 3FRKA 2BKWA 3NNKA 2O0RA 4DBCA 2D66A 3B1DA 2CB1A 3BWNC 3W1IA 1GEXA 3LV2A 1AHFA 3DU4A 2Z9XA 4A0RA 2VMUA 4ZM4A 1M0PA 1TATA 3TATA 2YOBA 1GCKA 3N4RA 3E6GA 2FN6A 4I8AA 1KAFA 2HOZA 5EAAA 2HOXA 3HT4A 3FQ8A 2BWPA 1W23A 4GEBA 3QPGA 4RM1A 4ATPA 3LVMA 4K2BA 4Q6RA 1D7VA 4BA5A 2ZY5A 3MBBA 2BIEA 4UHNA 5AX8A 3E2YA 1AX4A 4TV7A 3CBFA 2W7FA 1SPAA 4A0FA 1ASMA 1SVVA 3QGUA 3BCBA 1GDEA 1AKAA 2ZP7A 1D7UA 2C44A 2W8TA 3EI7A 3FQ7A 2VMSA 3FZ8A 3R9AA 2VYCA 1QISA 1ASDA 3FVSA 1GC2A 4OC9A 3G7QA 5I92A 4ZDOA 3Q8NA 2Z67A 3AATA 4F5FA 4ZAHA 4W1WA 1OHWA 1IX8A 4A6TA 2C81A 9AATA 2EO5A 1WYTA 2W7KA 3FVXA 1ARHA 3JWBA 2HUUA 2CINA 4IX8A 4XJPA 1O69A 5D95A 1W3UA 2BYJA 1O62A 5M46A 4WBTA 4Y0DA 3DC1A 2AY9A 2ZC0A 3E2ZA 3NUIA 3KGWA 3NYSA 2BI9A 4XJOA 2G6WA 1YIYA 2QB2A 3A9YA 3BCXA 1DJEA 2PO3A 1LW5A 1SFFA 3G8MA 1FC4A 1RVUA 2DKJA 5G4IA 3AOVA 3RCHB 2W7EA 5TF5A 3WCOA 3R4TA 1SF2A 3PIUA 3ZRRA 4ADBA 1E5FA 1C7OA 2JG2A 4LNLA 2R2NA 2CTZA 3DXVA 2BIAA 4PFNA 3K40A 4ADDA 4F4EA 3EIBA 3FQAA 2ZY2A 1KKPA 1DGEA 1O4SA 1YIZA 1IX6A 1I48A 1TASA 3FDBA 4UQVA 4WB0A 2D61A 3NTJA 3HL2A 1V2FA 1C7GA 1D2FA 4IXSA 4LNMA 3RCHA 3GR9A 1IAXA 1LKCA 5LH9A 1W7NA 2OKJA 4WYEA 1BJNA 1T3IA 5D5SA 4EMYA 5M4BA 1M6SA 1CQ8A 1TPLA 3GETA 4CBRA 1N31A 1X29A 3UWCA 2ORDA 2AATA 3W1HA 1ARTA 1MGVA 4ZDPA 1DKAA 4U2HA 2ZY3A 2YKUA 4AH3A 1BT4A 1UU1A 2R0TA 2ZY4A 2ZJGA 2HUIA 3PA9A 4W91A 3VK4A 3FTBA 4M2MA 1FG7A 1VEFA 2Q7WA 3PGYA 4WLHA 1ZOBA 2OGEA 4GE9A 3GSBA 1AIBA 1Z3ZA 2EH6A 2YKXA 3AEMA 1QGNA 3LVJA 5FT6A 4A00A 4AZKA 3VP6A 4K05A 1EJIA 2QMAA 3ZZKA 2VGUA 1G7XA 2YCPA 3ECDA 1V2DA 3K7YA 3GZDA 4M2JA 1XI9A 1WYVA 5DB5A 1ELUA 2D65A 1AY4A 1QIRA 1RV3A 2DOUA 2Z9UA 1B9IA 3MC6A 4WYAA 5E5IA 3KE3A 2R5CB 4ADEA 3EI5A 3OKSA 1AAWA 2BYLA 1EQBA 4JF1A 4E77A 2JISA 4ITGA 1W7LA 1YNUA 2V0YA 1MAQA 4KXKA 4K2IA 3RUYA 2OGAA 2W7DA 3I16A 1QJ3A 2DKBA 4CBSA 1OXOA 3TCMA 1AHXA 1JS3A 2DR1A 5G2PA 1M0OA 4ZDLA 4CVQA 1BKGA 3ZZJA 1AAMA 5FT8A 1PFFA 3OP7A 2X3LA 3HDOA 4N0BA 4XJLA 4CXRA 1TOGA 1UU2A 4ISYA 1YOOA 4IXOA 1DTYA 1J32A 5M49A 2YHKA 3QI6A 3JU7A 3MAUA 4IW7A 1OXPA 1X0MA 3EUCA 4JEYA 4Q75A 2X8UA 2D5YA 1GEWA 5HDMA 3HBXA 2DGLA 4WP0A 2W8JA
chains in the Genus database with same CATH topology
3II0A 3N4SA 3BWOA 4OMAA 2PB0A 3HVYA 1BW0A 4RAEA 2JJEA 1S09A 3WCNA 2CJDA 2VMXA 2VGVA 2VI8A 2EYQA 2D64A 3WLXA 1IAYA 3UAKA 4F5KA 4OCAA 3NU7A 1CL2A 2CSTA 4RLGA 4PFFA 2BI1A 3QM2A 1D7SA 5K8BA 3AEMC 3NDNA 3TFTA 2BI2A 2E7UA 1S0AA 2Z1ZA 3NU8A 3WX9A 2AY3A 1RVYA 3CQ4A 1M32A 2VI9A 1DFOA 2FNUA 4XEWA 3WGCA 1GEYA 3DXWA 3JW9A 3B1CA 3VK3A 1ASAA 1WYTB 3I5TA 2AY2A 1UU0A 3A9ZA 3GZDC 4TMRA 1LK9A 2QLRA 1CS1A 1U08A 3EZ1A 1SZUA 4Y0IA 1JS6A 2CH2A 2E54A 2HZPA 3MC6C 3E2ZB 1Z7DA 5EIGA 1QITA 2OQXA 5EUEA 4F5LA 5M4DA 1B5OA 1D7RA 1V2EA 2BHXA 3NRAA 1SZSA 2YKVA 3P6KA 4R5ZA 1WYUB 5E4ZA 3EZSA 3H9XA 1IX7A 3H7FA 2W8UA 4WYDA 1CQ6A 3GZCA 4HVKA 3PD6B 1TOKA 3PDXA 5G09A 3GJUA 4F5JA 1CZEA 2AY7A 2W8WA 1AY5A 1ASNA 1KMJA 3RBFA 3COGA 5EUDA 1KKJA 2JGTA 4WB0B 3BC8A 3CQ6A 5DJ9A 4AZJA 4ZLVA 4DQ6A 1I29A 5C6UA 3FDDA 4ADCA 1WYUA 1I43A 4KYOA 1YJYA 2EZ2A 4NOGA 5E3KA 3AV7A 4H63Q 1B9HA 1CJ0A 3FKDA 3PD6A 2HUFA 2FKIA 1YJZA 4RKCA 1LW4A 4B98A 4JE5D 3ZRQA 3E77A 4E3QA 2X5FA 1AKBA 1ASFA 4FFCA 1GC3A 1MLZA 1TOEA 4MGRA 4Q31A 3QHXA 4PVFA 4OBUA 2VGSA 2QSRA 1PMMA 2C7TA 5G0AA 4OYTA 1AMRA 4WYGA 2VGZA 1IJIA 4W8IA 3VOMA 4A6RA 1C4KA 4BQ0A 4KAMA 4R2NA 4OT8A 2W7LA 2VMOA 1CZCA 4WXFA 4JF0A 3AELA 1LC7A 1YJSA 4BMKA 2G7JA 1QJ5A 2W7HA 3FZ6A 3HLMA 4EFFA 4MKKA 1TOJA 1WYVB 3W1JA 1KL1A 4RITA 4HF8A 4ZWMA 5DJ1A 4W1XA 3AENA 1J04A 3LVKA 5BJ3A 2BWNA 3N4XA 5KTBA 4R8DA 2Z1YA 3L44A 4A6UA 1VP4A 3JTXA 4XJMA 1ASEA 3M5UA 3CAIA 2W8VA 3ASBA 2ZUKA 2F8JA 4RJ0A 4F5IA 3MEBA 3WZFA 4LW4A 2ZYJA 5G4JA 1P3WA 1BJOA 3DR4A 4F5GA 3HQTA 4ZSWA 1BJWA 1OHYA 1AJRA 3F9TA 1AICA 1N8PA 3KKIA 1TOIA 4K2MA 1B8GA 1S06A 4FL0A 4WYFA 3E9KA 3PAAA 3RQ1A 2VMYA 4UOYA 4E3RA 5EAVA 4H51A 5EFSA 2X5DA 3LWSA 1G4XA 5FT5A 2VMRA 4EB5A 4BA4A 2YRIA 2QB3A 4XK1A 4AO4A 4U1TA 4P7YA 1AHEA 2FNIA 2GMSA 7AATA 1DJUA 1O61A 2D7YA 1C9CA 3BV0A 2XH1A 3T32A 3TQXA 5EUNA 4GDYA 3P1TA 3DODA 3USFA 2YKYA 4LW2A 1UKJA 1AKCA 2E7JA 3FSLA 2WK9A 2W7MA 4WD2A 2D63A 1FG3A 1S07A 5EQCA 4WYCA 3MADA 4O6ZA 1BJ4A 1MDZA 2E7IA 1KL2A 1BS0A 2V1PA 4MSOA 3AEJA 1OATA 5EIGB 4ZM3A 3FCRA 3ELPA 2YCTA 2AEUA 4QGRA 4R5FA 5G2QA 1TARA 3MAFB 3A8UX 3WGBA 2VMNA 5BJ4A 4WLJA 2Z20A 4AO9A 2DGKA 4ZWVA 4RIZA 4JE5A 3NYTA 4JEVA 3B8XA 3BN1A 3ASAA 4JEWA 3EI6A 5DX5A 3WY7A 1GC4A 2AEVA 2OKKA 3ELEA 3LG0A 4P3MA 1G7WA 4UHOA 3ZRPA 1V72A 3MAFA 4MQRA 4WXBA 4XAUA 4F5MA 2Z9WA 1LS3A 3ACZA 4WXGA 2VIBA 3B46A 2JJGA 4IYOB 3RI6A 