1G7WA

Aspartate aminotransferase active site mutant n194a/r386l
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGLVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Strain is more important than electrostatic interaction in controlling the pKa of the catalytic group in aspartate aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 137
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2000-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1g7wA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1g7wA01
2GMSA 4A72A 1DFOA 3NYUA 1DGDA 1AHYA 1PFFA 5M49A 1C7OA 4CVQA 3GZDA 2FYFA 4UHOA 1XI9A 4ZM4A 2JJHA 1AAWA 2YHKA 3RI6A 2JGTA 2WK9A 4LW2A 1QZ9A 4GEBA 4WLHA 1OATA 4O6ZA 3FVSA 3FVUA 1EJIA 1CL1A 1S08A 2Z67A 4JF1A 3EI9A 3GETA 2R0TA 5EUDA 3E2FA 2YKXA 2AY6A 1ASCA 1J32A 2CANA 1AX4A 2CH1A 1ASGA 2BIGA 4GE9A 5TF5A 3RQ1A 3AENA 4Q76A 3QHXA 1VEFA 2AY4A 3HQTA 4JE5D 3ZRRA 3M5UA 4JF0A 3FQ8A 4MKJA 3NRAA 1M0OA 3FQAA 1WKHA 3NUIA 1B5OA 3ELEA 5FT4A 2CJDA 1S07A 3WZFA 4BQ0A 1C7NA 4DBCA 4P7YA 2OQXA 3UE8A 2BIEA 3N0LA 4AH3A 2BKWA 1LKCA 1TPLA 1V2FA 2HOXA 1RV3A 3JWBA 3MAUA 5JAYA 5EQCA 3FDDA 1S0AA 4JEVA 1BJ4A 1GC3A 1SZSA 4LC3A 1N31A 2W7FA 1E5EA 3AEJC 3IHJA 3MC6A 4WYDA 3ZZJA 4MQPA 1ECXA 3E6GA 3NX3A 4WYGA 3WLXA 1KKPA 4K2IA 2W8UA 1AICA 4W8IA 5AX8A 3W1JA 4AZKA 4E3RA 2VMSA 1UU0A 3LVMA 4ZWMA 1SZKA 5LHAA 2HOZA 3FFRA 3N5MA 3JTXA 3PD6B 4F5JA 1QGNA 3FDBA 1G4VA 3I16A 4XJLA 2VI9A 1KL2A 2XBNA 1CS1A 4IYOA 2JG2A 1ASMA 2AY2A 3EZ1A 4U1TA 1W3UA 2DKBA 4JEYA 1AMQA 4ZSWA 3LG0A 5F8VA 3GZCA 2CJHA 3B1CA 1MLYA 2PB0A 4N0WA 1BS0A 1BJNA 1AAMA 2BWOA 1JG8A 1ASFA 3BCXA 4JEXA 1N2TA 3TQXA 4CXRA 3L8AA 4IX8A 5IWQA 2C0RA 4ITXA 2RFVA 3NTJA 1WYTB 1WYVA 2OKKA 3RCHA 3RBLA 2BI1A 4WB0B 3VK3A 1IX6A 4W91A 4ZDOA 2D65A 4Y0IA 4WYEA 3TFTA 4ITGA 4MY5A 4WLJA 1BJWA 1AIBA 4H51A 5G2PA 4UHMA 1MDXA 1W7LA 2GMUA 2O7CA 1PG8A 1OHWA 3LVKA 3DXVA 1D7SA 4A0RA 1FG3A 5HXXA 2W7GA 2WK8A 3ISLA 2EGYA 1SZUA 2X8UA 4RLGA 3QGUA 1CQ7A 1M0NA 4IW7A 5M46A 3BC8A 2W7JA 1J04A 2BWNA 1ORDA 2XH1A 3GR9A 3BB8A 3VP6A 4XJPA 1YNUA 4B98A 3COGA 2VMQA 1MLZA 2VMTA 3E2ZA 3ECDA 2HP2A 2CY8A 1SF2A 2HOYA 2BHXA 2VLFA 1ARHA 1GC2A 1N8PA 4TN4A 3A2BA 4A0FA 2V0YA 1XEYA 2VGUA 4LNMA 3K40A 8AATA 1QISA 4PFNA 4RJYA 1D7UA 2PB2A 2VIAA 2VMWA 1PMOA 2VYCA 3AENB 3DR7A 3EZSA 3G8MA 9AATA 4DGTA 2YCTA 2R2NA 1D2FA 4A0GA 2O1BA 3D6KA 1M0PA 3FFHA 4KAMA 4OCAA 2TPLA 2DR1A 3ZZKA 2QBTA 1GEYA 3PGYA 3QI6A 4P3MA 2ZY3A 3VAXA 2FNIA 4HVKA 5EUEA 1BKGA 4ADBA 1S06A 4PIWA 4WXFA 1AKCA 3GBXA 4QGRA 1WKGA 2CTZA 2E7IA 2WKAA 4ATPA 2E7JA 3DR4A 3FTBA 5DJ1A 1YJSA 1TOIA 2W7KA 1TATA 1ASLA 2VGWA 3E2YA 3N75A 1EG5A 4TMRA 2AY3A 4JE5A 4AO4A 4WYCA 1TARA 1IAXA 3AEMC 3FSLA 5G4IA 4EMYA 5BJ4A 2D5YA 2X5DA 3BV0A 4XEWA 4XQ2A 4LNLA 4IYOB 4BMKA 1LC5A 3QBOA 1YAAA 3HVYA 2W7IA 5EUNA 2ZY4A 3WKRA 4A6RA 5J8QA 1ZOBA 3P6KA 5M4BA 3FZ8A 4GSAA 1PMMA 2VMRA 3JW9A 2O0RA 2W7LA 4BA5A 4F5HA 1ASEA 1BW0A 3PA9A 3F9TA 1JF9A 3H7FA 3AELA 3KGWA 3MADA 3BWNC 4TV7A 3WX9A 2EO5A 4MQRA 1AIAA 1WYVB 5EIGA 4BHDA 1LW5A 2QLRA 3RCHB 4ZM3A 2C44A 2EH6A 3AEJA 1AHEA 4WXGA 2VMUA 2BI3A 2Z20A 4WXBA 2ZC0A 2AY7A 3IF2A 3F0HA 4WP0A 3NDNA 5FT6A 4ADEA 3BWOA 4PVFA 2AEVA 4OT8A 3EI6A 2D61A 1BJOA 1YIYA 1B4XA 1D7RA 1IX8A 1RV4A 3ATHA 4OTLA 1GCKA 2HORA 1GD9A 3FRKA 4R5ZA 3BS8A 2FN6A 1E5FA 1LC8A 2QB2A 3B46A 3CQ4A 1P3WA 3GZDC 4F5LA 4A00A 4A0HA 3DU4A 1ARSA 1GEWA 1C0NA 2W8JA 3EIAA 3HT4A 1ARGA 1SVVA 3A9YA 4A6TA 3B1EA 3HDOA 3K28A 2VIBA 2CINA 1YOOA 3E2ZB 4KXKA 5G2QA 3WGCA 2C7TA 4OBUA 5M4DA 3DZZA 1EQBA 1CZCA 2D63A 2E54A 4WBTA 3MKJA 5E5IA 4RIZA 2EPJA 3KE3A 3WY7A 1Y4IA 1W23A 2QB3A 5I92A 3R9AA 4F5FA 3G7QA 1DJEA 1SFFA 4LW4A 1IJIA 5D5SA 3BCAA 1FC4A 5F9SA 5D95A 2BWPA 3PAAA 2HZPA 4IXSA 2WK7A 2VMYA 2Z61A 1YIZA 1MAQA 2CH2A 2W7MA 4CXQA 1TOGA 3A8UX 1ASDA 5EAAA 1AY8A 1IBJA 2ZJGA 3H14A 3PDBA 2ORDA 2CSTA 5E3KA 1M4NA 4N0BA 1M32A 1WYUA 3DXWA 4J5UA 2BYJA 1VP4A 3PPLA 2AY8A 4I8AA 1AJSA 1AJRA 4RKDA 2AY9A 2PO3A 3DODA 3DYDA 1AKAA 4JEZA 3A9XA 3RBFA 1Z7DA 3ZRPA 1O62A 1GC0A 1AHXA 1FG7A 2DGLA 2OGEA 4FFCA 1ASNA 4UHNA 1AHGA 1LK9A 2Z9WA 4E3QA 1W7MA 3MAFA 2DKJA 4XAUA 1ASAA 2BIAA 4ZASA 3TFUA 1X0MA 3CQ6A 2QMAA 1B8GA 2D7ZA 3CAIA 3OKSA 3LVJA 3QN6A 2YCNA 3B8XA 4UOYA 1ZC9A 4J8LA 5EIGB 1MGVA 2EZ1A 1ZODA 1B5PA 4R5FA 2W7HA 1TOKA 1QJ5A 3AEOA 1S09A 3NU8A 1KKJA 2VMPA 2YOBA 1VJOA 1ELQA 1BJOB 1AKBA 1V72A 5FT8A 2ZYJA 1V2DA 1KMJA 1M0QA 3USFA 4EB5A 4F5KA 3LV2A 3UWCA 3AEMA 1W7NA 1O69A 3NYTA 4GE7A 3GWPA 4ZLVA 3LVLB 2HUUA 1C9CA 2YRRA 3E77A 1QJ3A 5DB5A 3ASBA 4BA4A 4U2HA 1ARTA 2OKJA 1I48A 3I4JA 4ZWVA 4K2MA 2NMPA 1AY5A 1G7WA 4OBVA 4AO9A 2AATA 2D64A 2VGTA 3G0TA 3P1TA 4W1VA 3OP7A 2X3LA 3PJ0A 4MKKA 1I43A 4IXOA 3W1IA 2W8VA 3Q8NA 4ADDA 2DGKA 3FCRA 3BCBA 1M6SA 2ZSMA 4EB7A 1GC4A 2AY1A 2CJGA 2OGAA 5HDMA 4FL0A 3KGXA 4Q31A 5EFSA 1BQDA 4CBRA 1DJ9A 1RVYA 2HP1A 4Y0DA 3PDBB 1IUGA 1LS3A 1UU1A 5G4JA 4UQVA 5DX5A 1UU2A 3II0A 1WYUB 5E4ZA 1GEXA 1JS6A 2YKYA 5HHYA 4ATQA 2OATA 2R5CA 4MGRA 1AJSB 3EIBA 1RVUA 1DJUA 2YKVA 4RJ0A 4W5KA 3FQ7A 1X29A 3VK4A 3I5TA 2ZUKA 3NYSA 3JWAA 3AV7A 2C81A 2V1PA 1C7GA 3PIUA 4CBSA 1GBNA 2Z1ZA 4R2NA 1OXOA 2VI8A 4RKCA 1O61A 2DGMA 3VK2A 1MDZA 1Z3ZA 1T3IA 2D7YA 1G4XA 1IAYA 3NUBA 4IY7A 5G0AA 4E1OA 4GDYA 3HBXA 4Y0HA 3MEBA 2Z9UA 1H1CA 1ARIA 3LY1A 2VGSA 3CQ5A 3EUCA 3MAFB 2CFBA 3MBBA 4K2BA 1DKAA 1TOEA 4Q6RA 3K7YA 4ZDPA 1MAPA 4F5IA 3HLMA 2X5FA 1KMKA 4RITA 3NNKA 3PDXA 3FKDA 3L44A 1C4KA 4L0OA 2R5EA 4ZSYA 4OC9A 3TATA 1QIRA 1TASA 4Q75A 2ZY5A 1X28A 2GQNA 1AMSA 3EI5A 4W1XA 4F4EA 5LH9A 2HUFA 3AEPA 4IXZA 1IVRA 3AOVA 5DJ9A 1DTYA 1H0CA 2FNUA 2VMXA 1D7VA 3B1DA 4GRXA 2ZY2A 3KKIA 3NU7A 1YJYA 1B9HA 4ADCA 3MC6C 1V2EA 4WD2A 2BI5A 2Z1YA 1B9IA 3FZ7A 1JS3A 3FVXA 4MSOA 1GDEA 5EAVA 1AMRA 2YKUA 3FD0A 1UKJA 2W7DA 2EZ2A 2E7UA 2QA3A 2Q7WA 1I29A 1LW4A 1O4SA 3A9ZA 4M2MA 3DRDA 1I41A 1TOJA 1X2AA 3BN1A 3QPGA 4OMAA 3FZ6A 2YRIA 2FM1A 3LWSA 3EI8A 1AY4A 2W8WA 2AEUA 2DOUA 3ELPA 2Z9VA 3GSBA 3W1HA 3CBFA 3JZLA 4XJOA 5C6UA 3HMUA 4F5MA 1QITA 3ZRQA 4MQQA 2GSAA 2G6WA 4WYFA 4WYAA 2JISA 1DGEA 4EFFA 2FQ6A 4W1WA 4AZJA 1MDOA 4AOAA 2BI9A 4HF8A 2BYLA 5BJ3A 3DC1A 1CQ8A 2VGVA 2VMVA 3GJUA 3RUYA 2AY5A 2Z9XA 4ZDLA 4XK1A 2R5CB 4NOGA 3WCNA 4E77A 2VLHA 3TCMA 1IX7A 1U08A 4XJMA 2W7EA 5FT5A 3WGBA 1BQAA 3F6TA 3JU7A 2ZP7A 2HUIA 1CZEA 3PD6A 4LNJA 4JEWA 2VMZA 1AMAA 4RAEA 2ZSLA 1CL2A 3EI7A 1OHVA 2CB1A 2BI2A 2W8TA 1CJ0A 7AATA 4ZAHA 4A6UA 3ASAA 1OHYA 2VGZA 4EU1A 1G7XA 3AATA 2YCPA 3UAKA 3WKSA 5K8BA 3E9KA 2GB3A 2VMNA 4GE4A 2D66A 4ISYA 1AHFA 2JJEA 4M2JA 5G09A 1WSTA 1M7YA 1SPAA 3BWNA 1LC7A 3T32A 1WYTA 4F5GA 3AOWA 4DQ6A 1ELUA 4B9BA 2JJFA 3VOMA 4M2KA 3QM2A 4WB0A 1OXPA 1KL1A 3HL2A 3ACZA 3R4TA 3WCOA 1BT4A 4PFFA 2F8JA 2JJGA 4R8DA 4RM1A 1CQ6A 1ASBA 1YJZA 2VMOA 4KYOA 4OYTA
