1G7WA

Aspartate aminotransferase active site mutant n194a/r386l
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGLVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Strain is more important than electrostatic interaction in controlling the pKa of the catalytic group in aspartate aminotransferase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 137
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2000-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1g7wA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1g7wA01
3B46A 4JEWA 1X29A 4H51A 1AHGA 3E2ZA 3HL2A 3USFA 3GJUA 5JAYA 3GWPA 4LNLA 5E3KA 4F5LA 3FDBA 1G7WA 3NTJA 4KAMA 3NYUA 4E3RA 2JGTA 3I16A 4ITGA 4A00A 5AX8A 4F5HA 1DJEA 2HZPA 3A8UX 2C7TA 2X5FA 1CZCA 3LVJA 2YHKA 4WYFA 3MBBA 3W1IA 3ISLA 3EIAA 4JEYA 3DYDA 3IHJA 4R2NA 4WLJA 5F8VA 4LW4A 4FL0A 5DX5A 1CQ8A 1BJOB 1B9HA 1SF2A 2W8UA 2W7EA 3FKDA 1E5EA 3PAAA 1N8PA 5EUNA 1O62A 1IJIA 3FFRA 5EIGA 3NDNA 1X2AA 4M2MA 2VMUA 2ZSLA 4OYTA 2W7LA 1B4XA 2VMQA 3N75A 1AY8A 3GETA 8AATA 2Z67A 3BV0A 3I5TA 4UQVA 2EGYA 4JEZA 1MGVA 2QB2A 1AIBA 4Y0DA 3WKSA 3WKRA 1E5FA 2BWOA 2E54A 1LC7A 1PMOA 4A0GA 4BHDA 1BJOA 1GC3A 2AEUA 1AMSA 4TV7A 1ZODA 3VK3A 4WB0B 2OQXA 1AMQA 4HVKA 2JG2A 2W8VA 4A6UA 1SPAA 3QHXA 1TOEA 1TOKA 3AEJC 2O1BA 1ASMA 3HVYA 1M7YA 3PPLA 3A9XA 3QM2A 3TQXA 4AZKA 4WLHA 1TASA 5HXXA 1EJIA 2YKYA 3ASBA 4JEVA 5FT6A 3COGA 5M4BA 3JWBA 3LVKA 4J5UA 4IYOB 2VGVA 3PDBB 2W8WA 3NU7A 3RI6A 4W1XA 1ARTA 4AO9A 1TOGA 2FM1A 2PB0A 4WB0A 4ADDA 1LW5A 2DKBA 2AY4A 4PFNA 4KYOA 1CS1A 2CJHA 3H7FA 2HOXA 4R5FA 3JZLA 1TATA 3B1EA 3EI6A 3ZZKA 5HHYA 1CL2A 1AKBA 2PO3A 2VIBA 3BCAA 1YAAA 1C9CA 1Z3ZA 3RBFA 4GSAA 3FQ8A 4RM1A 4EMYA 1M0NA 4W1VA 4XJMA 4RJYA 2W7IA 3ACZA 3A2BA 1JS3A 1S0AA 4M2JA 2DOUA 1SFFA 1ORDA 2EH6A 2O7CA 1LS3A 4ADCA 4K2IA 2WK7A 3HDOA 3L44A 2BI3A 2D66A 4JEXA 3E9KA 1IBJA 5LH9A 3NYSA 1D7VA 4OMAA 1S08A 2AY5A 3NU8A 3PIUA 1QITA 4O6ZA 2GQNA 2VMPA 4GDYA 1AY5A 3ZRQA 1FG7A 2QBTA 1GC0A 3IF2A 1D7UA 4MKJA 1MAQA 3VK4A 3GSBA 2FNIA 2VGTA 4Q31A 2HOZA 3WGCA 5EUDA 