4CXQA 3JWAA 3K28A 4J8LA 3NYUA 4DGTA 4F5HA 3H14A 3GBXA 3N0LA 1MLYA 1H1CA 2CANA 2GSAA 1ASGA 4EB7A 1AIAA 3EIAA 3PPLA 1ZODA 2PB2A 3BB8A 2CFBA 4MKJA 1AJSB 3NX3A 3DYDA 3FFRA 4JEZA 4GRXA 1RV4A 2QBTA 2WKAA 4MQQA 3BCAA 2W7IA 8AATA 2CJGA 3HMUA 4IYOA 3AOWA 2C0RA 2JJFA 2AY1A 1N2TA 4IY7A 2Z9VA 1WKGA 2ZSMA 3WKSA 2YCNA 3AEOA 2AY6A 2VLHA 5F8VA 3FZ7A 3TFUA 1AMQA 2FYFA 2HORA 1X28A 4OTLA 1E5EA 2GMUA 4XQ2A 5JAYA 1M0NA 2VMQA 1AJSA 2R5EA 3A2BA 4GSAA 2CY8A 4Y0HA 4MQPA 1ASCA 1AHYA 2CJHA 2O1BA 3PJ0A 1LC8A 4RKDA 3ATHA 1CQ7A 3D6KA 4IXZA 1M0QA 2BI3A 4L0OA 2GB3A 3A9XA 2KFPA 2HP2A 4ZASA 2WB6A 3DRDA 4Q76A 4A72A 1X2AA 1H0CA 3AENB 1C0NA 1ELQA 2EPJA 1B4XA 3DZZA 1GD9A 2OATA 3AEJC 1AY8A 4E1OA 1S08A 3N7NA 4TN4A 1ARIA 1W7MA 2VMWA 3BS8A 3KGXA 3FVUA 4B9BA 1VJOA 3IF2A 3N5MA 3IHJA 3WKRA 3FFHA 2AY5A 4UHMA 2D7ZA 5HHYA 3VK2A 1B5PA 1EG5A 1MAPA 2VMTA 1BQDA 2RFVA 5FT4A 1YAAA 1IUGA 4W5KA 3GWPA 1BQAA 4J5UA 2WK7A 3L8AA 3F0HA 1BJOB 3LVLB 5HXXA 3I4JA 1ZC9A 1ORDA 2NMPA 2FM1A 1AHGA 1OHVA 3PDBB 3BWNA 2AY8A 4N0WA 4A0GA 4LC3A 5J8QA 1QZ9A 4PIWA 2TPLA 2WK8A 3CQ5A 1JF9A 1ECXA 2CH1A 4AOAA 2VGWA 1MDXA 3F6TA 3UE8A 1GC0A 5IWQA 2W7GA 1LC5A 3MKJA 3LY1A 4BHDA 1I41A 2EZ1A 3PDBA 2AY4A 1ASBA 2YRRA 3EI9A 1ARGA 1GBNA 4RJYA 1MDOA 2GQNA 4W1VA 1JG8A 2Z61A 1KMKA 3QBOA 4EU1A 2HOYA 2VMPA 3JZLA 4GE7A 4ATQA 1ARSA 1SZKA 2EGYA 3EI8A 3NUBA 1XEYA 4ITXA 4ZSYA 1DGDA 2VLFA 1ASLA 3AEPA 3VAXA 1M4NA 3E2FA 2VMVA 2VMZA 1CL1A 2HP1A 5LHAA 4LNJA 1WSTA 2O7CA 4A0HA 2XBNA 2A1VA 1PG8A 2FQ6A 4OBVA 1PMOA 3B1EA 2R5CA 3RBLA 2W7JA 2JJHA 3FD0A 1G4VA 4MY5A 1M7YA 2BWOA 2BI5A 2VIAA 2VGTA 1IVRA 3N75A 4M2KA 1AMSA 2DGMA 1IBJA 5F9SA 3DR7A 1DJ9A 1WKHA 1C7NA 2ZSLA 1Y4IA 3G0TA 2BIGA 4GE4A 2QA3A 1AMAA 3ISLA 4JEXA 3QN6A 3FRKA 2BKWA 3NNKA 2O0RA 4DBCA 2D66A 3B1DA 2CB1A 3BWNC 3W1IA 1GEXA 3LV2A 1AHFA 3DU4A 2Z9XA 4A0RA 2VMUA 4ZM4A 1M0PA 1TATA 3TATA 2YOBA 1GCKA 3N4RA 3E6GA 2FN6A 4I8AA 2HOZA 5EAAA 2HOXA 3HT4A 3FQ8A 2BWPA 1W23A 4GEBA 3QPGA 4RM1A 4ATPA 3LVMA 4K2BA 4Q6RA 1D7VA 4BA5A 2ZY5A 3MBBA 2BIEA 4UHNA 5AX8A 3E2YA 1AX4A 4TV7A 3CBFA 2W7FA 1SPAA 4A0FA 1ASMA 1SVVA 3QGUA 3BCBA 1GDEA 1AKAA 2ZP7A 1D7UA 2C44A 2W8TA 3EI7A 3FQ7A 2VMSA 3FZ8A 3R9AA 2VYCA 1QISA 1ASDA 3FVSA 1GC2A 4OC9A 3G7QA 5I92A 4ZDOA 3Q8NA 2Z67A 3AATA 4F5FA 4ZAHA 4W1WA 1OHWA 1IX8A 4A6TA 2C81A 9AATA 2EO5A 1WYTA 2W7KA 3FVXA 1ARHA 3JWBA 2HUUA 2CINA 4IX8A 4XJPA 1O69A 5D95A 1W3UA 2BYJA 1O62A 5M46A 4WBTA 4Y0DA 3DC1A 2AY9A 2ZC0A 3E2ZA 3NUIA 3KGWA 3NYSA 2BI9A 4XJOA 2G6WA 1YIYA 2QB2A 3A9YA 3BCXA 1DJEA 2PO3A 1LW5A 1SFFA 3G8MA 1FC4A 1RVUA 2DKJA 5G4IA 3AOVA 3RCHB 2W7EA 5TF5A 3WCOA 3R4TA 1SF2A 3PIUA 3ZRRA 4ADBA 1E5FA 1C7OA 2JG2A 4LNLA 2R2NA 2CTZA 3DXVA 2BIAA 4PFNA 3K40A 4ADDA 4F4EA 3EIBA 3FQAA 2ZY2A 1KKPA 1DGEA 1O4SA 1YIZA 1IX6A 1I48A 1TASA 3FDBA 4UQVA 4WB0A 2D61A 3NTJA 3HL2A 1V2FA 1C7GA 1D2FA 4IXSA 4LNMA 3RCHA 3GR9A 1IAXA 1LKCA 5LH9A 1W7NA 2OKJA 4WYEA 1BJNA 1T3IA 5D5SA 4EMYA 5M4BA 1M6SA 1CQ8A 1TPLA 3GETA 4CBRA 1N31A 1X29A 3UWCA 2ORDA 2AATA 3W1HA 1ARTA 1MGVA 4ZDPA 1DKAA 4U2HA 2ZY3A 2YKUA 4AH3A 1BT4A 1UU1A 2R0TA 2ZY4A 2ZJGA 2HUIA 3PA9A 4W91A 3VK4A 3FTBA 4M2MA 1FG7A 1VEFA 2Q7WA 3PGYA 4WLHA 1ZOBA 2OGEA 4GE9A 3GSBA 1AIBA 1Z3ZA 2EH6A 2YKXA 3AEMA 1QGNA 3LVJA 5FT6A 4A00A 4AZKA 3VP6A 4K05A 1EJIA 2QMAA 3ZZKA 2VGUA 1G7XA 2YCPA 3ECDA 1V2DA 3K7YA 3GZDA 4M2JA 1XI9A 1WYVA 5DB5A 1ELUA 2D65A 1AY4A 1QIRA 1RV3A 2DOUA 2Z9UA 1B9IA 3MC6A 4WYAA 5E5IA 3KE3A 2R5CB 4ADEA 3EI5A 3OKSA 1AAWA 2BYLA 1EQBA 4JF1A 4E77A 2JISA 4ITGA 1W7LA 1YNUA 2V0YA 1MAQA 4KXKA 4K2IA 3RUYA 2OGAA 2W7DA 3I16A 1QJ3A 2DKBA 4CBSA 1OXOA 3TCMA 1AHXA 1JS3A 2DR1A 5G2PA 1M0OA 4ZDLA 4CVQA 1BKGA 3ZZJA 1AAMA 5FT8A 1PFFA 3OP7A 2X3LA 3HDOA 4N0BA 4XJLA 4CXRA 1TOGA 1UU2A 4ISYA 1YOOA 4IXOA 1DTYA 1J32A 5M49A 2YHKA 3QI6A 3JU7A 3MAUA 4IW7A 1OXPA 1X0MA 3EUCA 4JEYA 4Q75A 2X8UA 2D5YA 1GEWA 5HDMA 3HBXA 2DGLA 4WP0A 2W8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3II0 A;  3BWO A;  4OMA A;  2PB0 A;  3HVY A;  1BW0 A;  4RAE A;  2JJE A;  1S09 A;  3WCN A;  2CJD A;  2VMX A;  2VGV A;  2VI8 A;  2D64 A;  3WLX A;  1IAY A;  3UAK A;  4F5K A;  4OCA A;  3NU7 A;  1CL2 A;  2CST A;  4RLG A;  4PFF A;  2BI1 A;  3QM2 A;  1D7S A;  5K8B A;  3AEM C;  3NDN A;  3TFT A;  2BI2 A;  2E7U A;  1S0A A;  2Z1Z A;  3NU8 A;  3WX9 A;  2AY3 A;  1RVY A;  3CQ4 A;  1M32 A;  2VI9 A;  1DFO A;  2FNU A;  4XEW A;  3WGC A;  1GEY A;  3DXW A;  3JW9 A;  3B1C A;  3VK3 A;  1ASA A;  1WYT B;  3I5T A;  2AY2 A;  1UU0 A;  3A9Z A;  3GZD C;  4TMR A;  1LK9 A;  2QLR A;  1CS1 A;  1U08 A;  3EZ1 A;  1SZU A;  4Y0I A;  1JS6 A;  2CH2 A;  2E54 