chains in the Genus database with same CATH superfamily
2GMSA 4A72A 1DFOA 3NYUA 1DGDA 1AHYA 1PFFA 5M49A 1C7OA 4CVQA 3GZDA 2FYFA 4UHOA 1XI9A 4ZM4A 2JJHA 1AAWA 2YHKA 3RI6A 2JGTA 2WK9A 4LW2A 1QZ9A 4GEBA 4WLHA 1OATA 4O6ZA 3FVSA 3FVUA 1EJIA 1CL1A 1S08A 2Z67A 4JF1A 3EI9A 3GETA 2R0TA 2EYQA 5EUDA 3E2FA 2YKXA 2AY6A 1ASCA 1J32A 2CANA 1AX4A 2CH1A 1ASGA 2BIGA 4GE9A 5TF5A 3RQ1A 3AENA 4Q76A 3QHXA 1VEFA 2AY4A 3HQTA 4JE5D 3ZRRA 3M5UA 4JF0A 3FQ8A 4MKJA 3NRAA 1M0OA 3FQAA 1WKHA 3NUIA 1B5OA 3ELEA 5FT4A 2CJDA 1S07A 3WZFA 4BQ0A 1C7NA 4DBCA 4P7YA 2OQXA 3UE8A 2BIEA 3N0LA 3N4RA 4AH3A 2BKWA 1LKCA 1TPLA 1V2FA 2HOXA 1RV3A 3JWBA 3MAUA 5JAYA 5EQCA 3FDDA 1S0AA 4JEVA 1BJ4A 1GC3A 1SZSA 4LC3A 1N31A 2W7FA 1E5EA 3AEJC 3IHJA 3MC6A 4WYDA 3ZZJA 4MQPA 1ECXA 3E6GA 3NX3A 4WYGA 3WLXA 1KKPA 4K2IA 2W8UA 1AICA 4W8IA 5AX8A 3W1JA 4AZKA 4E3RA 3N4XA 2VMSA 1UU0A 3LVMA 4ZWMA 1SZKA 5LHAA 2HOZA 3FFRA 3N5MA 3JTXA 3PD6B 4F5JA 1QGNA 3FDBA 1G4VA 3I16A 4XJLA 2VI9A 1KL2A 2XBNA 1CS1A 4IYOA 2JG2A 1ASMA 2AY2A 3EZ1A 4U1TA 1W3UA 2DKBA 4JEYA 1AMQA 4ZSWA 3LG0A 5F8VA 3GZCA 2CJHA 3B1CA 1MLYA 2PB0A 4N0WA 1BS0A 1BJNA 1AAMA 2BWOA 1JG8A 1ASFA 3BCXA 4JEXA 1N2TA 3TQXA 4CXRA 3L8AA 4IX8A 5IWQA 2C0RA 4ITXA 2RFVA 3NTJA 1WYTB 1WYVA 2OKKA 3RCHA 3RBLA 2BI1A 4WB0B 3VK3A 1IX6A 4W91A 4ZDOA 2D65A 4Y0IA 4WYEA 3TFTA 4ITGA 4MY5A 4WLJA 1BJWA 1AIBA 4H51A 5G2PA 4UHMA 1MDXA 1W7LA 2GMUA 2O7CA 1PG8A 1OHWA 3LVKA 3DXVA 1D7SA 4A0RA 1FG3A 5HXXA 2W7GA 2WK8A 3ISLA 2EGYA 1SZUA 2X8UA 4RLGA 3QGUA 1CQ7A 1M0NA 4IW7A 5M46A 3BC8A 2W7JA 1J04A 2BWNA 1ORDA 2XH1A 3GR9A 3BB8A 3VP6A 4XJPA 1YNUA 4B98A 3COGA 2VMQA 1MLZA 2VMTA 3E2ZA 3ECDA 2HP2A 2CY8A 1SF2A 2HOYA 2BHXA 2VLFA 1ARHA 1GC2A 1N8PA 4TN4A 3A2BA 4A0FA 2V0YA 1XEYA 2VGUA 2G7JA 4LNMA 3K40A 8AATA 1QISA 4PFNA 4RJYA 1D7UA 2PB2A 2VIAA 2VMWA 1PMOA 2VYCA 3AENB 3DR7A 3EZSA 3G8MA 9AATA 4DGTA 2YCTA 2R2NA 1D2FA 5KTBA 4A0GA 2O1BA 3D6KA 1M0PA 3FFHA 4KAMA 4OCAA 2TPLA 2DR1A 3ZZKA 2QBTA 1GEYA 3PGYA 3QI6A 4P3MA 2ZY3A 3VAXA 2FNIA 4HVKA 5EUEA 1BKGA 3H9XA 4ADBA 1S06A 4PIWA 4WXFA 1AKCA 3GBXA 4QGRA 1WKGA 2CTZA 2E7IA 2WKAA 4ATPA 2E7JA 3DR4A 3FTBA 5DJ1A 1YJSA 1TOIA 2W7KA 1TATA 1ASLA 2VGWA 3E2YA 3N75A 1EG5A 4TMRA 2AY3A 4JE5A 4AO4A 4WYCA 1TARA 1IAXA 3AEMC 3FSLA 5G4IA 4EMYA 5BJ4A 2D5YA 2X5DA 3BV0A 4XEWA 4XQ2A 4LNLA 4IYOB 4BMKA 1LC5A 3QBOA 1YAAA 3HVYA 2W7IA 2QSRA 5EUNA 2ZY4A 3WKRA 4A6RA 5J8QA 1ZOBA 3P6KA 5M4BA 3FZ8A 4GSAA 1PMMA 2VMRA 3JW9A 2O0RA 2W7LA 4BA5A 4F5HA 1ASEA 1BW0A 3PA9A 3F9TA 1JF9A 3H7FA 3AELA 3KGWA 3MADA 3BWNC 4TV7A 3WX9A 2EO5A 4MQRA 1AIAA 1WYVB 5EIGA 4BHDA 1LW5A 2QLRA 3RCHB 4ZM3A 2C44A 2EH6A 3AEJA 1AHEA 4WXGA 2VMUA 2BI3A 2Z20A 4WXBA 2ZC0A 2AY7A 3IF2A 3F0HA 4WP0A 3NDNA 5FT6A 4ADEA 3BWOA 4PVFA 2AEVA 4OT8A 3EI6A 2D61A 1BJOA 1YIYA 1B4XA 1D7RA 1IX8A 1RV4A 3ATHA 4OTLA 1GCKA 2HORA 1GD9A 3FRKA 4R5ZA 3BS8A 2FN6A 1E5FA 1LC8A 2QB2A 3B46A 3CQ4A 1P3WA 3GZDC 4F5LA 4A00A 4A0HA 3DU4A 1ARSA 1GEWA 1C0NA 2W8JA 3EIAA 3HT4A 2KFPA 1ARGA 1SVVA 3A9YA 4A6TA 3B1EA 3HDOA 3K28A 2VIBA 2CINA 1YOOA 3E2ZB 4KXKA 5G2QA 3WGCA 2C7TA 4OBUA 5M4DA 3DZZA 1EQBA 1CZCA 2D63A 2E54A 4WBTA 3MKJA 5E5IA 4RIZA 2EPJA 3KE3A 3WY7A 1Y4IA 1W23A 2QB3A 5I92A 3R9AA 4F5FA 3G7QA 1DJEA 1SFFA 4LW4A 1IJIA 5D5SA 3BCAA 1FC4A 5F9SA 5D95A 2BWPA 3PAAA 2HZPA 4IXSA 2WK7A 2VMYA 2Z61A 1YIZA 1MAQA 2CH2A 2W7MA 4CXQA 1TOGA 3A8UX 1ASDA 5EAAA 1AY8A 1IBJA 2ZJGA 3H14A 3PDBA 2ORDA 2CSTA 5E3KA 1M4NA 4N0BA 1M32A 1WYUA 3DXWA 4J5UA 2BYJA 1VP4A 3PPLA 2AY8A 4I8AA 1AJSA 1AJRA 4RKDA 2AY9A 2PO3A 3DODA 3DYDA 1AKAA 4JEZA 3A9XA 3RBFA 1Z7DA 3ZRPA 1O62A 1GC0A 1AHXA 1FG7A 2DGLA 2OGEA 4FFCA 1ASNA 4UHNA 1AHGA 1LK9A 2Z9WA 4E3QA 1W7MA 3MAFA 2DKJA 4XAUA 1ASAA 2BIAA 4ZASA 3TFUA 1X0MA 3CQ6A 2QMAA 1B8GA 2D7ZA 3CAIA 3OKSA 3LVJA 3QN6A 2YCNA 3B8XA 4UOYA 1ZC9A 4J8LA 5EIGB 1MGVA 2EZ1A 1ZODA 1B5PA 2A1VA 4R5FA 2W7HA 1TOKA 1QJ5A 3AEOA 1S09A 3NU8A 1KKJA 2VMPA 2YOBA 1VJOA 1ELQA 1BJOB 1AKBA 1V72A 5FT8A 2ZYJA 1V2DA 1KMJA 1M0QA 3USFA 4EB5A 4F5KA 3LV2A 3UWCA 3AEMA 1W7NA 1O69A 3NYTA 4GE7A 3GWPA 4ZLVA 3LVLB 2HUUA 1C9CA 2YRRA 3E77A 1QJ3A 5DB5A 3ASBA 4BA4A 4U2HA 1ARTA 2OKJA 1I48A 3I4JA 4ZWVA 2WB6A 4K2MA 2NMPA 1AY5A 1G7WA 4OBVA 4AO9A 2AATA 2D64A 2VGTA 3G0TA 3P1TA 4W1VA 3OP7A 2X3LA 3PJ0A 4MKKA 1I43A 4IXOA 3W1IA 2W8VA 3Q8NA 4ADDA 2DGKA 3FCRA 3BCBA 1M6SA 2ZSMA 4EB7A 1GC4A 2AY1A 2CJGA 2OGAA 5HDMA 4FL0A 3KGXA 4Q31A 5EFSA 1BQDA 4CBRA 1DJ9A 1RVYA 2HP1A 4Y0DA 3PDBB 1IUGA 1LS3A 1UU1A 5G4JA 4UQVA 5DX5A 1UU2A 3II0A 1WYUB 5E4ZA 1GEXA 1JS6A 2YKYA 5HHYA 4ATQA 2OATA 2R5CA 4MGRA 1AJSB 3EIBA 1RVUA 1DJUA 2YKVA 4RJ0A 4W5KA 3FQ7A 1X29A 3VK4A 3I5TA 2ZUKA 3NYSA 3JWAA 3AV7A 2C81A 2V1PA 1C7GA 3PIUA 4CBSA 1GBNA 2Z1ZA 4R2NA 1OXOA 2VI8A 4RKCA 1O61A 2DGMA 3VK2A 1MDZA 1Z3ZA 1T3IA 2D7YA 1G4XA 1IAYA 3NUBA 4IY7A 5G0AA 4E1OA 4GDYA 3HBXA 4Y0HA 3MEBA 2Z9UA 1H1CA 1ARIA 3LY1A 2VGSA 3CQ5A 3EUCA 3MAFB 2CFBA 3MBBA 4K2BA 3N4SA 1DKAA 1TOEA 4Q6RA 3K7YA 4ZDPA 1MAPA 4F5IA 3HLMA 2X5FA 1KMKA 4RITA 3NNKA 4H63Q 3PDXA 3FKDA 3L44A 1C4KA 4L0OA 2R5EA 4ZSYA 4OC9A 3TATA 1QIRA 1TASA 4Q75A 2ZY5A 1X28A 2GQNA 1AMSA 3EI5A 4W1XA 4F4EA 5LH9A 2HUFA 3AEPA 4IXZA 1IVRA 3AOVA 5DJ9A 1DTYA 1H0CA 2FNUA 2VMXA 1D7VA 3B1DA 4GRXA 2ZY2A 3KKIA 