1AKCA 1B5PA 2CSTA 2VMOA 2YRRA 3ELEA 4IXOA 1LC5A 4F5MA 2ZSMA 1GD9A 4XK1A 4XQ2A 3GR9A 1ELUA 2QMAA 4AH3A 3LVMA 4K2BA 3A9ZA 3DODA 4F5GA 2BKWA 4UHNA 4ZASA 3UE8A 1IX7A 3MAFA 3FFHA 4CXRA 2W7MA 1AAWA 1SZKA 1W7LA 4PVFA 1MLYA 2D5YA 4ZLVA 1DFOA 1YJZA 2ZUKA 3FVXA 3ATHA 5M49A 2AY9A 2FYFA 1YOOA 3KE3A 2D61A 3BN1A 1YJYA 2CINA 3I4JA 4XAUA 3QPGA 2Z9WA 3AEPA 3FZ6A 4IXZA 1J32A 4ITXA 4W5KA 4R8DA 4B9BA 1SVVA 1PFFA 1PMMA 1ASAA 3LG0A 2HUFA 1ASGA 4MY5A 4XJPA 4ZSYA 1ARGA 1ASNA 3CAIA 3EI8A 1IUGA 2CH1A 4GE7A 1IAXA 2G6WA 3FQ7A 4JE5A 3HLMA 2WK9A 4RKCA 1TPLA 3B1DA 3F6TA 4LC3A 4GRXA 3LY1A 3JWAA 3W1HA 1OATA 1WYTB 3OP7A 3ZZJA 4LNJA 1IX6A 1IAYA 2WKAA 1JG8A 1G4VA 3KGXA 2V1PA 1GEWA 3AOWA 1BW0A 3MADA 3LV2A 2AY2A 4CVQA 1KL1A 4BQ0A 1KKPA 3VOMA 1ARIA 2JJFA 3BWOA 4A0FA 2HOYA 5EUEA 3R9AA 4WD2A 1AMAA 2D63A 2BWNA 3DC1A 3LWSA 2CH2A 4GE9A 2CANA 1ARHA 2VMZA 3FD0A 2VI9A 4AO4A 1BKGA 2JJGA 1AHEA 1C7OA 2R5EA 3KKIA 2D64A 2PB2A 3ZRPA 3G8MA 2ZP7A 2C44A 1V2FA 1DGDA 1D7SA 2EZ1A 4Q75A 3LVLB 1B5OA 3D6KA 4ZM4A 1AAMA 2O0RA 3P1TA 4ZAHA 2Z20A 3TFUA 1AY4A 2DGLA 2VMTA 3E6GA 3BC8A 3WCOA 1S07A 2W7HA 3G0TA 2HP2A 2YKVA 4W8IA 1PG8A 5BJ4A 4A6TA 3FZ8A 1XI9A 4F4EA 2BI5A 2F8JA 1EG5A 2ORDA 4CBSA 2R5CB 1M0OA 2BI2A 5FT5A 2W7GA 4WYAA 5G0AA 1TOIA 2GSAA 2AATA 1AJRA 1Y4IA 3P6KA 4LW2A 1KL2A 4JE5D 4OBVA 2R0TA 2DR1A 4ZWMA 1ASBA 3BWNC 1VJOA 3DRDA 3DXWA 2VMWA 4MKKA 5DB5A 3FVUA 3RCHB 1GDEA 1AHXA 2OKKA 2WK8A 2AY8A 1ASFA 3AEJA 1RV3A 3E77A 3II0A 3N5MA 4N0BA 2VMSA 3AENB 5G2PA 1ZOBA 2W7KA 1CL1A 1UU0A 3MKJA 4OC9A 3FTBA 3PDXA 3EUCA 1GC4A 1BJWA 4IYOA 2VYCA 1B9IA 3PDBA 4W91A 1AIAA 2W7DA 2FQ6A 3PA9A 4JF0A 3BWNA 4UHOA 4WYDA 1U08A 4DBCA 4MGRA 5G2QA 1AJSB 3WZFA 1O4SA 3JW9A 2ZY4A 4ADEA 1M6SA 3JTXA 4WXFA 5FT4A 2X3LA 4ZSWA 3AEMC 1QGNA 1KMKA 1BS0A 1BQAA 4P3MA 1FC4A 3B8XA 1SZSA 4WBTA 3HMUA 1WYUB 3KGWA 4GE4A 2DKJA 4K2MA 1AHFA 4M2KA 1GC2A 2VLFA 1D2FA 1JF9A 4BMKA 1MDOA 3MAUA 1M4NA 1GBNA 3E2YA 3FSLA 2X8UA 3NUBA 2ZYJA 4BA4A 2JJHA 1DTYA 1CJ0A 3WGBA 4UOYA 1OHYA 4Q6RA 1C7NA 3ASAA 1CZEA 3F9TA 3RBLA 1YJSA 3R4TA 4MSOA 4N0WA 2VMVA 3MC6C 