A;  2HZP A;  3MC6 C;  3E2Z B;  1Z7D A;  5EIG A;  1QIT A;  2OQX A;  5EUE A;  4F5L A;  5M4D A;  1B5O A;  1D7R A;  1V2E A;  2BHX A;  3NRA A;  1SZS A;  2YKV A;  3P6K A;  4R5Z A;  1WYU B;  5E4Z A;  3EZS A;  1IX7 A;  3H7F A;  2W8U A;  4WYD A;  1CQ6 A;  3GZC A;  4HVK A;  3PD6 B;  1TOK A;  3PDX A;  5G09 A;  3GJU A;  4F5J A;  1CZE A;  2AY7 A;  2W8W A;  1AY5 A;  1ASN A;  1KMJ A;  3RBF A;  3COG A;  5EUD A;  1KKJ A;  2JGT A;  4WB0 B;  3BC8 A;  3CQ6 A;  5DJ9 A;  4AZJ A;  4ZLV A;  4DQ6 A;  1I29 A;  5C6U A;  3FDD A;  4ADC A;  1WYU A;  1I43 A;  4KYO A;  1YJY A;  2EZ2 A;  4NOG A;  5E3K A;  3AV7 A;  1B9H A;  1CJ0 A;  3FKD A;  3PD6 A;  2HUF A;  1YJZ A;  4RKC A;  1LW4 A;  4B98 A;  4JE5 D;  3ZRQ A;  3E77 A;  4E3Q A;  2X5F A;  1AKB A;  1ASF A;  4FFC A;  1GC3 A;  1MLZ A;  1TOE A;  4MGR A;  4Q31 A;  3QHX A;  4PVF A;  4OBU A;  2VGS A;  1PMM A;  2C7T A;  5G0A A;  4OYT A;  1AMR A;  4WYG A;  2VGZ A;  1IJI A;  4W8I A;  3VOM A;  4A6R A;  1C4K A;  4BQ0 A;  4KAM A;  4R2N A;  4OT8 A;  2W7L A;  2VMO A;  1CZC A;  4WXF A;  4JF0 A;  3AEL A;  1LC7 A;  1YJS A;  4BMK A;  1QJ5 A;  2W7H A;  3FZ6 A;  3HLM A;  4EFF A;  4MKK A;  1TOJ A;  1WYV B;  3W1J A;  1KL1 A;  4RIT A;  4HF8 A;  4ZWM A;  5DJ1 A;  4W1X A;  3AEN A;  1J04 A;  3LVK A;  5BJ3 A;  2BWN A;  4R8D A;  2Z1Y A;  3L44 A;  4A6U A;  1VP4 A;  3JTX A;  4XJM A;  1ASE A;  3M5U A;  3CAI A;  2W8V A;  3ASB A;  2ZUK A;  2F8J A;  4RJ0 A;  4F5I A;  3MEB A;  3WZF A;  4LW4 A;  2ZYJ A;  5G4J A;  1P3W A;  1BJO A;  3DR4 A;  4F5G A;  3HQT A;  4ZSW A;  1BJW A;  1OHY A;  1AJR A;  3F9T A;  1AIC A;  1N8P A;  3KKI A;  1TOI A;  4K2M A;  1B8G A;  1S06 A;  4FL0 A;  4WYF A;  3E9K A;  3PAA A;  3RQ1 A;  2VMY A;  4UOY A;  4E3R A;  5EAV A;  4H51 A;  5EFS A;  2X5D A;  3LWS A;  1G4X A;  5FT5 A;  2VMR A;  4EB5 A;  4BA4 A;  2YRI A;  2QB3 A;  4XK1 A;  4AO4 A;  4U1T A;  4P7Y A;  1AHE A;  2FNI A;  2GMS A;  7AAT A;  1DJU A;  1O61 A;  2D7Y A;  1C9C A;  3BV0 A;  2XH1 A;  3T32 A;  3TQX A;  5EUN A;  4GDY A;  3P1T A;  3DOD A;  3USF A;  2YKY A;  4LW2 A;  1UKJ A;  1AKC A;  2E7J A;  3FSL A;  2WK9 A;  2W7M A;  4WD2 A;  2D63 A;  1FG3 A;  1S07 A;  5EQC A;  4WYC A;  3MAD A;  4O6Z A;  1BJ4 A;  1MDZ A;  2E7I A;  1KL2 A;  1BS0 A;  2V1P A;  4MSO A;  3AEJ A;  1OAT A;  5EIG B;  4ZM3 A;  3FCR A;  3ELP A;  2YCT A;  2AEU A;  4QGR A;  4R5F A;  5G2Q A;  1TAR A;  3MAF B;  3A8U X;  3WGB A;  2VMN A;  5BJ4 A;  4WLJ A;  2Z20 A;  4AO9 A;  2DGK A;  4ZWV A;  4RIZ A;  4JE5 A;  3NYT A;  4JEV A;  3B8X A;  3BN1 A;  3ASA A;  4JEW A;  3EI6 A;  5DX5 A;  3WY7 A;  1GC4 A;  2AEV A;  2OKK A;  3ELE A;  3LG0 A;  4P3M A;  1G7W A;  4UHO A;  3ZRP A;  1V72 A;  3MAF A;  4MQR A;  4WXB A;  4XAU A;  4F5M A;  2Z9W A;  1LS3 A;  3ACZ A;  4WXG A;  2VIB A;  3B46 A;  2JJG A;  4IYO B;  3RI6 A;  4CXQ A;  3JWA A;  3K28 A;  4J8L A;  3NYU A;  4DGT A;  4F5H A;  3H14 A;  3GBX A;  3N0L A;  1MLY A;  1H1C A;  2CAN A;  2GSA A;  1ASG A;  4EB7 A;  1AIA A;  3EIA A;  3PPL A;  1ZOD A;  2PB2 A;  3BB8 A;  2CFB A;  4MKJ A;  1AJS B;  3NX3 A;  3DYD A;  3FFR A;  4JEZ A;  4GRX A;  1RV4 A;  2QBT A;  2WKA A;  4MQQ A;  3BCA A;  2W7I A;  8AAT A;  2CJG A;  3HMU A;  4IYO A;  3AOW A;  2C0R A;  2JJF A;  2AY1 A;  1N2T A;  4IY7 A;  2Z9V A;  1WKG A;  2ZSM A;  3WKS A;  2YCN A;  3AEO A;  2AY6 A;  2VLH A;  5F8V A;  3FZ7 A;  3TFU A;  1AMQ A;  2FYF A;  2HOR A;  1X28 A;  4OTL A;  1E5E A;  2GMU A;  4XQ2 A;  5JAY A;  1M0N A;  2VMQ A;  1AJS A;  2R5E A;  3A2B A;  4GSA A;  2CY8 A;  4Y0H A;  4MQP A;  1ASC A;  1AHY A;  2CJH A;  2O1B A;  3PJ0 A;  1LC8 A;  4RKD A;  3ATH A;  1CQ7 A;  3D6K A;  4IXZ A;  1M0Q A;  2BI3 A;  4L0O A;  2GB3 A;  3A9X A;  2HP2 A;  4ZAS A;  3DRD A;  4Q76 A;  4A72 A;  1X2A A;  1H0C A;  3AEN B;  1C0N A;  1ELQ A;  2EPJ A;  1B4X A;  3DZZ A;  1GD9 A;  2OAT A;  3AEJ C;  1AY8 A;  4E1O A;  1S08 A;  4TN4 A;  1ARI A;  1W7M A;  2VMW A;  3BS8 A;  3KGX A;  3FVU A;  4B9B A;  1VJO A;  3IF2 A;  3N5M A;  3IHJ A;  3WKR A;  3FFH A;  2AY5 A;  4UHM A;  2D7Z A;  5HHY A;  3VK2 A;  1B5P A;  1EG5 A;  1MAP A;  2VMT A;  1BQD A;  2RFV A;  5FT4 A;  1YAA A;  1IUG A;  4W5K A;  3GWP A;  1BQA A;  4J5U A;  2WK7 A;  3L8A A;  3F0H A;  1BJO B;  3LVL B;  5HXX A;  3I4J A;  1ZC9 A;  1ORD A;  2NMP A;  2FM1 A;  1AHG A;  1OHV A;  3PDB B;  3BWN A;  2AY8 A;  4N0W A;  4A0G A;  4LC3 A;  5J8Q A;  1QZ9 A;  4PIW A;  2TPL A;  2WK8 A;  3CQ5 A;  1JF9 A;  1ECX A;  2CH1 A;  4AOA A;  2VGW A;  1MDX A;  3F6T A;  3UE8 A;  1GC0 A;  5IWQ A;  2W7G A;  1LC5 A;  3MKJ A;  3LY1 A;  4BHD A;  1I41 A;  2EZ1 