3NU7A 1YJYA 1B9HA 4ADCA 3MC6C 1V2EA 4WD2A 2BI5A 2Z1YA 1B9IA 3FZ7A 1JS3A 3FVXA 4MSOA 1GDEA 5EAVA 1AMRA 2YKUA 3FD0A 1UKJA 2W7DA 2EZ2A 2E7UA 2QA3A 1KAFA 2Q7WA 1I29A 1LW4A 1O4SA 3A9ZA 4M2MA 3DRDA 1I41A 1TOJA 1X2AA 3BN1A 3QPGA 4OMAA 3FZ6A 2YRIA 2FM1A 3LWSA 3EI8A 1AY4A 2W8WA 2AEUA 2DOUA 3ELPA 2Z9VA 3GSBA 3W1HA 3CBFA 3JZLA 4XJOA 5C6UA 3HMUA 4F5MA 1QITA 3ZRQA 4MQQA 2FKIA 2GSAA 2G6WA 4WYFA 4WYAA 2JISA 1DGEA 4EFFA 2FQ6A 4W1WA 4AZJA 1MDOA 4AOAA 2BI9A 4HF8A 2BYLA 5BJ3A 3DC1A 1CQ8A 2VGVA 2VMVA 3GJUA 3RUYA 2AY5A 2Z9XA 4ZDLA 4XK1A 2R5CB 4NOGA 3WCNA 4E77A 2VLHA 3TCMA 1IX7A 1U08A 4XJMA 2W7EA 5FT5A 3WGBA 1BQAA 3F6TA 3JU7A 2ZP7A 2HUIA 1CZEA 3PD6A 4LNJA 4JEWA 2VMZA 1AMAA 4RAEA 2ZSLA 1CL2A 3EI7A 1OHVA 2CB1A 2BI2A 2W8TA 1CJ0A 7AATA 4ZAHA 4A6UA 3ASAA 1OHYA 2VGZA 4EU1A 1G7XA 4K05A 3AATA 2YCPA 3UAKA 3WKSA 5K8BA 3E9KA 2GB3A 2VMNA 4GE4A 2D66A 4ISYA 1AHFA 2JJEA 4M2JA 5G09A 1WSTA 1M7YA 1SPAA 3BWNA 1LC7A 3T32A 1WYTA 4F5GA 3AOWA 4DQ6A 1ELUA 4B9BA 2JJFA 3VOMA 4M2KA 3QM2A 4WB0A 1OXPA 1KL1A 3HL2A 3ACZA 3R4TA 3WCOA 1BT4A 4PFFA 2F8JA 2JJGA 4R8DA 4RM1A 1CQ6A 1ASBA 1YJZA 2VMOA 4KYOA 3N7NA 4OYTA
chains in the Genus database with same CATH topology
2GMSA 4A72A 1DFOA 3NYUA 1DGDA 1AHYA 1PFFA 5M49A 1C7OA 4CVQA 3GZDA 2FYFA 4UHOA 1XI9A 4ZM4A 2JJHA 1AAWA 2YHKA 3RI6A 2JGTA 2WK9A 4LW2A 1QZ9A 4GEBA 4WLHA 1OATA 4O6ZA 3FVSA 3FVUA 1EJIA 1CL1A 1S08A 2Z67A 4JF1A 3EI9A 3GETA 2R0TA 2EYQA 5EUDA 3E2FA 2YKXA 2AY6A 1ASCA 1J32A 2CANA 1AX4A 2CH1A 1ASGA 2BIGA 4GE9A 5TF5A 3RQ1A 3AENA 4Q76A 3QHXA 1VEFA 2AY4A 3HQTA 4JE5D 3ZRRA 3M5UA 4JF0A 3FQ8A 4MKJA 3NRAA 1M0OA 3FQAA 1WKHA 3NUIA 1B5OA 3ELEA 5FT4A 2CJDA 1S07A 3WZFA 4BQ0A 1C7NA 4DBCA 4P7YA 2OQXA 3UE8A 2BIEA 3N0LA 3N4RA 4AH3A 2BKWA 1LKCA 1TPLA 1V2FA 2HOXA 1RV3A 3JWBA 3MAUA 5JAYA 5EQCA 3FDDA 1S0AA 4JEVA 1BJ4A 1GC3A 1SZSA 4LC3A 1N31A 2W7FA 1E5EA 3AEJC 3IHJA 3MC6A 4WYDA 3ZZJA 4MQPA 1ECXA 3E6GA 3NX3A 4WYGA 3WLXA 1KKPA 4K2IA 2W8UA 1AICA 4W8IA 5AX8A 3W1JA 4AZKA 4E3RA 3N4XA 2VMSA 1UU0A 3LVMA 4ZWMA 1SZKA 5LHAA 2HOZA 3FFRA 3N5MA 3JTXA 3PD6B 4F5JA 1QGNA 3FDBA 1G4VA 3I16A 4XJLA 2VI9A 1KL2A 2XBNA 1CS1A 4IYOA 2JG2A 1ASMA 2AY2A 3EZ1A 4U1TA 1W3UA 2DKBA 4JEYA 1AMQA 4ZSWA 3LG0A 5F8VA 3GZCA 2CJHA 3B1CA 1MLYA 2PB0A 4N0WA 1BS0A 1BJNA 1AAMA 2BWOA 1JG8A 1ASFA 3BCXA 4JEXA 1N2TA 3TQXA 4CXRA 3L8AA 4IX8A 5IWQA 2C0RA 4ITXA 2RFVA 3NTJA 1WYTB 1WYVA 2OKKA 3RCHA 3RBLA 2BI1A 4WB0B 3VK3A 1IX6A 4W91A 4ZDOA 2D65A 4Y0IA 4WYEA 3TFTA 4ITGA 4MY5A 4WLJA 1BJWA 1AIBA 4H51A 5G2PA 4UHMA 1MDXA 1W7LA 2GMUA 2O7CA 1PG8A 1OHWA 3LVKA 3DXVA 1D7SA 4A0RA 1FG3A 5HXXA 2W7GA 2WK8A 3ISLA 2EGYA 1SZUA 2X8UA 4RLGA 3QGUA 1CQ7A 1M0NA 4IW7A 5M46A 3BC8A 2W7JA 1J04A 2BWNA 1ORDA 2XH1A 3GR9A 3BB8A 3VP6A 4XJPA 1YNUA 4B98A 3COGA 2VMQA 1MLZA 2VMTA 3E2ZA 3ECDA 2HP2A 2CY8A 1SF2A 2HOYA 2BHXA 2VLFA 1ARHA 1GC2A 1N8PA 4TN4A 3A2BA 4A0FA 2V0YA 1XEYA 2VGUA 2G7JA 4LNMA 3K40A 8AATA 1QISA 4PFNA 4RJYA 1D7UA 2PB2A 2VIAA 2VMWA 1PMOA 2VYCA 3AENB 3DR7A 3EZSA 3G8MA 9AATA 4DGTA 2YCTA 2R2NA 1D2FA 5KTBA 4A0GA 2O1BA 3D6KA 1M0PA 3FFHA 4KAMA 4OCAA 2TPLA 2DR1A 3ZZKA 2QBTA 1GEYA 3PGYA 3QI6A 4P3MA 2ZY3A 3VAXA 2FNIA 4HVKA 5EUEA 1BKGA 3H9XA 4ADBA 1S06A 4PIWA 4WXFA 1AKCA 3GBXA 4QGRA 1WKGA 2CTZA 2E7IA 2WKAA 4ATPA 2E7JA 3DR4A 3FTBA 5DJ1A 1YJSA 1TOIA 2W7KA 1TATA 1ASLA 2VGWA 3E2YA 3N75A 1EG5A 4TMRA 2AY3A 4JE5A 4AO4A 4WYCA 1TARA 1IAXA 3AEMC 3FSLA 5G4IA 4EMYA 5BJ4A 2D5YA 2X5DA 3BV0A 4XEWA 4XQ2A 4LNLA 4IYOB 4BMKA 1LC5A 3QBOA 1YAAA 3HVYA 2W7IA 2QSRA 5EUNA 2ZY4A 3WKRA 4A6RA 5J8QA 1ZOBA 3P6KA 5M4BA 3FZ8A 4GSAA 1PMMA 2VMRA 3JW9A 2O0RA 2W7LA 4BA5A 4F5HA 1ASEA 1BW0A 3PA9A 3F9TA 1JF9A 3H7FA 3AELA 3KGWA 3MADA 3BWNC 4TV7A 3WX9A 2EO5A 4MQRA 1AIAA 1WYVB 5EIGA 4BHDA 1LW5A 2QLRA 3RCHB 4ZM3A 2C44A 2EH6A 3AEJA 1AHEA 4WXGA 2VMUA 2BI3A 2Z20A 4WXBA 2ZC0A 2AY7A 3IF2A 3F0HA 4WP0A 3NDNA 5FT6A 4ADEA 3BWOA 4PVFA 2AEVA 4OT8A 3EI6A 2D61A 1BJOA 1YIYA 1B4XA 1D7RA 1IX8A 1RV4A 3ATHA 4OTLA 1GCKA 2HORA 1GD9A 3FRKA 4R5ZA 3BS8A 2FN6A 1E5FA 1LC8A 2QB2A 3B46A 3CQ4A 1P3WA 3GZDC 4F5LA 4A00A 4A0HA 3DU4A 1ARSA 1GEWA 1C0NA 2W8JA 3EIAA 3HT4A 2KFPA 1ARGA 1SVVA 3A9YA 4A6TA 3B1EA 3HDOA 3K28A 2VIBA 2CINA 1YOOA 3E2ZB 4KXKA 5G2QA 3WGCA 2C7TA 4OBUA 5M4DA 3DZZA 1EQBA 1CZCA 2D63A 2E54A 4WBTA 3MKJA 5E5IA 4RIZA 2EPJA 3KE3A 3WY7A 1Y4IA 1W23A 2QB3A 5I92A 3R9AA 4F5FA 3G7QA 1DJEA 1SFFA 4LW4A 1IJIA 5D5SA 3BCAA 1FC4A 5F9SA 5D95A 2BWPA 3PAAA 2HZPA 4IXSA 2WK7A 2VMYA 2Z61A 1YIZA 1MAQA 2CH2A 2W7MA 4CXQA 1TOGA 3A8UX 1ASDA 5EAAA 1AY8A 1IBJA 2ZJGA 3H14A 3PDBA 2ORDA 2CSTA 5E3KA 1M4NA 4N0BA 1M32A 1WYUA 3DXWA 4J5UA 2BYJA 1VP4A 3PPLA 2AY8A 4I8AA 1AJSA 1AJRA 4RKDA 2AY9A 2PO3A 3DODA 3DYDA 1AKAA 4JEZA 3A9XA 3RBFA 1Z7DA 3ZRPA 1O62A 1GC0A 1AHXA 1FG7A 2DGLA 2OGEA 4FFCA 1ASNA 4UHNA 1AHGA 1LK9A 2Z9WA 4E3QA 1W7MA 3MAFA 2DKJA 4XAUA 1ASAA 2BIAA 4ZASA 3TFUA 1X0MA 3CQ6A 2QMAA 1B8GA 2D7ZA 3CAIA 3OKSA 3LVJA 3QN6A 2YCNA 3B8XA 4UOYA 1ZC9A 4J8LA 5EIGB 1MGVA 2EZ1A 1ZODA 1B5PA 2A1VA 4R5FA 2W7HA 1TOKA 1QJ5A 3AEOA 1S09A 3NU8A 1KKJA 2VMPA 2YOBA 1VJOA 1ELQA 1BJOB 1AKBA 1V72A 5FT8A 2ZYJA 1V2DA 1KMJA 1M0QA 3USFA 4EB5A 4F5KA 3LV2A 3UWCA 3AEMA 1W7NA 1O69A 3NYTA 4GE7A 3GWPA 4ZLVA 3LVLB 2HUUA 1C9CA 2YRRA 3E77A 1QJ3A 5DB5A 3ASBA 4BA4A 4U2HA 1ARTA 2OKJA 1I48A 3I4JA 4ZWVA 2WB6A 4K2MA 2NMPA 1AY5A 1G7WA 4OBVA 4AO9A 2AATA 2D64A 2VGTA 3G0TA 3P1TA 4W1VA 3OP7A 2X3LA 3PJ0A 4MKKA 1I43A 4IXOA 3W1IA 2W8VA 3Q8NA 4ADDA 2DGKA 3FCRA 3BCBA 1M6SA 2ZSMA 4EB7A 1GC4A 2AY1A 2CJGA 2OGAA 5HDMA 4FL0A 3KGXA 4Q31A 5EFSA 1BQDA 4CBRA 1DJ9A 1RVYA 2HP1A 4Y0DA 3PDBB 1IUGA 1LS3A 1UU1A 5G4JA 4UQVA 5DX5A 1UU2A 3II0A 1WYUB 5E4ZA 1GEXA 1JS6A 2YKYA 5HHYA 4ATQA 2OATA 2R5CA 4MGRA 1AJSB 3EIBA 1RVUA 1DJUA 2YKVA 4RJ0A 4W5KA 3FQ7A 1X29A 3VK4A 3I5TA 2ZUKA 3NYSA 3JWAA 3AV7A 2C81A 2V1PA 1C7GA 3PIUA 4CBSA 1GBNA 2Z1ZA 4R2NA 1OXOA 2VI8A 4RKCA 1O61A 2DGMA 3VK2A 1MDZA 1Z3ZA 1T3IA 2D7YA 1G4XA 1IAYA 3NUBA 4IY7A 5G0AA 4E1OA 4GDYA 3HBXA 4Y0HA 3MEBA 2Z9UA 1H1CA 