4U1TA 1O69A 1WYVB 3H14A 4A0HA 1DKAA 1RV4A 3VAXA 4IW7A 3NYTA 1MDZA 3DR4A 4ZDPA 2YRIA 4W1WA 2BWPA 3GZDC 3FDDA 2W7JA 4IX8A 2VLHA 4KXKA 4RAEA 2HUIA 3K7YA 4F5JA 2AY6A 3PD6B 1AHYA 1MAPA 3UWCA 1VEFA 1W7NA 3DU4A 2BIGA 2ZY2A 3E2ZB 1MDXA 5DJ9A 2YKXA 2EO5A 1C7GA 2YCPA 3DR7A 3G7QA 1T3IA 2ZY3A 1QJ5A 3EZ1A 3EZSA 5TF5A 3K40A 4AOAA 1GEXA 1WKHA 3HT4A 4XJOA 3BCBA 2VMXA 4MQPA 1AX4A 1ZC9A 2D65A 2QA3A 1YIYA 2VGSA 1RVYA 2W7FA 4EB7A 4HF8A 1X0MA 4OBUA 4CBRA 2OGEA 4OTLA 4WYGA 5I92A 4ZWVA 3BB8A 3E2FA 3TFTA 1ASCA 1G7XA 1WKGA 1ELQA 2HORA 2VGUA 5EIGB 4B98A 1C4KA 1M0PA 2AY7A 1AMRA 4IXSA 2GB3A 1WSTA 2HUUA 2XBNA 3QBOA 2W8JA 4ATPA 4F5IA 4J8LA 5M4DA 1KMJA 3QI6A 1OXPA 2BIAA 4MQQA 4WXBA 1YIZA 5EAVA 2E7JA 3DZZA 1WYTA 1GEYA 3PJ0A 1JS6A 1Z7DA 4L0OA 3TATA 2YCTA 3BCXA 4UHMA 3CQ5A 2NMPA 3EI9A 2OKJA 2FN6A 4RKDA 2QLRA 3MEBA 5EAAA 1TARA 3N0LA 4DGTA 1EQBA 4RITA 1UKJA 3NX3A 4RLGA 3WCNA 2DGKA 2OATA 4A0RA 1M0QA 1ASEA 4OT8A 3VK2A 1QJ3A 1GCKA 4EFFA 4RJ0A 1I48A 5HDMA 1J04A 1ECXA 4TN4A 2BIEA 2BI9A 4RIZA 2RFVA 1BQDA 5F9SA 4CXQA 2YCNA 2CTZA 2Z61A 2X5DA 1IX8A 1CQ6A 2YKUA 4PIWA 2CJGA 3L8AA 5G4JA 4P7YA 3W1JA 1DJUA 4QGRA 4WYCA 3EI7A 3NUIA 1B8GA 1I43A 3FZ7A 4ISYA 3RQ1A 1LC8A 1VP4A 3F0HA 2W8TA 2EZ2A 2FNUA 4U2HA 1BT4A 4A72A 5M46A 5D95A 1OHVA 4EU1A 1SZUA 1V72A 4E1OA 1V2EA 3M5UA 4Y0IA 3AEOA 1LKCA 2E7UA 4WYEA 2GMSA 2VMYA 4ZM3A 7AATA 4Q76A 2XH1A 2AY3A 5E5IA 2JISA 2Z1ZA 3JU7A 5IWQA 1I41A 3ECDA 3CBFA 3NNKA 1AICA 1AKAA 1KKJA 3TCMA 1UU2A 3FVSA 4I8AA 2R5CA 4R5ZA 1QZ9A 5EFSA 5BJ3A 1XEYA 2Z1YA 3CQ6A 1W23A 3EI5A 3K28A 4A6RA 3NRAA 1ASDA 2V0YA 5D5SA 2BI1A 3AATA 9AATA 3GBXA 3RCHA 4ADBA 1P3WA 4BA5A 1BJ4A 1MLZA 1W3UA 3RUYA 2BYLA 1LW4A 1N2TA 1YNUA 2Z9VA 3AENA 1DJ9A 2C0RA 2VMRA 4GEBA 1O61A 1H1CA 2C81A 1OHWA 2VGWA 1IVRA 1RVUA 3AELA 3FCRA 3PGYA 3AOVA 4XJLA 4F5FA 1DGEA 2TPLA 3B1CA 5C6UA 4E3QA 3AV7A 4OCAA 3OKSA 1AJSA 2Z9UA 2BYJA 3AEMA 1UU1A 2AEVA 3HBXA 3FQAA 4XEWA 4FFCA 1N31A 2QB3A 1I29A 2DGMA 2D7ZA 2OGAA 3EIBA 3UAKA 1D7RA 2ZY5A 2CY8A 4EB5A 1LK9A 1OXOA 1WYUA 2VGZA 5LHAA 1V2DA 3MAFB 1X28A 3VP6A 2ZC0A 