A;  3PDB A;  2AY4 A;  1ASB A;  2YRR A;  3EI9 A;  1ARG A;  1GBN A;  4RJY A;  1MDO A;  2GQN A;  4W1V A;  1JG8 A;  2Z61 A;  1KMK A;  3QBO A;  4EU1 A;  2HOY A;  2VMP A;  3JZL A;  4GE7 A;  4ATQ A;  1ARS A;  1SZK A;  2EGY A;  3EI8 A;  3NUB A;  1XEY A;  4ITX A;  4ZSY A;  1DGD A;  2VLF A;  1ASL A;  3AEP A;  3VAX A;  1M4N A;  3E2F A;  2VMV A;  2VMZ A;  1CL1 A;  2HP1 A;  5LHA A;  4LNJ A;  1WST A;  2O7C A;  4A0H A;  2XBN A;  1PG8 A;  2FQ6 A;  4OBV A;  1PMO A;  3B1E A;  2R5C A;  3RBL A;  2W7J A;  2JJH A;  3FD0 A;  1G4V A;  4MY5 A;  1M7Y A;  2BWO A;  2BI5 A;  2VIA A;  2VGT A;  1IVR A;  3N75 A;  4M2K A;  1AMS A;  2DGM A;  1IBJ A;  5F9S A;  3DR7 A;  1DJ9 A;  1WKH A;  1C7N A;  2ZSL A;  1Y4I A;  3G0T A;  2BIG A;  4GE4 A;  2QA3 A;  1AMA A;  3ISL A;  4JEX A;  3QN6 A;  3FRK A;  2BKW A;  3NNK A;  2O0R A;  4DBC A;  2D66 A;  3B1D A;  2CB1 A;  3BWN C;  3W1I A;  1GEX A;  3LV2 A;  1AHF A;  3DU4 A;  2Z9X A;  4A0R A;  2VMU A;  4ZM4 A;  1M0P A;  1TAT A;  3TAT A;  2YOB A;  1GCK A;  3E6G A;  2FN6 A;  4I8A A;  2HOZ A;  5EAA A;  2HOX A;  3HT4 A;  3FQ8 A;  2BWP A;  1W23 A;  4GEB A;  3QPG A;  4RM1 A;  4ATP A;  3LVM A;  4K2B A;  4Q6R A;  1D7V A;  4BA5 A;  2ZY5 A;  3MBB A;  2BIE A;  4UHN A;  5AX8 A;  3E2Y A;  1AX4 A;  4TV7 A;  3CBF A;  2W7F A;  1SPA A;  4A0F A;  1ASM A;  1SVV A;  3QGU A;  3BCB A;  1GDE A;  1AKA A;  2ZP7 A;  1D7U A;  2C44 A;  2W8T A;  3EI7 A;  3FQ7 A;  2VMS A;  3FZ8 A;  3R9A A;  2VYC A;  1QIS A;  1ASD A;  3FVS A;  1GC2 A;  4OC9 A;  3G7Q A;  5I92 A;  4ZDO A;  3Q8N A;  2Z67 A;  3AAT A;  4F5F A;  4ZAH A;  4W1W A;  1OHW A;  1IX8 A;  4A6T A;  2C81 A;  9AAT A;  2EO5 A;  1WYT A;  2W7K A;  3FVX A;  1ARH A;  3JWB A;  2HUU A;  2CIN A;  4IX8 A;  4XJP A;  1O69 A;  5D95 A;  1W3U A;  2BYJ A;  1O62 A;  5M46 A;  4WBT A;  4Y0D A;  3DC1 A;  2AY9 A;  2ZC0 A;  3E2Z A;  3NUI A;  3KGW A;  3NYS A;  2BI9 A;  4XJO A;  2G6W A;  1YIY A;  2QB2 A;  3A9Y A;  3BCX A;  1DJE A;  2PO3 A;  1LW5 A;  1SFF A;  3G8M A;  1FC4 A;  1RVU A;  2DKJ A;  5G4I A;  3AOV A;  3RCH B;  2W7E A;  5TF5 A;  3WCO A;  3R4T A;  1SF2 A;  3PIU A;  3ZRR A;  4ADB A;  1E5F A;  1C7O A;  2JG2 A;  4LNL A;  2R2N A;  2CTZ A;  3DXV A;  2BIA A;  4PFN A;  3K40 A;  4ADD A;  4F4E A;  3EIB A;  3FQA A;  2ZY2 A;  1KKP A;  1DGE A;  1O4S A;  1YIZ A;  1IX6 A;  1I48 A;  1TAS A;  3FDB A;  4UQV A;  4WB0 A;  2D61 A;  3NTJ A;  3HL2 A;  1V2F A;  1C7G A;  1D2F A;  4IXS A;  4LNM A;  3RCH A;  3GR9 A;  1IAX A;  1LKC A;  5LH9 A;  1W7N A;  2OKJ A;  4WYE A;  1BJN A;  1T3I A;  5D5S A;  4EMY A;  5M4B A;  1M6S A;  1CQ8 A;  1TPL A;  3GET A;  4CBR A;  1N31 A;  1X29 A;  3UWC A;  2ORD A;  2AAT A;  3W1H A;  1ART A;  1MGV A;  4ZDP A;  1DKA A;  4U2H A;  2ZY3 A;  2YKU A;  4AH3 A;  1BT4 A;  1UU1 A;  2R0T A;  2ZY4 A;  2ZJG A;  2HUI A;  3PA9 A;  4W91 A;  3VK4 A;  3FTB A;  4M2M A;  1FG7 A;  1VEF A;  2Q7W A;  3PGY A;  4WLH A;  1ZOB A;  2OGE A;  4GE9 A;  3GSB A;  1AIB A;  1Z3Z A;  2EH6 A;  2YKX A;  3AEM A;  1QGN A;  3LVJ A;  5FT6 A;  4A00 A;  4AZK A;  3VP6 A;  1EJI A;  2QMA A;  3ZZK A;  2VGU A;  1G7X A;  2YCP A;  3ECD A;  1V2D A;  3K7Y A;  3GZD A;  4M2J A;  1XI9 A;  1WYV A;  5DB5 A;  1ELU A;  2D65 A;  1AY4 A;  1QIR A;  1RV3 A;  2DOU A;  2Z9U A;  1B9I A;  3MC6 A;  4WYA A;  5E5I A;  3KE3 A;  2R5C B;  4ADE A;  3EI5 A;  3OKS A;  1AAW A;  2BYL A;  1EQB A;  4JF1 A;  4E77 A;  2JIS A;  4ITG A;  1W7L A;  1YNU A;  2V0Y A;  1MAQ A;  4KXK A;  4K2I A;  3RUY A;  2OGA A;  2W7D A;  3I16 A;  1QJ3 A;  2DKB A;  4CBS A;  1OXO A;  3TCM A;  1AHX A;  1JS3 A;  2DR1 A;  5G2P A;  1M0O A;  4ZDL A;  4CVQ A;  1BKG A;  3ZZJ A;  1AAM A;  5FT8 A;  1PFF A;  3OP7 A;  2X3L A;  3HDO A;  4N0B A;  4XJL A;  4CXR A;  1TOG A;  1UU2 A;  4ISY A;  1YOO A;  4IXO A;  1DTY A;  1J32 A;  5M49 A;  2YHK A;  3QI6 A;  3JU7 A;  3MAU A;  4IW7 A;  1OXP A;  1X0M A;  3EUC A;  4JEY A;  4Q75 A;  2X8U A;  2D5Y A;  1GEW A;  5HDM A;  3HBX A;  2DGL A;  4WP0 A;  2W8J A; 
#chains in the Genus database with same CATH topology