1ARIA 3LY1A 2VGSA 3CQ5A 3EUCA 3MAFB 2CFBA 3MBBA 4K2BA 3N4SA 1DKAA 1TOEA 4Q6RA 3K7YA 4ZDPA 1MAPA 4F5IA 3HLMA 2X5FA 1KMKA 4RITA 3NNKA 4H63Q 3PDXA 3FKDA 3L44A 1C4KA 4L0OA 2R5EA 4ZSYA 4OC9A 3TATA 1QIRA 1TASA 4Q75A 2ZY5A 1X28A 2GQNA 1AMSA 3EI5A 4W1XA 4F4EA 5LH9A 2HUFA 3AEPA 4IXZA 1IVRA 3AOVA 5DJ9A 1DTYA 1H0CA 2FNUA 2VMXA 1D7VA 3B1DA 4GRXA 2ZY2A 3KKIA 3NU7A 1YJYA 1B9HA 4ADCA 3MC6C 1V2EA 4WD2A 2BI5A 2Z1YA 1B9IA 3FZ7A 1JS3A 3FVXA 4MSOA 1GDEA 5EAVA 1AMRA 2YKUA 3FD0A 1UKJA 2W7DA 2EZ2A 2E7UA 2QA3A 2Q7WA 1I29A 1LW4A 1O4SA 3A9ZA 4M2MA 3DRDA 1I41A 1TOJA 1X2AA 3BN1A 3QPGA 4OMAA 3FZ6A 2YRIA 2FM1A 3LWSA 3EI8A 1AY4A 2W8WA 2AEUA 2DOUA 3ELPA 2Z9VA 3GSBA 3W1HA 3CBFA 3JZLA 4XJOA 5C6UA 3HMUA 4F5MA 1QITA 3ZRQA 4MQQA 2FKIA 2GSAA 2G6WA 4WYFA 4WYAA 2JISA 1DGEA 4EFFA 2FQ6A 4W1WA 4AZJA 1MDOA 4AOAA 2BI9A 4HF8A 2BYLA 5BJ3A 3DC1A 1CQ8A 2VGVA 2VMVA 3GJUA 3RUYA 2AY5A 2Z9XA 4ZDLA 4XK1A 2R5CB 4NOGA 3WCNA 4E77A 2VLHA 3TCMA 1IX7A 1U08A 4XJMA 2W7EA 5FT5A 3WGBA 1BQAA 3F6TA 3JU7A 2ZP7A 2HUIA 1CZEA 3PD6A 4LNJA 4JEWA 2VMZA 1AMAA 4RAEA 2ZSLA 1CL2A 3EI7A 1OHVA 2CB1A 2BI2A 2W8TA 1CJ0A 7AATA 4ZAHA 4A6UA 3ASAA 1OHYA 2VGZA 4EU1A 1G7XA 4K05A 3AATA 2YCPA 3UAKA 3WKSA 5K8BA 3E9KA 2GB3A 2VMNA 4GE4A 2D66A 4ISYA 1AHFA 2JJEA 4M2JA 5G09A 1WSTA 1M7YA 1SPAA 3BWNA 1LC7A 3T32A 1WYTA 4F5GA 3AOWA 4DQ6A 1ELUA 4B9BA 2JJFA 3VOMA 4M2KA 3QM2A 4WB0A 1OXPA 1KL1A 3HL2A 3ACZA 3R4TA 3WCOA 1BT4A 4PFFA 2F8JA 2JJGA 4R8DA 4RM1A 1CQ6A 1ASBA 1YJZA 2VMOA 4KYOA 3N7NA 4OYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GMS A;  4A72 A;  1DFO A;  3NYU A;  1DGD A;  1AHY A;  1PFF A;  5M49 A;  1C7O A;  4CVQ A;  3GZD A;  2FYF A;  4UHO A;  1XI9 A;  4ZM4 A;  2JJH A;  1AAW A;  2YHK A;  3RI6 A;  2JGT A;  2WK9 A;  4LW2 A;  1QZ9 A;  4GEB A;  4WLH A;  1OAT A;  4O6Z A;  3FVS A;  3FVU A;  1EJI A;  1CL1 A;  1S08 A;  2Z67 A;  4JF1 A;  3EI9 A;  3GET A;  2R0T A;  5EUD A;  3E2F A;  2YKX A;  2AY6 A;  1ASC A;  1J32 A;  2CAN A;  1AX4 A;  2CH1 A;  1ASG A;  2BIG A;  4GE9 A;  5TF5 A;  3RQ1 A;  3AEN A;  4Q76 A;  3QHX A;  1VEF A;  2AY4 A;  3HQT A;  4JE5 D;  3ZRR A;  3M5U A;  4JF0 A;  3FQ8 A;  4MKJ A;  3NRA A;  1M0O A;  3FQA A;  1WKH A;  3NUI A;  1B5O A;  3ELE A;  5FT4 A;  2CJD A;  1S07 A;  3WZF A;  4BQ0 A;  1C7N A;  4DBC A;  4P7Y A;  2OQX A;  3UE8 A;  2BIE A;  3N0L A;  4AH3 A;  2BKW A;  1LKC A;  1TPL A;  1V2F A;  2HOX A;  1RV3 A;  3JWB A;  3MAU A;  5JAY A;  5EQC A;  3FDD A;  1S0A A;  4JEV A;  1BJ4 A;  1GC3 A;  1SZS A;  4LC3 A;  1N31 A;  2W7F A;  1E5E A;  3AEJ C;  3IHJ A;  3MC6 A;  4WYD A;  3ZZJ A;  4MQP A;  1ECX A;  3E6G A;  3NX3 A;  4WYG A;  3WLX A;  1KKP A;  4K2I A;  2W8U A;  1AIC A;  4W8I A;  5AX8 A;  3W1J A;  4AZK A;  4E3R A;  2VMS A;  1UU0 A;  3LVM A;  4ZWM A;  1SZK A;  5LHA A;  2HOZ A;  3FFR A;  3N5M A;  3JTX A;  3PD6 B;  4F5J A;  1QGN A;  3FDB A;  1G4V A;  3I16 A;  4XJL A;  2VI9 A;  1KL2 A;  2XBN A;  1CS1 A;  4IYO A;  2JG2 A;  1ASM A;  2AY2 A;  3EZ1 A;  4U1T A;  1W3U A;  2DKB A;  4JEY A;  1AMQ A;  4ZSW A;  3LG0 A;  5F8V A;  3GZC A;  2CJH A;  3B1C A;  1MLY A;  2PB0 A;  4N0W A;  1BS0 A;  1BJN A;  1AAM A;  2BWO A;  1JG8 A;  1ASF A;  3BCX A;  4JEX A;  1N2T A;  3TQX A;  4CXR A;  3L8A A;  4IX8 A;  5IWQ A;  2C0R A;  4ITX A;  2RFV A;  3NTJ A;  1WYT B;  1WYV A;  2OKK A;  3RCH A;  3RBL A;  2BI1 A;  4WB0 B;  3VK3 A;  1IX6 A;  4W91 A;  4ZDO A;  2D65 A;  4Y0I A;  4WYE A;  3TFT A;  4ITG A;  4MY5 A;  4WLJ A;  1BJW A;  1AIB A;  4H51 A;  5G2P A;  4UHM A;  1MDX A;  1W7L A;  2GMU A;  2O7C A;  1PG8 A;  1OHW A;  3LVK A;  3DXV A;  1D7S A;  4A0R A;  1FG3 A;  5HXX A;  2W7G A;  2WK8 A;  3ISL A;  2EGY A;  1SZU A;  2X8U A;  4RLG A;  3QGU A;  1CQ7 A;  1M0N A;  4IW7 A;  5M46 A;  3BC8 A;  2W7J A;  1J04 A;  2BWN A;  1ORD A;  2XH1 A;  3GR9 A;  3BB8 A;  3VP6 A;  4XJP A;  1YNU A;  4B98 A;  3COG A;  2VMQ A;  1MLZ A;  2VMT A;  3E2Z A;  3ECD A;  2HP2 A;  2CY8 A;  1SF2 A;  2HOY A;  2BHX A;  2VLF A;  1ARH A;  1GC2 A;  1N8P A;  4TN4 A;  3A2B A;  4A0F A;  2V0Y A;  1XEY A;  2VGU A;  4LNM A;  3K40 A;  8AAT A;  1QIS A;  4PFN A;  4RJY A;  1D7U A;  2PB2 A;  2VIA A;  2VMW A;  1PMO A;  2VYC A;  3AEN B;  3DR7 A;  3EZS A;  3G8M A;  9AAT A;  4DGT A;  2YCT A;  2R2N A;  1D2F A;  4A0G A;  2O1B A;  3D6K A;  1M0P A;  3FFH A;  4KAM A;  4OCA A;  2TPL A;  2DR1 A;  3ZZK A;  2QBT A;  1GEY A;  3PGY A;  3QI6 A;  4P3M A;  2ZY3 A;  3VAX A;  2FNI A;  4HVK A;  5EUE A;  1BKG A;  4ADB A;  1S06 A;  4PIW A;  4WXF A;  1AKC A;  3GBX A;  4QGR A;  1WKG A;  2CTZ A;  2E7I A;  2WKA A;  4ATP A;  2E7J A;  3DR4 A;  3FTB A;  5DJ1 A;  1YJS A;  1TOI A;  2W7K A;  1TAT A;  1ASL A;  2VGW A;  3E2Y A;  3N75 A;  1EG5 A;  4TMR A;  2AY3 A;  4JE5 A;  4AO4 A;  4WYC A;  1TAR A;  1IAX A;  3AEM C;  3FSL A;  5G4I A;  4EMY A;  5BJ4 A;  2D5Y A;  2X5D A;  3BV0 A;  4XEW A;  4XQ2 A;  4LNL A;  4IYO B;  4BMK A;  1LC5 A;  3QBO A;  1YAA A;  3HVY A;  2W7I A;  5EUN A;  2ZY4 A;  3WKR A;  4A6R A;  5J8Q A;  1ZOB A;  3P6K A;  5M4B A;  3FZ8 A;  4GSA A;  1PMM A;  2VMR A;  3JW9 A;  2O0R A;  2W7L A;  4BA5 A;  4F5H A;  1ASE A;  1BW0 A;  3PA9 A;  3F9T A;  1JF9 A;  3H7F A;  3AEL A;  3KGW A;  3MAD A;  3BWN C;  4TV7 A;  3WX9 A;  2EO5 A;  4MQR A;  1AIA A;  1WYV B;  5EIG A;  4BHD A;  1LW5 A;  2QLR A;  3RCH B;  4ZM3 A;  2C44 A;  2EH6 A;  3AEJ A;  1AHE A;  4WXG A;  2VMU A;  2BI3 A;  2Z20 A;  4WXB A;  2ZC0 A;  2AY7 A;  3IF2 A;  3F0H A;  4WP0 A;  3NDN A;  5FT6 A;  4ADE A;  3BWO A;  4PVF A;  2AEV A;  4OT8 A;  3EI6 A;  2D61 A;  1BJO A;  1YIY A;  1B4X A;  1D7R A;  1IX8 A;  1RV4 A;  3ATH A;  4OTL A;  1GCK A;  2HOR A;  1GD9 A;  3FRK A;  4R5Z A;  3BS8 A;  2FN6 A;  1E5F A;  1LC8 A;  2QB2 A;  3B46 A;  3CQ4 A;  1P3W A;  3GZD C;  4F5L A;  4A00 A;  4A0H A;  3DU4 A;  1ARS A;  1GEW A;  1C0N A;  2W8J A;  3EIA A;  3HT4 A;  1ARG A;  1SVV A;  3A9Y A;  4A6T A;  3B1E A;  3HDO A;  3K28 A;  2VIB A;  2CIN A;  1YOO A;  3E2Z B;  4KXK