5EQCA 2CB1A 2JJEA 4IY7A 1ASLA 4Y0HA 3QGUA 2CFBA 2Z9XA 2BHXA 1QIRA 2VIAA 5G4IA 5J8QA 3A9YA 2YOBA 4PFFA 2EPJA 2AY1A 3QN6A 3WLXA 4F5KA 1G4XA 1FG3A 2VI8A 3BS8A 3Q8NA 1M32A 4MQRA 2D7YA 3ELPA 1H0CA 4TMRA 1W7MA 4ATQA 2ZJGA 5FT8A 4WXGA 4AZJA 1ARSA 2GMUA 2VMNA 3MC6A 1QISA 1CQ7A 3GZCA 1WYVA 3DXVA 2E7IA 2Q7WA 3CQ4A 5DJ1A 3T32A 3ZRRA 4NOGA 4ZDOA 4E77A 2HP1A 3HQTA 3GZDA 4JF1A 1TOJA 3WY7A 4ZDLA 3WX9A 4DQ6A 1S06A 5K8BA 1C0NA 3FRKA 1S09A 5E4ZA 5G09A 4LNMA 4WP0A 2R2NA 1BJNA 3PD6A 2CJDA
chains in the Genus database with same CATH superfamily
3B46A 4JEWA 1X29A 4H51A 1AHGA 3E2ZA 3HL2A 3USFA 3GJUA 5JAYA 3GWPA 4LNLA 5E3KA 4F5LA 3FDBA 1G7WA 3NTJA 4KAMA 3NYUA 4E3RA 2JGTA 3I16A 4ITGA 4A00A 5AX8A 4F5HA 1DJEA 2HZPA 3A8UX 2C7TA 2X5FA 1CZCA 3LVJA 2YHKA 4WYFA 3MBBA 3W1IA 3ISLA 3EIAA 4JEYA 3DYDA 3IHJA 4R2NA 4WLJA 5F8VA 4LW4A 4FL0A 5DX5A 1CQ8A 1BJOB 1B9HA 1SF2A 2W8UA 2W7EA 3FKDA 1E5EA 3PAAA 1N8PA 5EUNA 1O62A 1IJIA 3FFRA 5EIGA 5KTBA 3NDNA 1X2AA 4M2MA 2VMUA 2ZSLA 4OYTA 2W7LA 1B4XA 2VMQA 3N75A 1AY8A 3GETA 3N4RA 8AATA 2Z67A 3BV0A 3I5TA 4UQVA 2EGYA 4JEZA 1MGVA 2QB2A 1AIBA 4Y0DA 3WKSA 3WKRA 1E5FA 2BWOA 2E54A 1LC7A 1PMOA 4A0GA 4BHDA 1BJOA 1GC3A 2AEUA 1AMSA 4TV7A 1ZODA 2WB6A 3VK3A 4WB0B 2OQXA 1AMQA 4HVKA 2JG2A 2W8VA 4A6UA 1SPAA 3QHXA 1TOEA 1TOKA 3AEJC 2O1BA 1ASMA 3HVYA 1M7YA 3PPLA 3A9XA 3QM2A 3TQXA 4AZKA 4WLHA 1TASA 5HXXA 1EJIA 2YKYA 3ASBA 4JEVA 5FT6A 3COGA 5M4BA 3JWBA 3LVKA 4J5UA 4IYOB 2VGVA 3PDBB 2W8WA 3NU7A 3RI6A 4K05A 4W1XA 1ARTA 4AO9A 1TOGA 2FM1A 2PB0A 4WB0A 4ADDA 1LW5A 3N4XA 2DKBA 3H9XA 2AY4A 4PFNA 4KYOA 1CS1A 2CJHA 3H7FA 2HOXA 4R5FA 3JZLA 1TATA 3B1EA 3EI6A 3ZZKA 5HHYA 1CL2A 1AKBA 2PO3A 2VIBA 3BCAA 1YAAA 1C9CA 1Z3ZA 3RBFA 4GSAA 3FQ8A 4RM1A 4EMYA 1M0NA 4W1VA 4XJMA 4RJYA 2W7IA 3ACZA 3A2BA 1JS3A 1S0AA 4M2JA 2DOUA 1SFFA 1ORDA 2EH6A 2O7CA 1LS3A 4ADCA 4K2IA 2WK7A 3HDOA 3L44A 2BI3A 2D66A 4JEXA 3E9KA 1IBJA 5LH9A 3NYSA 1D7VA 4OMAA 1S08A 2AY5A 3NU8A 3PIUA 1QITA 4O6ZA 2GQNA 2VMPA 4GDYA 1AY5A 3ZRQA 1FG7A 2QBTA 1GC0A 3IF2A 1D7UA 4MKJA 1MAQA 3VK4A 3GSBA 2FNIA 2VGTA 