 3II0 A;  3N4S A;  3BWO A;  4OMA A;  2PB0 A;  3HVY A;  1BW0 A;  4RAE A;  2JJE A;  1S09 A;  3WCN A;  2CJD A;  2VMX A;  2VGV A;  2VI8 A;  2EYQ A;  2D64 A;  3WLX A;  1IAY A;  3UAK A;  4F5K A;  4OCA A;  3NU7 A;  1CL2 A;  2CST A;  4RLG A;  4PFF A;  2BI1 A;  3QM2 A;  1D7S A;  5K8B A;  3AEM C;  3NDN A;  3TFT A;  2BI2 A;  2E7U A;  1S0A A;  2Z1Z A;  3NU8 A;  3WX9 A;  2AY3 A;  1RVY A;  3CQ4 A;  1M32 A;  2VI9 A;  1DFO A;  2FNU A;  4XEW A;  3WGC A;  1GEY A;  3DXW A;  3JW9 A;  3B1C A;  3VK3 A;  1ASA A;  1WYT B;  3I5T A;  2AY2 A;  1UU0 A;  3A9Z A;  3GZD C;  4TMR A;  1LK9 A;  2QLR A;  1CS1 A;  1U08 A;  3EZ1 A;  1SZU A;  4Y0I A;  1JS6 A;  2CH2 A;  2E54 A;  2HZP A;  3MC6 C;  3E2Z B;  1Z7D A;  5EIG A;  1QIT A;  2OQX A;  5EUE A;  4F5L A;  5M4D A;  1B5O A;  1D7R A;  1V2E A;  2BHX A;  3NRA A;  1SZS A;  2YKV A;  3P6K A;  4R5Z A;  1WYU B;  5E4Z A;  3EZS A;  3H9X A;  1IX7 A;  3H7F A;  2W8U A;  4WYD A;  1CQ6 A;  3GZC A;  4HVK A;  3PD6 B;  1TOK A;  3PDX A;  5G09 A;  3GJU A;  4F5J A;  1CZE A;  2AY7 A;  2W8W A;  1AY5 A;  1ASN A;  1KMJ A;  3RBF A;  3COG A;  5EUD A;  1KKJ A;  2JGT A;  4WB0 B;  3BC8 A;  3CQ6 A;  5DJ9 A;  4AZJ A;  4ZLV A;  4DQ6 A;  1I29 A;  5C6U A;  3FDD A;  4ADC A;  1WYU A;  1I43 A;  4KYO A;  1YJY A;  2EZ2 A;  4NOG A;  5E3K A;  3AV7 A;  4H63 Q;  1B9H A;  1CJ0 A;  3FKD A;  3PD6 A;  2HUF A;  2FKI A;  1YJZ A;  4RKC A;  1LW4 A;  4B98 A;  4JE5 D;  3ZRQ A;  3E77 A;  4E3Q A;  2X5F A;  1AKB A;  1ASF A;  4FFC A;  1GC3 A;  1MLZ A;  1TOE A;  4MGR A;  4Q31 A;  3QHX A;  4PVF A;  4OBU A;  2VGS A;  2QSR A;  1PMM A;  2C7T A;  5G0A A;  4OYT A;  1AMR A;  4WYG A;  2VGZ A;  1IJI A;  4W8I A;  3VOM A;  4A6R A;  1C4K A;  4BQ0 A;  4KAM A;  4R2N A;  4OT8 A;  2W7L A;  2VMO A;  1CZC A;  4WXF A;  4JF0 A;  3AEL A;  1LC7 A;  1YJS A;  4BMK A;  2G7J A;  1QJ5 A;  2W7H A;  3FZ6 A;  3HLM A;  4EFF A;  4MKK A;  1TOJ A;  1WYV B;  3W1J A;  1KL1 A;  4RIT A;  4HF8 A;  4ZWM A;  5DJ1 A;  4W1X A;  3AEN A;  1J04 A;  3LVK A;  5BJ3 A;  2BWN A;  3N4X A;  5KTB A;  4R8D A;  2Z1Y A;  3L44 A;  4A6U A;  1VP4 A;  3JTX A;  4XJM A;  1ASE A;  3M5U A;  3CAI A;  2W8V A;  3ASB A;  2ZUK A;  2F8J A;  4RJ0 A;  4F5I A;  3MEB A;  3WZF A;  4LW4 A;  2ZYJ A;  5G4J A;  1P3W A;  1BJO A;  3DR4 A;  4F5G A;  3HQT A;  4ZSW A;  1BJW A;  1OHY A;  1AJR A;  3F9T A;  1AIC A;  1N8P A;  3KKI A;  1TOI A;  4K2M A;  1B8G A;  1S06 A;  4FL0 A;  4WYF A;  3E9K A;  3PAA A;  3RQ1 A;  2VMY A;  4UOY A;  4E3R A;  5EAV A;  4H51 A;  5EFS A;  2X5D A;  3LWS A;  1G4X A;  5FT5 A;  2VMR A;  4EB5 A;  4BA4 A;  2YRI A;  2QB3 A;  4XK1 A;  4AO4 A;  4U1T A;  4P7Y A;  1AHE A;  2FNI A;  2GMS A;  7AAT A;  1DJU A;  1O61 A;  2D7Y A;  1C9C A;  3BV0 A;  2XH1 A;  3T32 A;  3TQX A;  5EUN A;  4GDY A;  3P1T A;  3DOD A;  3USF A;  2YKY A;  4LW2 A;  1UKJ A;  1AKC A;  2E7J A;  3FSL A;  2WK9 A;  2W7M A;  4WD2 A;  2D63 A;  1FG3 A;  1S07 A;  5EQC A;  4WYC A;  3MAD A;  4O6Z A;  1BJ4 A;  1MDZ A;  2E7I A;  1KL2 A;  1BS0 A;  2V1P A;  4MSO A;  3AEJ A;  1OAT A;  5EIG B;  4ZM3 A;  3FCR A;  3ELP A;  2YCT A;  2AEU A;  4QGR A;  4R5F A;  5G2Q A;  1TAR A;  3MAF B;  3A8U X;  3WGB A;  2VMN A;  5BJ4 A;  4WLJ A;  2Z20 A;  4AO9 A;  2DGK A;  4ZWV A;  4RIZ A;  4JE5 A;  3NYT A;  4JEV A;  3B8X A;  3BN1 A;  3ASA A;  4JEW A;  3EI6 A;  5DX5 A;  3WY7 A;  1GC4 A;  2AEV A;  2OKK A;  3ELE A;  3LG0 A;  4P3M A;  1G7W A;  4UHO A;  3ZRP A;  1V72 A;  3MAF A;  4MQR A;  4WXB A;  4XAU A;  4F5M A;  2Z9W A;  1LS3 A;  3ACZ A;  4WXG A;  2VIB A;  3B46 A;  2JJG A;  4IYO B;  3RI6 A;  4CXQ A;  3JWA A;  3K28 A;  4J8L A;  3NYU A;  4DGT A;  4F5H A;  3H14 A;  3GBX A;  3N0L A;  1MLY A;  1H1C A;  2CAN A;  2GSA A;  1ASG A;  4EB7 A;  1AIA A;  3EIA A;  3PPL A;  1ZOD A;  2PB2 A;  3BB8 A;  2CFB A;  4MKJ A;  1AJS B;  3NX3 A;  3DYD A;  3FFR A;  4JEZ A;  4GRX A;  1RV4 A;  2QBT A;  2WKA A;  4MQQ A;  3BCA A;  2W7I A;  8AAT A;  2CJG A;  3HMU A;  4IYO A;  3AOW A;  2C0R A;  2JJF A;  2AY1 A;  1N2T A;  4IY7 A;  2Z9V A;  1WKG A;  2ZSM A;  3WKS A;  2YCN A;  3AEO A;  2AY6 A;  2VLH A;  5F8V A;  3FZ7 A;  3TFU A;  1AMQ A;  2FYF A;  2HOR A;  1X28 A;  4OTL A;  1E5E A;  2GMU A;  4XQ2 A;  5JAY A;  1M0N A;  2VMQ A;  1AJS A;  2R5E A;  3A2B A;  4GSA A;  2CY8 A;  4Y0H A;  4MQP A;  1ASC A;  1AHY A;  2CJH A;  2O1B A;  3PJ0 A;  1LC8 A;  4RKD A;  3ATH A;  1CQ7 A;  3D6K A;  4IXZ A;  1M0Q A;  2BI3 A;  4L0O A;  2GB3 A;  3A9X A;  2KFP A;  2HP2 A;  4ZAS A;  2WB6 A;  3DRD A;  4Q76 A;  4A72 A;  1X2A A;  1H0C A;  3AEN B;  1C0N A;  1ELQ A;  2EPJ A;  1B4X A;  3DZZ A;  1GD9 A;  2OAT A;  3AEJ C;  1AY8 A;  4E1O A;  1S08 A;  3N7N A;  4TN4 A;  1ARI A;  1W7M A;  2VMW A;  3BS8 A;  3KGX A;  3FVU A;  4B9B A;  1VJO A;  3IF2 A;  3N5M A;  3IHJ A;  3WKR A;  3FFH A;  2AY5 A;  4UHM A;  2D7Z A;  5HHY A;  3VK2 A;  1B5P A;  1EG5 A;  1MAP A;  2VMT A;  1BQD A;  2RFV A;  5FT4 A;  1YAA A;  1IUG A;  4W5K A;  3GWP A;  1BQA A;  4J5U A;  2WK7 A;  3L8A A;  3F0H A;  1BJO B;  3LVL B;  5HXX A;  3I4J A;  1ZC9 A;  1ORD A;  2NMP A;  2FM1 A;  1AHG A;  1OHV A;  3PDB B;  3BWN A;  2AY8 A;  4N0W