A;  5G2Q A;  3WGC A;  2C7T A;  4OBU A;  5M4D A;  3DZZ A;  1EQB A;  1CZC A;  2D63 A;  2E54 A;  4WBT A;  3MKJ A;  5E5I A;  4RIZ A;  2EPJ A;  3KE3 A;  3WY7 A;  1Y4I A;  1W23 A;  2QB3 A;  5I92 A;  3R9A A;  4F5F A;  3G7Q A;  1DJE A;  1SFF A;  4LW4 A;  1IJI A;  5D5S A;  3BCA A;  1FC4 A;  5F9S A;  5D95 A;  2BWP A;  3PAA A;  2HZP A;  4IXS A;  2WK7 A;  2VMY A;  2Z61 A;  1YIZ A;  1MAQ A;  2CH2 A;  2W7M A;  4CXQ A;  1TOG A;  3A8U X;  1ASD A;  5EAA A;  1AY8 A;  1IBJ A;  2ZJG A;  3H14 A;  3PDB A;  2ORD A;  2CST A;  5E3K A;  1M4N A;  4N0B A;  1M32 A;  1WYU A;  3DXW A;  4J5U A;  2BYJ A;  1VP4 A;  3PPL A;  2AY8 A;  4I8A A;  1AJS A;  1AJR A;  4RKD A;  2AY9 A;  2PO3 A;  3DOD A;  3DYD A;  1AKA A;  4JEZ A;  3A9X A;  3RBF A;  1Z7D A;  3ZRP A;  1O62 A;  1GC0 A;  1AHX A;  1FG7 A;  2DGL A;  2OGE A;  4FFC A;  1ASN A;  4UHN A;  1AHG A;  1LK9 A;  2Z9W A;  4E3Q A;  1W7M A;  3MAF A;  2DKJ A;  4XAU A;  1ASA A;  2BIA A;  4ZAS A;  3TFU A;  1X0M A;  3CQ6 A;  2QMA A;  1B8G A;  2D7Z A;  3CAI A;  3OKS A;  3LVJ A;  3QN6 A;  2YCN A;  3B8X A;  4UOY A;  1ZC9 A;  4J8L A;  5EIG B;  1MGV A;  2EZ1 A;  1ZOD A;  1B5P A;  4R5F A;  2W7H A;  1TOK A;  1QJ5 A;  3AEO A;  1S09 A;  3NU8 A;  1KKJ A;  2VMP A;  2YOB A;  1VJO A;  1ELQ A;  1BJO B;  1AKB A;  1V72 A;  5FT8 A;  2ZYJ A;  1V2D A;  1KMJ A;  1M0Q A;  3USF A;  4EB5 A;  4F5K A;  3LV2 A;  3UWC A;  3AEM A;  1W7N A;  1O69 A;  3NYT A;  4GE7 A;  3GWP A;  4ZLV A;  3LVL B;  2HUU A;  1C9C A;  2YRR A;  3E77 A;  1QJ3 A;  5DB5 A;  3ASB A;  4BA4 A;  4U2H A;  1ART A;  2OKJ A;  1I48 A;  3I4J A;  4ZWV A;  4K2M A;  2NMP A;  1AY5 A;  1G7W A;  4OBV A;  4AO9 A;  2AAT A;  2D64 A;  2VGT A;  3G0T A;  3P1T A;  4W1V A;  3OP7 A;  2X3L A;  3PJ0 A;  4MKK A;  1I43 A;  4IXO A;  3W1I A;  2W8V A;  3Q8N A;  4ADD A;  2DGK A;  3FCR A;  3BCB A;  1M6S A;  2ZSM A;  4EB7 A;  1GC4 A;  2AY1 A;  2CJG A;  2OGA A;  5HDM A;  4FL0 A;  3KGX A;  4Q31 A;  5EFS A;  1BQD A;  4CBR A;  1DJ9 A;  1RVY A;  2HP1 A;  4Y0D A;  3PDB B;  1IUG A;  1LS3 A;  1UU1 A;  5G4J A;  4UQV A;  5DX5 A;  1UU2 A;  3II0 A;  1WYU B;  5E4Z A;  1GEX A;  1JS6 A;  2YKY A;  5HHY A;  4ATQ A;  2OAT A;  2R5C A;  4MGR A;  1AJS B;  3EIB A;  1RVU A;  1DJU A;  2YKV A;  4RJ0 A;  4W5K A;  3FQ7 A;  1X29 A;  3VK4 A;  3I5T A;  2ZUK A;  3NYS A;  3JWA A;  3AV7 A;  2C81 A;  2V1P A;  1C7G A;  3PIU A;  4CBS A;  1GBN A;  2Z1Z A;  4R2N A;  1OXO A;  2VI8 A;  4RKC A;  1O61 A;  2DGM A;  3VK2 A;  1MDZ A;  1Z3Z A;  1T3I A;  2D7Y A;  1G4X A;  1IAY A;  3NUB A;  4IY7 A;  5G0A A;  4E1O A;  4GDY A;  3HBX A;  4Y0H A;  3MEB A;  2Z9U A;  1H1C A;  1ARI A;  3LY1 A;  2VGS A;  3CQ5 A;  3EUC A;  3MAF B;  2CFB A;  3MBB A;  4K2B A;  1DKA A;  1TOE A;  4Q6R A;  3K7Y A;  4ZDP A;  1MAP A;  4F5I A;  3HLM A;  2X5F A;  1KMK A;  4RIT A;  3NNK A;  3PDX A;  3FKD A;  3L44 A;  1C4K A;  4L0O A;  2R5E A;  4ZSY A;  4OC9 A;  3TAT A;  1QIR A;  1TAS A;  4Q75 A;  2ZY5 A;  1X28 A;  2GQN A;  1AMS A;  3EI5 A;  4W1X A;  4F4E A;  5LH9 A;  2HUF A;  3AEP A;  4IXZ A;  1IVR A;  3AOV A;  5DJ9 A;  1DTY A;  1H0C A;  2FNU A;  2VMX A;  1D7V A;  3B1D A;  4GRX A;  2ZY2 A;  3KKI A;  3NU7 A;  1YJY A;  1B9H A;  4ADC A;  3MC6 C;  1V2E A;  4WD2 A;  2BI5 A;  2Z1Y A;  1B9I A;  3FZ7 A;  1JS3 A;  3FVX A;  4MSO A;  1GDE A;  5EAV A;  1AMR A;  2YKU A;  3FD0 A;  1UKJ A;  2W7D A;  2EZ2 A;  2E7U A;  2QA3 A;  2Q7W A;  1I29 A;  1LW4 A;  1O4S A;  3A9Z A;  4M2M A;  3DRD A;  1I41 A;  1TOJ A;  1X2A A;  3BN1 A;  3QPG A;  4OMA A;  3FZ6 A;  2YRI A;  2FM1 A;  3LWS A;  3EI8 A;  1AY4 A;  2W8W A;  2AEU A;  2DOU A;  3ELP A;  2Z9V A;  3GSB A;  3W1H A;  3CBF A;  3JZL A;  4XJO A;  5C6U A;  3HMU A;  4F5M A;  1QIT A;  3ZRQ A;  4MQQ A;  2GSA A;  2G6W A;  4WYF A;  4WYA A;  2JIS A;  1DGE A;  4EFF A;  2FQ6 A;  4W1W A;  4AZJ A;  1MDO A;  4AOA A;  2BI9 A;  4HF8 A;  2BYL A;  5BJ3 A;  3DC1 A;  1CQ8 A;  2VGV A;  2VMV A;  3GJU A;  3RUY A;  2AY5 A;  2Z9X A;  4ZDL A;  4XK1 A;  2R5C B;  4NOG A;  3WCN A;  4E77 A;  2VLH A;  3TCM A;  1IX7 A;  1U08 A;  4XJM A;  2W7E A;  5FT5 A;  3WGB A;  1BQA A;  3F6T A;  3JU7 A;  2ZP7 A;  2HUI A;  1CZE A;  3PD6 A;  4LNJ A;  4JEW A;  2VMZ A;  1AMA A;  4RAE A;  2ZSL A;  1CL2 A;  3EI7 A;  1OHV A;  2CB1 A;  2BI2 A;  2W8T A;  1CJ0 A;  7AAT A;  4ZAH A;  4A6U A;  3ASA A;  1OHY A;  2VGZ A;  4EU1 A;  1G7X A;  3AAT A;  2YCP A;  3UAK A;  3WKS A;  5K8B A;  3E9K A;  2GB3 A;  2VMN A;  4GE4 A;  2D66 A;  4ISY A;  1AHF A;  2JJE A;  4M2J A;  5G09 A;  1WST A;  1M7Y A;  1SPA A;  3BWN A;  1LC7 A;  3T32 A;  1WYT A;  4F5G A;  3AOW A;  4DQ6 A;  1ELU A;  4B9B A;  2JJF A;  3VOM A;  4M2K A;  3QM2 A;  4WB0 A;  1OXP A;  1KL1 A;  3HL2 A;  3ACZ A;  3R4T A;  3WCO A;  1BT4 A;  4PFF A;  2F8J A;  2JJG A;  4R8D A;  4RM1 A;  1CQ6 A;  1ASB A;  1YJZ A;  2VMO A;  4KYO A;  4OYT A; 
#chains in the Genus database with same CATH topology
 2GMS A;  4A72 A;  1DFO A;  3NYU A;  1DGD A;  1AHY A;  1PFF A;  5M49 A;  1C7O A;  4CVQ A;  3GZD A;  2FYF A;  4UHO A;  1XI9 A;  4ZM4 A;  2JJH A;  1AAW A;  2YHK A;  3RI6 A;  2JGT A;  2WK9 A;  4LW2 A;  1QZ9 A;  4GEB A;  4WLH A;  1OAT A;  4O6Z A;  3FVS A;  3FVU A;  1EJI A;  1CL1 A;  1S08 A;  2Z67 A;  4JF1 A;  3EI9 A;  3GET A;  2R0T A;  2EYQ A;  5EUD A;  3E2F A;  2YKX A;  2AY6 A;  1ASC A;  1J32 A;  2CAN A;  1AX4 A;  2CH1 A;  1ASG A;  2BIG A;  4GE9 A;  5TF5 A;  3RQ1 A;  3AEN A;  4Q76 A;  3QHX A;  1VEF A;  2AY4 A;  3HQT A;  4JE5 D;  3ZRR A;  3M5U A;  4JF0 A;  3FQ8 A;  4MKJ A;  3NRA A;  1M0O A;  3FQA A;  1WKH A;  3NUI A;  1B5O A;  3ELE A;  5FT4 A;  2CJD A;  1S07 A;  3WZF A;  4BQ0 A;  1C7N A;  4DBC A;  4P7Y A;  2OQX A;  3UE8 A;  2BIE A;  3N0L A;  3N4R A;  4AH3 A;  2BKW A;  1LKC A;  1TPL A;  1V2F A;  2HOX A;  1RV3 A;  3JWB A;  3MAU A;  5JAY A;  5EQC A;  3FDD A;  1S0A A;  4JEV A;  1BJ4 A;  1GC3 A;  1SZS A;  4LC3 A;  1N31 A;  2W7F A;  1E5E A;  3AEJ C;  3IHJ A;  3MC6 A;  4WYD A;  