4Q31A 2HOZA 3WGCA 5EUDA 1AKCA 1B5PA 2CSTA 2VMOA 2YRRA 3ELEA 4IXOA 1LC5A 1KAFA 4F5MA 2ZSMA 1GD9A 4XK1A 4XQ2A 3GR9A 1ELUA 2QMAA 4AH3A 3LVMA 4K2BA 3A9ZA 3DODA 4F5GA 2BKWA 4UHNA 4ZASA 3UE8A 1IX7A 3MAFA 3FFHA 4CXRA 2W7MA 1AAWA 1SZKA 1W7LA 4PVFA 1MLYA 2D5YA 4ZLVA 1DFOA 1YJZA 2ZUKA 3FVXA 3ATHA 5M49A 2AY9A 2FYFA 1YOOA 3KE3A 2D61A 3BN1A 1YJYA 2CINA 3I4JA 4XAUA 3QPGA 2Z9WA 3AEPA 3FZ6A 4IXZA 1J32A 4ITXA 4W5KA 4R8DA 4B9BA 1SVVA 1PFFA 1PMMA 1ASAA 3LG0A 2HUFA 1ASGA 4MY5A 4XJPA 4ZSYA 1ARGA 1ASNA 3CAIA 3EI8A 1IUGA 2CH1A 4GE7A 1IAXA 2G6WA 3FQ7A 4JE5A 3HLMA 3N7NA 2WK9A 4RKCA 1TPLA 3B1DA 3F6TA 4LC3A 4GRXA 3LY1A 3JWAA 3W1HA 1OATA 1WYTB 3OP7A 3ZZJA 4LNJA 1IX6A 1IAYA 2WKAA 1JG8A 1G4VA 3KGXA 2V1PA 1GEWA 3AOWA 1BW0A 3MADA 3LV2A 2AY2A 4CVQA 1KL1A 4BQ0A 1KKPA 3VOMA 1ARIA 2JJFA 3BWOA 4A0FA 2HOYA 5EUEA 3R9AA 4WD2A 1AMAA 2D63A 2BWNA 3DC1A 3LWSA 2CH2A 4GE9A 2CANA 1ARHA 2VMZA 3FD0A 2VI9A 4AO4A 1BKGA 2JJGA 1AHEA 1C7OA 2R5EA 3KKIA 2D64A 2PB2A 3ZRPA 3G8MA 2QSRA 2ZP7A 2C44A 1V2FA 1DGDA 1D7SA 2EZ1A 4Q75A 3LVLB 1B5OA 3D6KA 4ZM4A 1AAMA 2O0RA 3P1TA 4ZAHA 2Z20A 3TFUA 1AY4A 2DGLA 2VMTA 3E6GA 3BC8A 3WCOA 1S07A 2W7HA 3G0TA 2HP2A 2YKVA 4W8IA 1PG8A 5BJ4A 4A6TA 3FZ8A 1XI9A 4F4EA 2BI5A 2F8JA 1EG5A 2ORDA 4CBSA 2R5CB 1M0OA 2BI2A 5FT5A 2W7GA 4WYAA 5G0AA 1TOIA 2GSAA 2AATA 1AJRA 1Y4IA 3P6KA 4LW2A 1KL2A 4JE5D 4OBVA 2EYQA 2R0TA 2DR1A 4ZWMA 1ASBA 3BWNC 1VJOA 3DRDA 3DXWA 2VMWA 4MKKA 5DB5A 3FVUA 3RCHB 1GDEA 1AHXA 2OKKA 2WK8A 2AY8A 1ASFA 3AEJA 1RV3A 3E77A 3II0A 3N5MA 4N0BA 2VMSA 3AENB 5G2PA 1ZOBA 2W7KA 1CL1A 1UU0A 3MKJA 4OC9A 3FTBA 3PDXA 3EUCA 1GC4A 1BJWA 4IYOA 2VYCA 1B9IA 3PDBA 4W91A 1AIAA 2W7DA 2FQ6A 3PA9A 4JF0A 3BWNA 4UHOA 4WYDA 1U08A 4DBCA 4MGRA 5G2QA 1AJSB 3WZFA 1O4SA 3JW9A 2ZY4A 4ADEA 1M6SA 3JTXA 4WXFA 5FT4A 2X3LA 4ZSWA 3AEMC 1QGNA 1KMKA 1BS0A 1BQAA 4P3MA 1FC4A 3B8XA 1SZSA 4WBTA 3HMUA 1WYUB 3KGWA 4GE4A 2DKJA 4K2MA 1AHFA 4M2KA 1GC2A 2VLFA 1D2FA 1JF9A 4BMKA 1MDOA 3MAUA 1M4NA 1GBNA 3E2YA 3FSLA 2X8UA 3NUBA 2ZYJA 4BA4A 2JJHA 1DTYA 1CJ0A 3WGBA 4UOYA 1OHYA 4Q6RA 1C7NA 3ASAA 