A;  4A0G A;  4LC3 A;  5J8Q A;  1QZ9 A;  4PIW A;  2TPL A;  2WK8 A;  3CQ5 A;  1JF9 A;  1ECX A;  2CH1 A;  4AOA A;  2VGW A;  1MDX A;  3F6T A;  3UE8 A;  1GC0 A;  5IWQ A;  2W7G A;  1LC5 A;  3MKJ A;  3LY1 A;  4BHD A;  1I41 A;  2EZ1 A;  3PDB A;  2AY4 A;  1ASB A;  2YRR A;  3EI9 A;  1ARG A;  1GBN A;  4RJY A;  1MDO A;  2GQN A;  4W1V A;  1JG8 A;  2Z61 A;  1KMK A;  3QBO A;  4EU1 A;  2HOY A;  2VMP A;  3JZL A;  4GE7 A;  4ATQ A;  1ARS A;  1SZK A;  2EGY A;  3EI8 A;  3NUB A;  1XEY A;  4ITX A;  4ZSY A;  1DGD A;  2VLF A;  1ASL A;  3AEP A;  3VAX A;  1M4N A;  3E2F A;  2VMV A;  2VMZ A;  1CL1 A;  2HP1 A;  5LHA A;  4LNJ A;  1WST A;  2O7C A;  4A0H A;  2XBN A;  2A1V A;  1PG8 A;  2FQ6 A;  4OBV A;  1PMO A;  3B1E A;  2R5C A;  3RBL A;  2W7J A;  2JJH A;  3FD0 A;  1G4V A;  4MY5 A;  1M7Y A;  2BWO A;  2BI5 A;  2VIA A;  2VGT A;  1IVR A;  3N75 A;  4M2K A;  1AMS A;  2DGM A;  1IBJ A;  5F9S A;  3DR7 A;  1DJ9 A;  1WKH A;  1C7N A;  2ZSL A;  1Y4I A;  3G0T A;  2BIG A;  4GE4 A;  2QA3 A;  1AMA A;  3ISL A;  4JEX A;  3QN6 A;  3FRK A;  2BKW A;  3NNK A;  2O0R A;  4DBC A;  2D66 A;  3B1D A;  2CB1 A;  3BWN C;  3W1I A;  1GEX A;  3LV2 A;  1AHF A;  3DU4 A;  2Z9X A;  4A0R A;  2VMU A;  4ZM4 A;  1M0P A;  1TAT A;  3TAT A;  2YOB A;  1GCK A;  3N4R A;  3E6G A;  2FN6 A;  4I8A A;  1KAF A;  2HOZ A;  5EAA A;  2HOX A;  3HT4 A;  3FQ8 A;  2BWP A;  1W23 A;  4GEB A;  3QPG A;  4RM1 A;  4ATP A;  3LVM A;  4K2B A;  4Q6R A;  1D7V A;  4BA5 A;  2ZY5 A;  3MBB A;  2BIE A;  4UHN A;  5AX8 A;  3E2Y A;  1AX4 A;  4TV7 A;  3CBF A;  2W7F A;  1SPA A;  4A0F A;  1ASM A;  1SVV A;  3QGU A;  3BCB A;  1GDE A;  1AKA A;  2ZP7 A;  1D7U A;  2C44 A;  2W8T A;  3EI7 A;  3FQ7 A;  2VMS A;  3FZ8 A;  3R9A A;  2VYC A;  1QIS A;  1ASD A;  3FVS A;  1GC2 A;  4OC9 A;  3G7Q A;  5I92 A;  4ZDO A;  3Q8N A;  2Z67 A;  3AAT A;  4F5F A;  4ZAH A;  4W1W A;  1OHW A;  1IX8 A;  4A6T A;  2C81 A;  9AAT A;  2EO5 A;  1WYT A;  2W7K A;  3FVX A;  1ARH A;  3JWB A;  2HUU A;  2CIN A;  4IX8 A;  4XJP A;  1O69 A;  5D95 A;  1W3U A;  2BYJ A;  1O62 A;  5M46 A;  4WBT A;  4Y0D A;  3DC1 A;  2AY9 A;  2ZC0 A;  3E2Z A;  3NUI A;  3KGW A;  3NYS A;  2BI9 A;  4XJO A;  2G6W A;  1YIY A;  2QB2 A;  3A9Y A;  3BCX A;  1DJE A;  2PO3 A;  1LW5 A;  1SFF A;  3G8M A;  1FC4 A;  1RVU A;  2DKJ A;  5G4I A;  3AOV A;  3RCH B;  2W7E A;  5TF5 A;  3WCO A;  3R4T A;  1SF2 A;  3PIU A;  3ZRR A;  4ADB A;  1E5F A;  1C7O A;  2JG2 A;  4LNL A;  2R2N A;  2CTZ A;  3DXV A;  2BIA A;  4PFN A;  3K40 A;  4ADD A;  4F4E A;  3EIB A;  3FQA A;  2ZY2 A;  1KKP A;  1DGE A;  1O4S A;  1YIZ A;  1IX6 A;  1I48 A;  1TAS A;  3FDB A;  4UQV A;  4WB0 A;  2D61 A;  3NTJ A;  3HL2 A;  1V2F A;  1C7G A;  1D2F A;  4IXS A;  4LNM A;  3RCH A;  3GR9 A;  1IAX A;  1LKC A;  5LH9 A;  1W7N A;  2OKJ A;  4WYE A;  1BJN A;  1T3I A;  5D5S A;  4EMY A;  5M4B A;  1M6S A;  1CQ8 A;  1TPL A;  3GET A;  4CBR A;  1N31 A;  1X29 A;  3UWC A;  2ORD A;  2AAT A;  3W1H A;  1ART A;  1MGV A;  4ZDP A;  1DKA A;  4U2H A;  2ZY3 A;  2YKU A;  4AH3 A;  1BT4 A;  1UU1 A;  2R0T A;  2ZY4 A;  2ZJG A;  2HUI A;  3PA9 A;  4W91 A;  3VK4 A;  3FTB A;  4M2M A;  1FG7 A;  1VEF A;  2Q7W A;  3PGY A;  4WLH A;  1ZOB A;  2OGE A;  4GE9 A;  3GSB A;  1AIB A;  1Z3Z A;  2EH6 A;  2YKX A;  3AEM A;  1QGN A;  3LVJ A;  5FT6 A;  4A00 A;  4AZK A;  3VP6 A;  4K05 A;  1EJI A;  2QMA A;  3ZZK A;  2VGU A;  1G7X A;  2YCP A;  3ECD A;  1V2D A;  3K7Y A;  3GZD A;  4M2J A;  1XI9 A;  1WYV A;  5DB5 A;  1ELU A;  2D65 A;  1AY4 A;  1QIR A;  1RV3 A;  2DOU A;  2Z9U A;  1B9I A;  3MC6 A;  4WYA A;  5E5I A;  3KE3 A;  2R5C B;  4ADE A;  3EI5 A;  3OKS A;  1AAW A;  2BYL A;  1EQB A;  4JF1 A;  4E77 A;  2JIS A;  4ITG A;  1W7L A;  1YNU A;  2V0Y A;  1MAQ A;  4KXK A;  4K2I A;  3RUY A;  2OGA A;  2W7D A;  3I16 A;  1QJ3 A;  2DKB A;  4CBS A;  1OXO A;  3TCM A;  1AHX A;  1JS3 A;  2DR1 A;  5G2P A;  1M0O A;  4ZDL A;  4CVQ A;  1BKG A;  3ZZJ A;  1AAM A;  5FT8 A;  1PFF A;  3OP7 A;  2X3L A;  3HDO A;  4N0B A;  4XJL A;  4CXR A;  1TOG A;  1UU2 A;  4ISY A;  1YOO A;  4IXO A;  1DTY A;  1J32 A;  5M49 A;  2YHK A;  3QI6 A;  3JU7 A;  3MAU A;  4IW7 A;  1OXP A;  1X0M A;  3EUC A;  4JEY A;  4Q75 A;  2X8U A;  2D5Y A;  1GEW A;  5HDM A;  3HBX A;  2DGL A;  4WP0 A;  2W8J A; 
#chains in the Genus database with same CATH homology