3ZZJ A;  4MQP A;  1ECX A;  3E6G A;  3NX3 A;  4WYG A;  3WLX A;  1KKP A;  4K2I A;  2W8U A;  1AIC A;  4W8I A;  5AX8 A;  3W1J A;  4AZK A;  4E3R A;  3N4X A;  2VMS A;  1UU0 A;  3LVM A;  4ZWM A;  1SZK A;  5LHA A;  2HOZ A;  3FFR A;  3N5M A;  3JTX A;  3PD6 B;  4F5J A;  1QGN A;  3FDB A;  1G4V A;  3I16 A;  4XJL A;  2VI9 A;  1KL2 A;  2XBN A;  1CS1 A;  4IYO A;  2JG2 A;  1ASM A;  2AY2 A;  3EZ1 A;  4U1T A;  1W3U A;  2DKB A;  4JEY A;  1AMQ A;  4ZSW A;  3LG0 A;  5F8V A;  3GZC A;  2CJH A;  3B1C A;  1MLY A;  2PB0 A;  4N0W A;  1BS0 A;  1BJN A;  1AAM A;  2BWO A;  1JG8 A;  1ASF A;  3BCX A;  4JEX A;  1N2T A;  3TQX A;  4CXR A;  3L8A A;  4IX8 A;  5IWQ A;  2C0R A;  4ITX A;  2RFV A;  3NTJ A;  1WYT B;  1WYV A;  2OKK A;  3RCH A;  3RBL A;  2BI1 A;  4WB0 B;  3VK3 A;  1IX6 A;  4W91 A;  4ZDO A;  2D65 A;  4Y0I A;  4WYE A;  3TFT A;  4ITG A;  4MY5 A;  4WLJ A;  1BJW A;  1AIB A;  4H51 A;  5G2P A;  4UHM A;  1MDX A;  1W7L A;  2GMU A;  2O7C A;  1PG8 A;  1OHW A;  3LVK A;  3DXV A;  1D7S A;  4A0R A;  1FG3 A;  5HXX A;  2W7G A;  2WK8 A;  3ISL A;  2EGY A;  1SZU A;  2X8U A;  4RLG A;  3QGU A;  1CQ7 A;  1M0N A;  4IW7 A;  5M46 A;  3BC8 A;  2W7J A;  1J04 A;  2BWN A;  1ORD A;  2XH1 A;  3GR9 A;  3BB8 A;  3VP6 A;  4XJP A;  1YNU A;  4B98 A;  3COG A;  2VMQ A;  1MLZ A;  2VMT A;  3E2Z A;  3ECD A;  2HP2 A;  2CY8 A;  1SF2 A;  2HOY A;  2BHX A;  2VLF A;  1ARH A;  1GC2 A;  1N8P A;  4TN4 A;  3A2B A;  4A0F A;  2V0Y A;  1XEY A;  2VGU A;  2G7J A;  4LNM A;  3K40 A;  8AAT A;  1QIS A;  4PFN A;  4RJY A;  1D7U A;  2PB2 A;  2VIA A;  2VMW A;  1PMO A;  2VYC A;  3AEN B;  3DR7 A;  3EZS A;  3G8M A;  9AAT A;  4DGT A;  2YCT A;  2R2N A;  1D2F A;  5KTB A;  4A0G A;  2O1B A;  3D6K A;  1M0P A;  3FFH A;  4KAM A;  4OCA A;  2TPL A;  2DR1 A;  3ZZK A;  2QBT A;  1GEY A;  3PGY A;  3QI6 A;  4P3M A;  2ZY3 A;  3VAX A;  2FNI A;  4HVK A;  5EUE A;  1BKG A;  3H9X A;  4ADB A;  1S06 A;  4PIW A;  4WXF A;  1AKC A;  3GBX A;  4QGR A;  1WKG A;  2CTZ A;  2E7I A;  2WKA A;  4ATP A;  2E7J A;  3DR4 A;  3FTB A;  5DJ1 A;  1YJS A;  1TOI A;  2W7K A;  1TAT A;  1ASL A;  2VGW A;  3E2Y A;  3N75 A;  1EG5 A;  4TMR A;  2AY3 A;  4JE5 A;  4AO4 A;  4WYC A;  1TAR A;  1IAX A;  3AEM C;  3FSL A;  5G4I A;  4EMY A;  5BJ4 A;  2D5Y A;  2X5D A;  3BV0 A;  4XEW A;  4XQ2 A;  4LNL A;  4IYO B;  4BMK A;  1LC5 A;  3QBO A;  1YAA A;  3HVY A;  2W7I A;  2QSR A;  5EUN A;  2ZY4 A;  3WKR A;  4A6R A;  5J8Q A;  1ZOB A;  3P6K A;  5M4B A;  3FZ8 A;  4GSA A;  1PMM A;  2VMR A;  3JW9 A;  2O0R A;  2W7L A;  4BA5 A;  4F5H A;  1ASE A;  1BW0 A;  3PA9 A;  3F9T A;  1JF9 A;  3H7F A;  3AEL A;  3KGW A;  3MAD A;  3BWN C;  4TV7 A;  3WX9 A;  2EO5 A;  4MQR A;  1AIA A;  1WYV B;  5EIG A;  4BHD A;  1LW5 A;  2QLR A;  3RCH B;  4ZM3 A;  2C44 A;  2EH6 A;  3AEJ A;  1AHE A;  4WXG A;  2VMU A;  2BI3 A;  2Z20 A;  4WXB A;  2ZC0 A;  2AY7 A;  3IF2 A;  3F0H A;  4WP0 A;  3NDN A;  5FT6 A;  4ADE A;  3BWO A;  4PVF A;  2AEV A;  4OT8 A;  3EI6 A;  2D61 A;  1BJO A;  1YIY A;  1B4X A;  1D7R A;  1IX8 A;  1RV4 A;  3ATH A;  4OTL A;  1GCK A;  2HOR A;  1GD9 A;  3FRK A;  4R5Z A;  3BS8 A;  2FN6 A;  1E5F A;  1LC8 A;  2QB2 A;  3B46 A;  3CQ4 A;  1P3W A;  3GZD C;  4F5L A;  4A00 A;  4A0H A;  3DU4 A;  1ARS A;  1GEW A;  1C0N A;  2W8J A;  3EIA A;  3HT4 A;  2KFP A;  1ARG A;  1SVV A;  3A9Y A;  4A6T A;  3B1E A;  3HDO A;  3K28 A;  2VIB A;  2CIN A;  1YOO A;  3E2Z B;  4KXK A;  5G2Q A;  3WGC A;  2C7T A;  4OBU A;  5M4D A;  3DZZ A;  1EQB A;  1CZC A;  2D63 A;  2E54 A;  4WBT A;  3MKJ A;  5E5I A;  4RIZ A;  2EPJ A;  3KE3 A;  3WY7 A;  1Y4I A;  1W23 A;  2QB3 A;  5I92 A;  3R9A A;  4F5F A;  3G7Q A;  1DJE A;  1SFF A;  4LW4 A;  1IJI A;  5D5S A;  3BCA A;  1FC4 A;  5F9S A;  5D95 A;  2BWP A;  3PAA A;  2HZP A;  4IXS A;  2WK7 A;  2VMY A;  2Z61 A;  1YIZ A;  1MAQ A;  2CH2 A;  2W7M A;  4CXQ A;  1TOG A;  3A8U X;  1ASD A;  5EAA A;  1AY8 A;  1IBJ A;  2ZJG A;  3H14 A;  3PDB A;  2ORD A;  2CST A;  5E3K A;  1M4N A;  4N0B A;  1M32 A;  1WYU A;  3DXW A;  4J5U A;  2BYJ A;  1VP4 A;  3PPL A;  2AY8 A;  4I8A A;  1AJS A;  1AJR A;  4RKD A;  2AY9 A;  2PO3 A;  3DOD A;  3DYD A;  1AKA A;  4JEZ A;  3A9X A;  3RBF A;  1Z7D A;  3ZRP A;  1O62 A;  1GC0 A;  1AHX A;  1FG7 A;  2DGL A;  2OGE A;  4FFC A;  1ASN A;  4UHN A;  1AHG A;  1LK9 A;  2Z9W A;  4E3Q A;  1W7M A;  3MAF A;  2DKJ A;  4XAU A;  1ASA A;  2BIA A;  4ZAS A;  3TFU A;  1X0M A;  3CQ6 A;  2QMA A;  1B8G A;  2D7Z A;  3CAI A;  3OKS A;  3LVJ A;  3QN6 A;  2YCN A;  3B8X A;  4UOY A;  1ZC9 A;  4J8L A;  5EIG B;  1MGV A;  2EZ1 A;  1ZOD A;  1B5P A;  2A1V A;  4R5F A;  2W7H A;  1TOK A;  1QJ5 A;  3AEO A;  1S09 A;  3NU8 A;  1KKJ A;  2VMP A;  2YOB A;  1VJO A;  1ELQ A;  1BJO B;  1AKB A;  1V72 A;  5FT8 A;  2ZYJ A;  1V2D A;  1KMJ A;  1M0Q A;  3USF A;  4EB5 A;  4F5K A;  3LV2 A;  3UWC A;  3AEM A;  1W7N A;  1O69 A;  3NYT A;  4GE7 A;  3GWP A;  4ZLV A;  3LVL B;  2HUU A;  1C9C A;  2YRR A;  3E77 A;  1QJ3 A;  5DB5 A;  3ASB A;  4BA4 A;  4U2H A;  1ART A;  2OKJ A;  1I48 A;  3I4J A;  4ZWV A;  2WB6 A;  4K2M A;  2NMP A;  1AY5 A;  1G7W A;  4OBV A;  4AO9 A;  2AAT A;  2D64 A;  2VGT A;  3G0T A;  3P1T A;  4W1V A;  3OP7 A;  2X3L A;  3PJ0 A;  4MKK A;  1I43 A;  4IXO A;  3W1I A;  2W8V A;  3Q8N A;  4ADD A;  2DGK A;  3FCR A;  3BCB A;  1M6S A;  2ZSM A;  4EB7 A;  1GC4 A;  2AY1 A;  2CJG A;  2OGA A;  5HDM A;  4FL0 A;  3KGX A;  4Q31 A;  5EFS A;  1BQD A;  4CBR A;  1DJ9 A;  1RVY A;  2HP1 A;  4Y0D A;  3PDB B;  1IUG A;  1LS3 A;  1UU1 A;  5G4J A;  4UQV A;  5DX5 A;  1UU2 A;  3II0 A;  1WYU B;  5E4Z A;  1GEX A;  1JS6 A;  2YKY A;  5HHY A;  4ATQ A;  2OAT A;  2R5C A;  4MGR A;  1AJS B;  3EIB A;  1RVU A;  1DJU A;  2YKV A;  4RJ0 A;  4W5K A;  3FQ7 A;  1X29 A;  3VK4 A;  3I5T A;  2ZUK A;  3NYS A;  3JWA A;  3AV7 A;  2C81 A;  2V1P A;  1C7G A;  3PIU A;  4CBS A;  1GBN A;  2Z1Z A;  4R2N A;  1OXO A;  2VI8 A;  4RKC A;  1O61 A;  2DGM A;  3VK2 A;  1MDZ A;  1Z3Z A;  