1CZEA 3F9TA 3RBLA 1YJSA 3R4TA 4MSOA 4N0WA 2VMVA 3MC6C 4U1TA 1O69A 1WYVB 3H14A 4A0HA 1DKAA 1RV4A 3VAXA 4IW7A 3NYTA 1MDZA 3DR4A 4ZDPA 2YRIA 4W1WA 2BWPA 3GZDC 3FDDA 2W7JA 4IX8A 2VLHA 4KXKA 4RAEA 2HUIA 3N4SA 3K7YA 4F5JA 2AY6A 3PD6B 1AHYA 1MAPA 3UWCA 1VEFA 1W7NA 3DU4A 2BIGA 2ZY2A 3E2ZB 1MDXA 5DJ9A 2YKXA 2EO5A 1C7GA 2YCPA 3DR7A 3G7QA 1T3IA 2ZY3A 1QJ5A 3EZ1A 3EZSA 5TF5A 2KFPA 3K40A 4AOAA 1GEXA 1WKHA 3HT4A 4XJOA 3BCBA 2VMXA 4MQPA 1AX4A 1ZC9A 2D65A 2QA3A 1YIYA 2VGSA 1RVYA 2W7FA 4EB7A 4HF8A 1X0MA 4OBUA 4CBRA 2OGEA 4OTLA 4WYGA 5I92A 4ZWVA 3BB8A 3E2FA 3TFTA 1ASCA 1G7XA 1WKGA 1ELQA 2HORA 2VGUA 5EIGB 4B98A 1C4KA 1M0PA 2AY7A 1AMRA 4IXSA 2GB3A 1WSTA 2HUUA 2XBNA 3QBOA 2W8JA 4ATPA 4F5IA 4J8LA 5M4DA 1KMJA 3QI6A 1OXPA 2BIAA 4MQQA 4WXBA 1YIZA 5EAVA 2E7JA 3DZZA 1WYTA 1GEYA 3PJ0A 1JS6A 1Z7DA 4L0OA 3TATA 2YCTA 3BCXA 4UHMA 3CQ5A 2NMPA 3EI9A 2OKJA 2FN6A 4RKDA 2QLRA 3MEBA 5EAAA 1TARA 3N0LA 4DGTA 1EQBA 4RITA 1UKJA 3NX3A 4RLGA 3WCNA 2DGKA 2OATA 4A0RA 1M0QA 1ASEA 4OT8A 3VK2A 1QJ3A 1GCKA 4EFFA 4RJ0A 1I48A 5HDMA 1J04A 1ECXA 4TN4A 2G7JA 2BIEA 2BI9A 4RIZA 2RFVA 1BQDA 5F9SA 4CXQA 2YCNA 2CTZA 2Z61A 2X5DA 1IX8A 1CQ6A 2YKUA 4PIWA 2CJGA 3L8AA 5G4JA 4P7YA 3W1JA 1DJUA 4QGRA 4WYCA 3EI7A 3NUIA 1B8GA 1I43A 3FZ7A 4ISYA 3RQ1A 1LC8A 1VP4A 3F0HA 2W8TA 2EZ2A 2FKIA 2FNUA 4U2HA 1BT4A 4A72A 5M46A 5D95A 1OHVA 4EU1A 1SZUA 1V72A 4E1OA 1V2EA 3M5UA 4Y0IA 3AEOA 1LKCA 2E7UA 4WYEA 2GMSA 2VMYA 4ZM3A 7AATA 4Q76A 2XH1A 2AY3A 5E5IA 2JISA 2Z1ZA 3JU7A 5IWQA 1I41A 3ECDA 3CBFA 3NNKA 1AICA 1AKAA 1KKJA 3TCMA 1UU2A 3FVSA 4I8AA 2R5CA 4R5ZA 1QZ9A 5EFSA 5BJ3A 1XEYA 2Z1YA 3CQ6A 1W23A 3EI5A 3K28A 4A6RA 3NRAA 1ASDA 2V0YA 5D5SA 2BI1A 3AATA 9AATA 3GBXA 3RCHA 4ADBA 1P3WA 4BA5A 1BJ4A 1MLZA 1W3UA 3RUYA 2BYLA 1LW4A 1N2TA 1YNUA 2Z9VA 3AENA 1DJ9A 2C0RA 2VMRA 4GEBA 1O61A 1H1CA 2C81A 1OHWA 2VGWA 1IVRA 1RVUA 3AELA 3FCRA 2A1VA 3PGYA 3AOVA 4XJLA 4F5FA 1DGEA 2TPLA 3B1CA 5C6UA 4E3QA 3AV7A 4OCAA 3OKSA 1AJSA 2Z9UA 2BYJA 3AEMA 1UU1A 2AEVA 3HBXA 3FQAA 4XEWA 4FFCA 1N31A 2QB3A 1I29A 2DGMA 2D7ZA 2OGAA 3EIBA 3UAKA 