 3II0 A;  3N4S A;  3BWO A;  4OMA A;  2PB0 A;  3HVY A;  1BW0 A;  4RAE A;  2JJE A;  1S09 A;  3WCN A;  2CJD A;  2VMX A;  2VGV A;  2VI8 A;  2EYQ A;  2D64 A;  3WLX A;  1IAY A;  3UAK A;  4F5K A;  4OCA A;  3NU7 A;  1CL2 A;  2CST A;  4RLG A;  4PFF A;  2BI1 A;  3QM2 A;  1D7S A;  5K8B A;  3AEM C;  3NDN A;  3TFT A;  2BI2 A;  2E7U A;  1S0A A;  2Z1Z A;  3NU8 A;  3WX9 A;  2AY3 A;  1RVY A;  3CQ4 A;  1M32 A;  2VI9 A;  1DFO A;  2FNU A;  4XEW A;  3WGC A;  1GEY A;  3DXW A;  3JW9 A;  3B1C A;  3VK3 A;  1ASA A;  1WYT B;  3I5T A;  2AY2 A;  1UU0 A;  3A9Z A;  3GZD C;  4TMR A;  1LK9 A;  2QLR A;  1CS1 A;  1U08 A;  3EZ1 A;  1SZU A;  4Y0I A;  1JS6 A;  2CH2 A;  2E54 A;  2HZP A;  3MC6 C;  3E2Z B;  1Z7D A;  5EIG A;  1QIT A;  2OQX A;  5EUE A;  4F5L A;  5M4D A;  1B5O A;  1D7R A;  1V2E A;  2BHX A;  3NRA A;  1SZS A;  2YKV A;  3P6K A;  4R5Z A;  1WYU B;  5E4Z A;  3EZS A;  3H9X A;  1IX7 A;  3H7F A;  2W8U A;  4WYD A;  1CQ6 A;  3GZC A;  4HVK A;  3PD6 B;  1TOK A;  3PDX A;  5G09 A;  3GJU A;  4F5J A;  1CZE A;  2AY7 A;  2W8W A;  1AY5 A;  1ASN A;  1KMJ A;  3RBF A;  3COG A;  5EUD A;  1KKJ A;  2JGT A;  4WB0 B;  3BC8 A;  3CQ6 A;  5DJ9 A;  4AZJ A;  4ZLV A;  4DQ6 A;  1I29 A;  5C6U A;  3FDD A;  4ADC A;  1WYU A;  1I43 A;  4KYO A;  1YJY A;  2EZ2 A;  4NOG A;  5E3K A;  3AV7 A;  4H63 Q;  1B9H A;  1CJ0 A;  3FKD A;  3PD6 A;  2HUF A;  2FKI A;  1YJZ A;  4RKC A;  1LW4 A;  4B98 A;  4JE5 D;  3ZRQ A;  3E77 A;  4E3Q A;  2X5F A;  1AKB A;  1ASF A;  4FFC A;  1GC3 A;  1MLZ A;  1TOE A;  4MGR A;  4Q31 A;  3QHX A;  4PVF A;  4OBU A;  2VGS A;  2QSR A;  1PMM A;  2C7T A;  5G0A A;  4OYT A;  1AMR A;  4WYG A;  2VGZ A;  1IJI A;  4W8I A;  3VOM A;  4A6R A;  1C4K A;  4BQ0 A;  4KAM A;  4R2N A;  4OT8 A;  2W7L A;  2VMO A;  1CZC A;  4WXF A;  4JF0 A;  3AEL A;  1LC7 A;  1YJS A;  4BMK A;  2G7J A;  1QJ5 A;  2W7H A;  3FZ6 A;  3HLM A;  4EFF A;  4MKK A;  1TOJ A;  1WYV B;  3W1J A;  1KL1 A;  4RIT A;  4HF8 A;  4ZWM A;  5DJ1 A;  4W1X A;  3AEN A;  1J04 A;  3LVK A;  5BJ3 A;  2BWN A;  3N4X A;  5KTB A;  4R8D A;  2Z1Y A;  3L44 A;  4A6U A;  1VP4 A;  3JTX A;  4XJM A;  1ASE A;  3M5U A;  3CAI A;  2W8V A;  3ASB A;  2ZUK A;  2F8J A;  4RJ0 A;  4F5I A;  3MEB A;  3WZF A;  4LW4 A;  2ZYJ A;  5G4J A;  1P3W A;  1BJO A;  3DR4 A;  4F5G A;  3HQT A;  4ZSW A;  1BJW A;  1OHY A;  1AJR A;  3F9T A;  1AIC A;  1N8P A;  3KKI A;  1TOI A;  4K2M A;  1B8G A;  1S06 A;  4FL0 A;  4WYF A;  3E9K A;  3PAA A;  3RQ1 A;  2VMY A;  4UOY A;  4E3R A;  5EAV A;  4H51 A;  5EFS A;  2X5D A;  3LWS A;  1G4X A;  5FT5 A;  2VMR A;  4EB5 A;  4BA4 A;  2YRI A;  2QB3 A;  4XK1 A;  4AO4 A;  4U1T A;  4P7Y A;  1AHE A;  2FNI A;  2GMS A;  7AAT A;  1DJU A;  1O61 A;  2D7Y A;  1C9C A;  3BV0 A;  2XH1 A;  3T32 A;  3TQX A;  5EUN A;  4GDY A;  3P1T A;  3DOD A;  3USF A;  2YKY A;  4LW2 A;  1UKJ A;  1AKC A;  2E7J A;  3FSL A;  2WK9 A;  2W7M A;  4WD2 A;  2D63 A;  1FG3 A;  1S07 A;  5EQC A;  4WYC A;  3MAD A;  4O6Z A;  1BJ4 A;  1MDZ A;  2E7I A;  1KL2 A;  1BS0 A;  2V1P A;  4MSO A;  3AEJ A;  1OAT A;  5EIG B;  4ZM3 A;  3FCR A;  3ELP A;  2YCT A;  2AEU A;  4QGR A;  4R5F A;  5G2Q A;  1TAR A;  3MAF B;  3A8U X;  3WGB A;  2VMN A;  5BJ4 A;  4WLJ A;  2Z20 A;  4AO9 A;  2DGK A;  4ZWV A;  4RIZ A;  4JE5 A;  3NYT A;  4JEV A;  3B8X A;  3BN1 A;  3ASA A;  4JEW A;  3EI6 A;  5DX5 A;  3WY7 A;  1GC4 A;  2AEV A;  2OKK A;  3ELE A;  3LG0 A;  4P3M A;  1G7W A;  4UHO A;  3ZRP A;  1V72 A;  3MAF A;  4MQR A;  4WXB A;  4XAU A;  4F5M A;  2Z9W A;  1LS3 A;  3ACZ A;  4WXG A;  2VIB A;  3B46 A;  2JJG A;  4IYO B;  3RI6 A;  4CXQ A;  3JWA A;  3K28 A;  4J8L A;  3NYU A;  4DGT A;  4F5H A;  3H14 A;  3GBX A;  3N0L A;  1MLY A;  1H1C A;  2CAN A;  2GSA A;  1ASG A;  4EB7 A;  1AIA A;  3EIA A;  3PPL A;  1ZOD A;  2PB2 A;  3BB8 A;  2CFB A;  4MKJ A;  1AJS B;  3NX3 A;  3DYD A;  3FFR A;  4JEZ A;  4GRX A;  1RV4 A;  2QBT A;  2WKA A;  4MQQ A;  3BCA A;  2W7I A;  8AAT A;  2CJG A;  3HMU A;  4IYO A;  3AOW A;  2C0R A;  2JJF A;  2AY1 A;  1N2T A;  4IY7 A;  2Z9V A;  1WKG A;  2ZSM A;  3WKS A;  2YCN A;  3AEO A;  2AY6 A;  2VLH A;  5F8V A;  3FZ7 A;  3TFU A;  1AMQ A;  2FYF A;  2HOR A;  1X28 A;  4OTL A;  1E5E A;  2GMU A;  4XQ2 A;  5JAY A;  1M0N A;  2VMQ A;  1AJS A;  2R5E A;  3A2B A;  4GSA A;  2CY8 A;  4Y0H A;  4MQP A;  1ASC A;  1AHY A;  2CJH A;  2O1B A;  3PJ0 A;  1LC8 A;  4RKD A;  3ATH A;  1CQ7 A;  3D6K A;  4IXZ A;  1M0Q A;  2BI3 A;  4L0O A;  2GB3 A;  3A9X A;  2KFP A;  2HP2 A;  4ZAS A;  2WB6 A;  3DRD A;  4Q76 A;  4A72 A;  1X2A A;  1H0C A;  3AEN B;  1C0N A;  1ELQ A;  2EPJ A;  1B4X A;  3DZZ A;  1GD9 A;  2OAT A;  3AEJ C;  1AY8 A;  4E1O A;  1S08 A;  3N7N A;  4TN4 A;  1ARI A;  1W7M A;  2VMW A;  3BS8 A;  3KGX A;  3FVU A;  4B9B A;  1VJO A;  3IF2 A;  3N5M A;  3IHJ A;  3WKR A;  3FFH A;  2AY5 A;  4UHM A;  2D7Z A;  5HHY A;  3VK2 A;  1B5P