1T3I A;  2D7Y A;  1G4X A;  1IAY A;  3NUB A;  4IY7 A;  5G0A A;  4E1O A;  4GDY A;  3HBX A;  4Y0H A;  3MEB A;  2Z9U A;  1H1C A;  1ARI A;  3LY1 A;  2VGS A;  3CQ5 A;  3EUC A;  3MAF B;  2CFB A;  3MBB A;  4K2B A;  3N4S A;  1DKA A;  1TOE A;  4Q6R A;  3K7Y A;  4ZDP A;  1MAP A;  4F5I A;  3HLM A;  2X5F A;  1KMK A;  4RIT A;  3NNK A;  4H63 Q;  3PDX A;  3FKD A;  3L44 A;  1C4K A;  4L0O A;  2R5E A;  4ZSY A;  4OC9 A;  3TAT A;  1QIR A;  1TAS A;  4Q75 A;  2ZY5 A;  1X28 A;  2GQN A;  1AMS A;  3EI5 A;  4W1X A;  4F4E A;  5LH9 A;  2HUF A;  3AEP A;  4IXZ A;  1IVR A;  3AOV A;  5DJ9 A;  1DTY A;  1H0C A;  2FNU A;  2VMX A;  1D7V A;  3B1D A;  4GRX A;  2ZY2 A;  3KKI A;  3NU7 A;  1YJY A;  1B9H A;  4ADC A;  3MC6 C;  1V2E A;  4WD2 A;  2BI5 A;  2Z1Y A;  1B9I A;  3FZ7 A;  1JS3 A;  3FVX A;  4MSO A;  1GDE A;  5EAV A;  1AMR A;  2YKU A;  3FD0 A;  1UKJ A;  2W7D A;  2EZ2 A;  2E7U A;  2QA3 A;  1KAF A;  2Q7W A;  1I29 A;  1LW4 A;  1O4S A;  3A9Z A;  4M2M A;  3DRD A;  1I41 A;  1TOJ A;  1X2A A;  3BN1 A;  3QPG A;  4OMA A;  3FZ6 A;  2YRI A;  2FM1 A;  3LWS A;  3EI8 A;  1AY4 A;  2W8W A;  2AEU A;  2DOU A;  3ELP A;  2Z9V A;  3GSB A;  3W1H A;  3CBF A;  3JZL A;  4XJO A;  5C6U A;  3HMU A;  4F5M A;  1QIT A;  3ZRQ A;  4MQQ A;  2FKI A;  2GSA A;  2G6W A;  4WYF A;  4WYA A;  2JIS A;  1DGE A;  4EFF A;  2FQ6 A;  4W1W A;  4AZJ A;  1MDO A;  4AOA A;  2BI9 A;  4HF8 A;  2BYL A;  5BJ3 A;  3DC1 A;  1CQ8 A;  2VGV A;  2VMV A;  3GJU A;  3RUY A;  2AY5 A;  2Z9X A;  4ZDL A;  4XK1 A;  2R5C B;  4NOG A;  3WCN A;  4E77 A;  2VLH A;  3TCM A;  1IX7 A;  1U08 A;  4XJM A;  2W7E A;  5FT5 A;  3WGB A;  1BQA A;  3F6T A;  3JU7 A;  2ZP7 A;  2HUI A;  1CZE A;  3PD6 A;  4LNJ A;  4JEW A;  2VMZ A;  1AMA A;  4RAE A;  2ZSL A;  1CL2 A;  3EI7 A;  1OHV A;  2CB1 A;  2BI2 A;  2W8T A;  1CJ0 A;  7AAT A;  4ZAH A;  4A6U A;  3ASA A;  1OHY A;  2VGZ A;  4EU1 A;  1G7X A;  4K05 A;  3AAT A;  2YCP A;  3UAK A;  3WKS A;  5K8B A;  3E9K A;  2GB3 A;  2VMN A;  4GE4 A;  2D66 A;  4ISY A;  1AHF A;  2JJE A;  4M2J A;  5G09 A;  1WST A;  1M7Y A;  1SPA A;  3BWN A;  1LC7 A;  3T32 A;  1WYT A;  4F5G A;  3AOW A;  4DQ6 A;  1ELU A;  4B9B A;  2JJF A;  3VOM A;  4M2K A;  3QM2 A;  4WB0 A;  1OXP A;  1KL1 A;  3HL2 A;  3ACZ A;  3R4T A;  3WCO A;  1BT4 A;  4PFF A;  2F8J A;  2JJG A;  4R8D A;  4RM1 A;  1CQ6 A;  1ASB A;  1YJZ A;  2VMO A;  4KYO A;  3N7N A;  4OYT A; 
#chains in the Genus database with same CATH homology
 2GMS A;  4A72 A;  1DFO A;  3NYU A;  1DGD A;  1AHY A;  1PFF A;  5M49 A;  1C7O A;  4CVQ A;  3GZD A;  2FYF A;  4UHO A;  1XI9 A;  4ZM4 A;  2JJH A;  1AAW A;  2YHK A;  3RI6 A;  2JGT A;  2WK9 A;  4LW2 A;  1QZ9 A;  4GEB A;  4WLH A;  1OAT A;  4O6Z A;  3FVS A;  3FVU A;  1EJI A;  1CL1 A;  1S08 A;  2Z67 A;  4JF1 A;  3EI9 A;  3GET A;  2R0T A;  2EYQ A;  5EUD A;  3E2F A;  2YKX A;  2AY6 A;  1ASC A;  1J32 A;  2CAN A;  1AX4 A;  2CH1 A;  1ASG A;  2BIG A;  4GE9 A;  5TF5 A;  3RQ1 A;  3AEN A;  4Q76 A;  3QHX A;  1VEF A;  2AY4 A;  3HQT A;  4JE5 D;  3ZRR A;  3M5U A;  4JF0 A;  3FQ8 A;  4MKJ A;  3NRA A;  1M0O A;  3FQA A;  1WKH A;  3NUI A;  1B5O A;  3ELE A;  5FT4 A;  2CJD A;  1S07 A;  3WZF A;  4BQ0 A;  1C7N A;  4DBC A;  4P7Y A;  2OQX A;  3UE8 A;  2BIE A;  3N0L A;  3N4R A;  4AH3 A;  2BKW A;  1LKC A;  1TPL A;  1V2F A;  2HOX A;  1RV3 A;  3JWB A;  3MAU A;  5JAY A;  5EQC A;  3FDD A;  1S0A A;  4JEV A;  1BJ4 A;  1GC3 A;  1SZS A;  4LC3 A;  1N31 A;  2W7F A;  1E5E A;  3AEJ C;  3IHJ A;  3MC6 A;  4WYD A;  3ZZJ A;  4MQP A;  1ECX A;  3E6G A;  3NX3 A;  4WYG A;  3WLX A;  1KKP A;  4K2I A;  2W8U A;  1AIC A;  4W8I A;  5AX8 A;  3W1J A;  4AZK A;  4E3R A;  3N4X A;  2VMS A;  1UU0 A;  3LVM A;  4ZWM A;  1SZK A;  5LHA A;  2HOZ A;  3FFR A;  3N5M A;  3JTX A;  3PD6 B;  4F5J A;  1QGN A;  3FDB A;  1G4V A;  3I16 A;  4XJL A;  2VI9 A;  1KL2 A;  2XBN A;  1CS1 A;  4IYO A;  2JG2 A;  1ASM A;  2AY2 A;  3EZ1 A;  4U1T A;  1W3U A;  2DKB A;  4JEY A;  1AMQ A;  4ZSW A;  3LG0 A;  5F8V A;  3GZC A;  2CJH A;  3B1C A;  1MLY A;  2PB0 A;  4N0W A;  1BS0 A;  1BJN A;  1AAM A;  2BWO A;  1JG8 A;  1ASF A;  3BCX A;  4JEX A;  1N2T A;  3TQX A;  4CXR A;  3L8A A;  4IX8 A;  5IWQ A;  2C0R A;  4ITX A;  2RFV A;  3NTJ A;  1WYT B;  1WYV A;  2OKK A;  3RCH A;  3RBL A;  2BI1 A;  4WB0 B;  3VK3 A;  1IX6 A;  4W91 A;  4ZDO A;  2D65 A;  4Y0I A;  4WYE A;  3TFT A;  4ITG A;  4MY5 A;  4WLJ A;  1BJW A;  1AIB A;  4H51 A;  5G2P A;  4UHM A;  1MDX A;  1W7L A;  2GMU A;  2O7C A;  1PG8 A;  1OHW A;  3LVK A;  3DXV A;  1D7S A;  4A0R A;  1FG3 A;  5HXX A;  2W7G A;  2WK8 A;  3ISL A;  2EGY A;  1SZU A;  2X8U A;  4RLG A;  3QGU A;  1CQ7 A;  1M0N A;  4IW7 A;  5M46 A;  3BC8 A;  2W7J A;  1J04 A;  2BWN A;  1ORD A;  2XH1 A;  3GR9 A;  3BB8 A;  3VP6 A;  4XJP A;  1YNU A;  4B98 A;  3COG A;  2VMQ A;  1MLZ A;  2VMT A;  3E2Z A;  3ECD A;  2HP2 A;  2CY8 A;  1SF2 A;  2HOY A;  2BHX A;  2VLF A;  1ARH A;  1GC2 A;  1N8P A;  4TN4 A;  3A2B A;  4A0F A;  2V0Y A;  1XEY A;  2VGU A;  2G7J A;  4LNM A;  3K40 A;  8AAT A;  1QIS A;  4PFN A;  4RJY A;  1D7U A;  2PB2 A;  2VIA A;  2VMW A;  1PMO A;  2VYC A;  3AEN B;  3DR7 A;  3EZS A;  3G8M A;  9AAT A;  4DGT A;  2YCT A;  2R2N A;  1D2F A;  5KTB A;  4A0G A;  2O1B A;  3D6K A;  1M0P A;  3FFH A;  4KAM A;  4OCA A;  2TPL A;  2DR1 A;  3ZZK A;  2QBT A;  1GEY A;  3PGY A;  3QI6 A;  4P3M A;  2ZY3 A;  3VAX A;  2FNI A;  4HVK A;  5EUE A;  1BKG A;  3H9X A;  4ADB A;  1S06 A;  4PIW A;  4WXF A;  1AKC A;  3GBX A;  4QGR A;  1WKG A;  2CTZ A;  2E7I A;  2WKA A;  4ATP A;  2E7J A;  3DR4 A;  3FTB A;  5DJ1 A;  1YJS A;  1TOI A;  2W7K A;  1TAT A;  1ASL A;  2VGW A;  3E2Y A;  3N75 A;  1EG5 A;  4TMR A;  2AY3 A;  4JE5 A;  4AO4 A;  4WYC A;  1TAR A;  1IAX A;  3AEM C;  3FSL A;  5G4I A;  4EMY A;  5BJ4 A;  2D5Y A;  2X5D A;  3BV0 A;  4XEW A;  4XQ2 A;  4LNL A;  4IYO B;  4BMK A;  1LC5 A;  3QBO A;  1YAA A;  3HVY A;  2W7I A;  2QSR A;  5EUN A;  2ZY4 A;  3WKR A;  4A6R A;  