1D7RA 2ZY5A 2CY8A 4EB5A 1LK9A 1OXOA 1WYUA 2VGZA 5LHAA 1V2DA 3MAFB 1X28A 3VP6A 2ZC0A 5EQCA 2CB1A 2JJEA 4IY7A 1ASLA 4Y0HA 3QGUA 2CFBA 2Z9XA 2BHXA 1QIRA 2VIAA 5G4IA 5J8QA 3A9YA 2YOBA 4PFFA 2EPJA 2AY1A 3QN6A 3WLXA 4F5KA 1G4XA 1FG3A 2VI8A 3BS8A 3Q8NA 1M32A 4MQRA 2D7YA 3ELPA 1H0CA 4TMRA 1W7MA 4ATQA 2ZJGA 5FT8A 4WXGA 4AZJA 1ARSA 2GMUA 2VMNA 3MC6A 1QISA 1CQ7A 3GZCA 1WYVA 3DXVA 2E7IA 2Q7WA 3CQ4A 5DJ1A 3T32A 3ZRRA 4NOGA 4ZDOA 4E77A 4H63Q 2HP1A 3HQTA 3GZDA 4JF1A 1TOJA 3WY7A 4ZDLA 3WX9A 4DQ6A 1S06A 5K8BA 1C0NA 3FRKA 1S09A 5E4ZA 5G09A 4LNMA 4WP0A 2R2NA 1BJNA 3PD6A 2CJDA
chains in the Genus database with same CATH topology
3B46A 4JEWA 1X29A 4H51A 1AHGA 3E2ZA 3HL2A 3USFA 3GJUA 5JAYA 3GWPA 4LNLA 5E3KA 4F5LA 3FDBA 1G7WA 3NTJA 4KAMA 3NYUA 4E3RA 2JGTA 3I16A 4ITGA 4A00A 5AX8A 4F5HA 1DJEA 2HZPA 3A8UX 2C7TA 2X5FA 1CZCA 3LVJA 2YHKA 4WYFA 3MBBA 3W1IA 3ISLA 3EIAA 4JEYA 3DYDA 3IHJA 4R2NA 4WLJA 5F8VA 4LW4A 4FL0A 5DX5A 1CQ8A 1BJOB 1B9HA 1SF2A 2W8UA 2W7EA 3FKDA 1E5EA 3PAAA 1N8PA 5EUNA 1O62A 1IJIA 3FFRA 5EIGA 5KTBA 3NDNA 1X2AA 4M2MA 2VMUA 2ZSLA 4OYTA 2W7LA 1B4XA 2VMQA 3N75A 1AY8A 3GETA 3N4RA 8AATA 2Z67A 3BV0A 3I5TA 4UQVA 2EGYA 4JEZA 1MGVA 2QB2A 1AIBA 4Y0DA 3WKSA 3WKRA 1E5FA 2BWOA 2E54A 1LC7A 1PMOA 4A0GA 4BHDA 1BJOA 1GC3A 2AEUA 1AMSA 4TV7A 1ZODA 2WB6A 3VK3A 4WB0B 2OQXA 1AMQA 4HVKA 2JG2A 2W8VA 4A6UA 1SPAA 3QHXA 1TOEA 1TOKA 3AEJC 2O1BA 1ASMA 3HVYA 1M7YA 3PPLA 3A9XA 3QM2A 3TQXA 4AZKA 4WLHA 1TASA 5HXXA 1EJIA 2YKYA 3ASBA 4JEVA 5FT6A 3COGA 5M4BA 3JWBA 3LVKA 4J5UA 4IYOB 2VGVA 3PDBB 2W8WA 3NU7A 3RI6A 4K05A 4W1XA 1ARTA 4AO9A 1TOGA 2FM1A 2PB0A 4WB0A 4ADDA 1LW5A 3N4XA 2DKBA 3H9XA 2AY4A 4PFNA 4KYOA 1CS1A 2CJHA 3H7FA 2HOXA 4R5FA 3JZLA 1TATA 3B1EA 3EI6A 3ZZKA 5HHYA 1CL2A 1AKBA 2PO3A 2VIBA 3BCAA 1YAAA 1C9CA 1Z3ZA 3RBFA 4GSAA 3FQ8A 4RM1A 4EMYA 1M0NA 4W1VA 4XJMA 4RJYA 2W7IA 3ACZA 3A2BA 1JS3A 1S0AA 4M2JA 2DOUA 1SFFA 1ORDA 2EH6A 2O7CA 1LS3A 4ADCA 4K2IA 2WK7A 3HDOA 3L44A 2BI3A 2D66A 4JEXA 3E9KA 1IBJA 5LH9A 3NYSA 1D7VA 4OMAA 1S08A 2AY5A 3NU8A 3PIUA 1QITA 4O6ZA 2GQNA 2VMPA 