A;  1EG5 A;  1MAP A;  2VMT A;  1BQD A;  2RFV A;  5FT4 A;  1YAA A;  1IUG A;  4W5K A;  3GWP A;  1BQA A;  4J5U A;  2WK7 A;  3L8A A;  3F0H A;  1BJO B;  3LVL B;  5HXX A;  3I4J A;  1ZC9 A;  1ORD A;  2NMP A;  2FM1 A;  1AHG A;  1OHV A;  3PDB B;  3BWN A;  2AY8 A;  4N0W A;  4A0G A;  4LC3 A;  5J8Q A;  1QZ9 A;  4PIW A;  2TPL A;  2WK8 A;  3CQ5 A;  1JF9 A;  1ECX A;  2CH1 A;  4AOA A;  2VGW A;  1MDX A;  3F6T A;  3UE8 A;  1GC0 A;  5IWQ A;  2W7G A;  1LC5 A;  3MKJ A;  3LY1 A;  4BHD A;  1I41 A;  2EZ1 A;  3PDB A;  2AY4 A;  1ASB A;  2YRR A;  3EI9 A;  1ARG A;  1GBN A;  4RJY A;  1MDO A;  2GQN A;  4W1V A;  1JG8 A;  2Z61 A;  1KMK A;  3QBO A;  4EU1 A;  2HOY A;  2VMP A;  3JZL A;  4GE7 A;  4ATQ A;  1ARS A;  1SZK A;  2EGY A;  3EI8 A;  3NUB A;  1XEY A;  4ITX A;  4ZSY A;  1DGD A;  2VLF A;  1ASL A;  3AEP A;  3VAX A;  1M4N A;  3E2F A;  2VMV A;  2VMZ A;  1CL1 A;  2HP1 A;  5LHA A;  4LNJ A;  1WST A;  2O7C A;  4A0H A;  2XBN A;  2A1V A;  1PG8 A;  2FQ6 A;  4OBV A;  1PMO A;  3B1E A;  2R5C A;  3RBL A;  2W7J A;  2JJH A;  3FD0 A;  1G4V A;  4MY5 A;  1M7Y A;  2BWO A;  2BI5 A;  2VIA A;  2VGT A;  1IVR A;  3N75 A;  4M2K A;  1AMS A;  2DGM A;  1IBJ A;  5F9S A;  3DR7 A;  1DJ9 A;  1WKH A;  1C7N A;  2ZSL A;  1Y4I A;  3G0T A;  2BIG A;  4GE4 A;  2QA3 A;  1AMA A;  3ISL A;  4JEX A;  3QN6 A;  3FRK A;  2BKW A;  3NNK A;  2O0R A;  4DBC A;  2D66 A;  3B1D A;  2CB1 A;  3BWN C;  3W1I A;  1GEX A;  3LV2 A;  1AHF A;  3DU4 A;  2Z9X A;  4A0R A;  2VMU A;  4ZM4 A;  1M0P A;  1TAT A;  3TAT A;  2YOB A;  1GCK A;  3N4R A;  3E6G A;  2FN6 A;  4I8A A;  2HOZ A;  5EAA A;  2HOX A;  3HT4 A;  3FQ8 A;  2BWP A;  1W23 A;  4GEB A;  3QPG A;  4RM1 A;  4ATP A;  3LVM A;  4K2B A;  4Q6R A;  1D7V A;  4BA5 A;  2ZY5 A;  3MBB A;  2BIE A;  4UHN A;  5AX8 A;  3E2Y A;  1AX4 A;  4TV7 A;  3CBF A;  2W7F A;  1SPA A;  4A0F A;  1ASM A;  1SVV A;  3QGU A;  3BCB A;  1GDE A;  1AKA A;  2ZP7 A;  1D7U A;  2C44 A;  2W8T A;  3EI7 A;  3FQ7 A;  2VMS A;  3FZ8 A;  3R9A A;  2VYC A;  1QIS A;  1ASD A;  3FVS A;  1GC2 A;  4OC9 A;  3G7Q A;  5I92 A;  4ZDO A;  3Q8N A;  2Z67 A;  3AAT A;  4F5F A;  4ZAH A;  4W1W A;  1OHW A;  1IX8 A;  4A6T A;  2C81 A;  9AAT A;  2EO5 A;  1WYT A;  2W7K A;  3FVX A;  1ARH A;  3JWB A;  2HUU A;  2CIN A;  4IX8 A;  4XJP A;  1O69 A;  5D95 A;  1W3U A;  2BYJ A;  1O62 A;  5M46 A;  4WBT A;  4Y0D A;  3DC1 A;  2AY9 A;  2ZC0 A;  3E2Z A;  3NUI A;  3KGW A;  3NYS A;  2BI9 A;  4XJO A;  2G6W A;  1YIY A;  2QB2 A;  3A9Y A;  3BCX A;  1DJE A;  2PO3 A;  1LW5 A;  1SFF A;  3G8M A;  1FC4 A;  1RVU A;  2DKJ A;  5G4I A;  3AOV A;  3RCH B;  2W7E A;  5TF5 A;  3WCO A;  3R4T A;  1SF2 A;  3PIU A;  3ZRR A;  4ADB A;  1E5F A;  1C7O A;  2JG2 A;  4LNL A;  2R2N A;  2CTZ A;  3DXV A;  2BIA A;  4PFN A;  3K40 A;  4ADD A;  4F4E A;  3EIB A;  3FQA A;  2ZY2 A;  1KKP A;  1DGE A;  1O4S A;  1YIZ A;  1IX6 A;  1I48 A;  1TAS A;  3FDB A;  4UQV A;  4WB0 A;  2D61 A;  3NTJ A;  3HL2 A;  1V2F A;  1C7G A;  1D2F A;  4IXS A;  4LNM A;  3RCH A;  3GR9 A;  1IAX A;  1LKC A;  5LH9 A;  1W7N A;  2OKJ A;  4WYE A;  1BJN A;  1T3I A;  5D5S A;  4EMY A;  5M4B A;  1M6S A;  1CQ8 A;  1TPL A;  3GET A;  4CBR A;  1N31 A;  1X29 A;  3UWC A;  2ORD A;  2AAT A;  3W1H A;  1ART A;  1MGV A;  4ZDP A;  1DKA A;  4U2H A;  2ZY3 A;  2YKU A;  4AH3 A;  1BT4 A;  1UU1 A;  2R0T A;  2ZY4 A;  2ZJG A;  2HUI A;  3PA9 A;  4W91 A;  3VK4 A;  3FTB A;  4M2M A;  1FG7 A;  1VEF A;  2Q7W A;  3PGY A;  4WLH A;  1ZOB A;  2OGE A;  4GE9 A;  3GSB A;  1AIB A;  1Z3Z A;  2EH6 A;  2YKX A;  3AEM A;  1QGN A;  3LVJ A;  5FT6 A;  4A00 A;  4AZK A;  3VP6 A;  4K05 A;  1EJI A;  2QMA A;  3ZZK A;  2VGU A;  1G7X A;  2YCP A;  3ECD A;  1V2D A;  3K7Y A;  3GZD A;  4M2J A;  1XI9 A;  1WYV A;  5DB5 A;  1ELU A;  2D65 A;  1AY4 A;  1QIR A;  1RV3 A;  2DOU A;  2Z9U A;  1B9I A;  3MC6 A;  4WYA A;  5E5I A;  3KE3 A;  2R5C B;  4ADE A;  3EI5 A;  3OKS A;  1AAW A;  2BYL A;  1EQB A;  4JF1 A;  4E77 A;  2JIS A;  4ITG A;  1W7L A;  1YNU A;  2V0Y A;  1MAQ A;  4KXK A;  4K2I A;  3RUY A;  2OGA A;  2W7D A;  3I16 A;  1QJ3 A;  2DKB A;  4CBS A;  1OXO A;  3TCM A;  1AHX A;  1JS3 A;  2DR1 A;  5G2P A;  1M0O A;  4ZDL A;  4CVQ A;  1BKG A;  3ZZJ A;  1AAM A;  5FT8 A;  1PFF A;  3OP7 A;  2X3L A;  3HDO A;  4N0B A;  4XJL A;  4CXR A;  1TOG A;  1UU2 A;  4ISY A;  1YOO A;  4IXO A;  1DTY A;  1J32 A;  5M49 A;  2YHK A;  3QI6 A;  3JU7 A;  3MAU A;  4IW7 A;  1OXP A;  1X0M A;  3EUC A;  4JEY A;  4Q75 A;  2X8U A;  2D5Y A;  1GEW A;  5HDM A;  3HBX A;  2DGL A;  4WP0 A;  2W8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...