5J8Q A;  1ZOB A;  3P6K A;  5M4B A;  3FZ8 A;  4GSA A;  1PMM A;  2VMR A;  3JW9 A;  2O0R A;  2W7L A;  4BA5 A;  4F5H A;  1ASE A;  1BW0 A;  3PA9 A;  3F9T A;  1JF9 A;  3H7F A;  3AEL A;  3KGW A;  3MAD A;  3BWN C;  4TV7 A;  3WX9 A;  2EO5 A;  4MQR A;  1AIA A;  1WYV B;  5EIG A;  4BHD A;  1LW5 A;  2QLR A;  3RCH B;  4ZM3 A;  2C44 A;  2EH6 A;  3AEJ A;  1AHE A;  4WXG A;  2VMU A;  2BI3 A;  2Z20 A;  4WXB A;  2ZC0 A;  2AY7 A;  3IF2 A;  3F0H A;  4WP0 A;  3NDN A;  5FT6 A;  4ADE A;  3BWO A;  4PVF A;  2AEV A;  4OT8 A;  3EI6 A;  2D61 A;  1BJO A;  1YIY A;  1B4X A;  1D7R A;  1IX8 A;  1RV4 A;  3ATH A;  4OTL A;  1GCK A;  2HOR A;  1GD9 A;  3FRK A;  4R5Z A;  3BS8 A;  2FN6 A;  1E5F A;  1LC8 A;  2QB2 A;  3B46 A;  3CQ4 A;  1P3W A;  3GZD C;  4F5L A;  4A00 A;  4A0H A;  3DU4 A;  1ARS A;  1GEW A;  1C0N A;  2W8J A;  3EIA A;  3HT4 A;  2KFP A;  1ARG A;  1SVV A;  3A9Y A;  4A6T A;  3B1E A;  3HDO A;  3K28 A;  2VIB A;  2CIN A;  1YOO A;  3E2Z B;  4KXK A;  5G2Q A;  3WGC A;  2C7T A;  4OBU A;  5M4D A;  3DZZ A;  1EQB A;  1CZC A;  2D63 A;  2E54 A;  4WBT A;  3MKJ A;  5E5I A;  4RIZ A;  2EPJ A;  3KE3 A;  3WY7 A;  1Y4I A;  1W23 A;  2QB3 A;  5I92 A;  3R9A A;  4F5F A;  3G7Q A;  1DJE A;  1SFF A;  4LW4 A;  1IJI A;  5D5S A;  3BCA A;  1FC4 A;  5F9S A;  5D95 A;  2BWP A;  3PAA A;  2HZP A;  4IXS A;  2WK7 A;  2VMY A;  2Z61 A;  1YIZ A;  1MAQ A;  2CH2 A;  2W7M A;  4CXQ A;  1TOG A;  3A8U X;  1ASD A;  5EAA A;  1AY8 A;  1IBJ A;  2ZJG A;  3H14 A;  3PDB A;  2ORD A;  2CST A;  5E3K A;  1M4N A;  4N0B A;  1M32 A;  1WYU A;  3DXW A;  4J5U A;  2BYJ A;  1VP4 A;  3PPL A;  2AY8 A;  4I8A A;  1AJS A;  1AJR A;  4RKD A;  2AY9 A;  2PO3 A;  3DOD A;  3DYD A;  1AKA A;  4JEZ A;  3A9X A;  3RBF A;  1Z7D A;  3ZRP A;  1O62 A;  1GC0 A;  1AHX A;  1FG7 A;  2DGL A;  2OGE A;  4FFC A;  1ASN A;  4UHN A;  1AHG A;  1LK9 A;  2Z9W A;  4E3Q A;  1W7M A;  3MAF A;  2DKJ A;  4XAU A;  1ASA A;  2BIA A;  4ZAS A;  3TFU A;  1X0M A;  3CQ6 A;  2QMA A;  1B8G A;  2D7Z A;  3CAI A;  3OKS A;  3LVJ A;  3QN6 A;  2YCN A;  3B8X A;  4UOY A;  1ZC9 A;  4J8L A;  5EIG B;  1MGV A;  2EZ1 A;  1ZOD A;  1B5P A;  2A1V A;  4R5F A;  2W7H A;  1TOK A;  1QJ5 A;  3AEO A;  1S09 A;  3NU8 A;  1KKJ A;  2VMP A;  2YOB A;  1VJO A;  1ELQ A;  1BJO B;  1AKB A;  1V72 A;  5FT8 A;  2ZYJ A;  1V2D A;  1KMJ A;  1M0Q A;  3USF A;  4EB5 A;  4F5K A;  3LV2 A;  3UWC A;  3AEM A;  1W7N A;  1O69 A;  3NYT A;  4GE7 A;  3GWP A;  4ZLV A;  3LVL B;  2HUU A;  1C9C A;  2YRR A;  3E77 A;  1QJ3 A;  5DB5 A;  3ASB A;  4BA4 A;  4U2H A;  1ART A;  2OKJ A;  1I48 A;  3I4J A;  4ZWV A;  2WB6 A;  4K2M A;  2NMP A;  1AY5 A;  1G7W A;  4OBV A;  4AO9 A;  2AAT A;  2D64 A;  2VGT A;  3G0T A;  3P1T A;  4W1V A;  3OP7 A;  2X3L A;  3PJ0 A;  4MKK A;  1I43 A;  4IXO A;  3W1I A;  2W8V A;  3Q8N A;  4ADD A;  2DGK A;  3FCR A;  3BCB A;  1M6S A;  2ZSM A;  4EB7 A;  1GC4 A;  2AY1 A;  2CJG A;  2OGA A;  5HDM A;  4FL0 A;  3KGX A;  4Q31 A;  5EFS A;  1BQD A;  4CBR A;  1DJ9 A;  1RVY A;  2HP1 A;  4Y0D A;  3PDB B;  1IUG A;  1LS3 A;  1UU1 A;  5G4J A;  4UQV A;  5DX5 A;  1UU2 A;  3II0 A;  1WYU B;  5E4Z A;  1GEX A;  1JS6 A;  2YKY A;  5HHY A;  4ATQ A;  2OAT A;  2R5C A;  4MGR A;  1AJS B;  3EIB A;  1RVU A;  1DJU A;  2YKV A;  4RJ0 A;  4W5K A;  3FQ7 A;  1X29 A;  3VK4 A;  3I5T A;  2ZUK A;  3NYS A;  3JWA A;  3AV7 A;  2C81 A;  2V1P A;  1C7G A;  3PIU A;  4CBS A;  1GBN A;  2Z1Z A;  4R2N A;  1OXO A;  2VI8 A;  4RKC A;  1O61 A;  2DGM A;  3VK2 A;  1MDZ A;  1Z3Z A;  1T3I A;  2D7Y A;  1G4X A;  1IAY A;  3NUB A;  4IY7 A;  5G0A A;  4E1O A;  4GDY A;  3HBX A;  4Y0H A;  3MEB A;  2Z9U A;  1H1C A;  1ARI A;  3LY1 A;  2VGS A;  3CQ5 A;  3EUC A;  3MAF B;  2CFB A;  3MBB A;  4K2B A;  3N4S A;  1DKA A;  1TOE A;  4Q6R A;  3K7Y A;  4ZDP A;  1MAP A;  4F5I A;  3HLM A;  2X5F A;  1KMK A;  4RIT A;  3NNK A;  4H63 Q;  3PDX A;  3FKD A;  3L44 A;  1C4K A;  4L0O A;  2R5E A;  4ZSY A;  4OC9 A;  3TAT A;  1QIR A;  1TAS A;  4Q75 A;  2ZY5 A;  1X28 A;  2GQN A;  1AMS A;  3EI5 A;  4W1X A;  4F4E A;  5LH9 A;  2HUF A;  3AEP A;  4IXZ A;  1IVR A;  3AOV A;  5DJ9 A;  1DTY A;  1H0C A;  2FNU A;  2VMX A;  1D7V A;  3B1D A;  4GRX A;  2ZY2 A;  3KKI A;  3NU7 A;  1YJY A;  1B9H A;  4ADC A;  3MC6 C;  1V2E A;  4WD2 A;  2BI5 A;  2Z1Y A;  1B9I A;  3FZ7 A;  1JS3 A;  3FVX A;  4MSO A;  1GDE A;  5EAV A;  1AMR A;  2YKU A;  3FD0 A;  1UKJ A;  2W7D A;  2EZ2 A;  2E7U A;  2QA3 A;  2Q7W A;  1I29 A;  1LW4 A;  1O4S A;  3A9Z A;  4M2M A;  3DRD A;  1I41 A;  1TOJ A;  1X2A A;  3BN1 A;  3QPG A;  4OMA A;  3FZ6 A;  2YRI A;  2FM1 A;  3LWS A;  3EI8 A;  1AY4 A;  2W8W A;  2AEU A;  2DOU A;  3ELP A;  2Z9V A;  3GSB A;  3W1H A;  3CBF A;  3JZL A;  4XJO A;  5C6U A;  3HMU A;  4F5M A;  1QIT A;  3ZRQ A;  4MQQ A;  2FKI A;  2GSA A;  2G6W A;  4WYF A;  4WYA A;  2JIS A;  1DGE A;  4EFF A;  2FQ6 A;  4W1W A;  4AZJ A;  1MDO A;  4AOA A;  2BI9 A;  4HF8 A;  2BYL A;  5BJ3 A;  3DC1 A;  1CQ8 A;  2VGV A;  2VMV A;  3GJU A;  3RUY A;  2AY5 A;  2Z9X A;  4ZDL A;  4XK1 A;  2R5C B;  4NOG A;  3WCN A;  4E77 A;  2VLH A;  3TCM A;  1IX7 A;  1U08 A;  4XJM A;  2W7E A;  5FT5 A;  3WGB A;  1BQA A;  3F6T A;  3JU7 A;  2ZP7 A;  2HUI A;  1CZE A;  3PD6 A;  4LNJ A;  4JEW A;  2VMZ A;  1AMA A;  4RAE A;  2ZSL A;  1CL2 A;  3EI7 A;  1OHV A;  2CB1 A;  2BI2 A;  2W8T A;  1CJ0 A;  7AAT A;  4ZAH A;  4A6U A;  3ASA A;  1OHY A;  2VGZ A;  4EU1 A;  1G7X A;  4K05 A;  3AAT A;  2YCP A;  3UAK A;  3WKS A;  5K8B A;  3E9K A;  2GB3 A;  2VMN A;  4GE4 A;  2D66 A;  4ISY A;  1AHF A;  2JJE A;  4M2J A;  5G09 A;  1WST A;  1M7Y A;  1SPA A;  3BWN A;  1LC7 A;  3T32 A;  1WYT A;  4F5G A;  3AOW A;  4DQ6 A;  1ELU A;  4B9B A;  2JJF A;  3VOM A;  4M2K A;  3QM2 A;  4WB0 A;  1OXP A;  1KL1 A;  3HL2 A;  3ACZ A;  3R4T A;  3WCO A;  1BT4 A;  4PFF A;  2F8J A;  2JJG A;  4R8D A;  4RM1 A;  1CQ6 A;  1ASB A;  1YJZ A;  2VMO A;  4KYO A;  3N7N A;  4OYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...