4GDYA 1AY5A 3ZRQA 1FG7A 2QBTA 1GC0A 3IF2A 1D7UA 4MKJA 1MAQA 3VK4A 3GSBA 2FNIA 2VGTA 4Q31A 2HOZA 3WGCA 5EUDA 1AKCA 1B5PA 2CSTA 2VMOA 2YRRA 3ELEA 4IXOA 1LC5A 4F5MA 2ZSMA 1GD9A 4XK1A 4XQ2A 3GR9A 1ELUA 2QMAA 4AH3A 3LVMA 4K2BA 3A9ZA 3DODA 4F5GA 2BKWA 4UHNA 4ZASA 3UE8A 1IX7A 3MAFA 3FFHA 4CXRA 2W7MA 1AAWA 1SZKA 1W7LA 4PVFA 1MLYA 2D5YA 4ZLVA 1DFOA 1YJZA 2ZUKA 3FVXA 3ATHA 5M49A 2AY9A 2FYFA 1YOOA 3KE3A 2D61A 3BN1A 1YJYA 2CINA 3I4JA 4XAUA 3QPGA 2Z9WA 3AEPA 3FZ6A 4IXZA 1J32A 4ITXA 4W5KA 4R8DA 4B9BA 1SVVA 1PFFA 1PMMA 1ASAA 3LG0A 2HUFA 1ASGA 4MY5A 4XJPA 4ZSYA 1ARGA 1ASNA 3CAIA 3EI8A 1IUGA 2CH1A 4GE7A 1IAXA 2G6WA 3FQ7A 4JE5A 3HLMA 3N7NA 2WK9A 4RKCA 1TPLA 3B1DA 3F6TA 4LC3A 4GRXA 3LY1A 3JWAA 3W1HA 1OATA 1WYTB 3OP7A 3ZZJA 4LNJA 1IX6A 1IAYA 2WKAA 1JG8A 1G4VA 3KGXA 2V1PA 1GEWA 3AOWA 1BW0A 3MADA 3LV2A 2AY2A 4CVQA 1KL1A 4BQ0A 1KKPA 3VOMA 1ARIA 2JJFA 3BWOA 4A0FA 2HOYA 5EUEA 3R9AA 4WD2A 1AMAA 2D63A 2BWNA 3DC1A 3LWSA 2CH2A 4GE9A 2CANA 1ARHA 2VMZA 3FD0A 2VI9A 4AO4A 1BKGA 2JJGA 1AHEA 1C7OA 2R5EA 3KKIA 2D64A 2PB2A 3ZRPA 3G8MA 2QSRA 2ZP7A 2C44A 1V2FA 1DGDA 1D7SA 2EZ1A 4Q75A 3LVLB 1B5OA 3D6KA 4ZM4A 1AAMA 2O0RA 3P1TA 4ZAHA 2Z20A 3TFUA 1AY4A 2DGLA 2VMTA 3E6GA 3BC8A 3WCOA 1S07A 2W7HA 3G0TA 2HP2A 2YKVA 4W8IA 1PG8A 5BJ4A 4A6TA 3FZ8A 1XI9A 4F4EA 2BI5A 2F8JA 1EG5A 2ORDA 4CBSA 2R5CB 1M0OA 2BI2A 5FT5A 2W7GA 4WYAA 5G0AA 1TOIA 2GSAA 2AATA 1AJRA 1Y4IA 3P6KA 4LW2A 1KL2A 4JE5D 4OBVA 2EYQA 2R0TA 2DR1A 4ZWMA 1ASBA 3BWNC 1VJOA 3DRDA 3DXWA 2VMWA 4MKKA 5DB5A 3FVUA 3RCHB 1GDEA 1AHXA 2OKKA 2WK8A 2AY8A 1ASFA 3AEJA 1RV3A 3E77A 3II0A 3N5MA 4N0BA 2VMSA 3AENB 5G2PA 1ZOBA 2W7KA 1CL1A 1UU0A 3MKJA 4OC9A 3FTBA 3PDXA 3EUCA 1GC4A 1BJWA 4IYOA 2VYCA 1B9IA 3PDBA 4W91A 1AIAA 2W7DA 2FQ6A 3PA9A 4JF0A 3BWNA 4UHOA 4WYDA 1U08A 4DBCA 4MGRA 5G2QA 1AJSB 3WZFA 1O4SA 3JW9A 2ZY4A 4ADEA 1M6SA 3JTXA 4WXFA 5FT4A 2X3LA 4ZSWA 3AEMC 1QGNA 1KMKA 1BS0A 1BQAA 4P3MA 1FC4A 3B8XA 1SZSA 4WBTA 3HMUA 1WYUB 3KGWA 4GE4A 2DKJA 4K2MA 1AHFA 4M2KA 1GC2A 2VLFA 1D2FA 1JF9A 4BMKA 1MDOA 3MAUA 1M4NA 1GBNA 3E2YA 3FSLA 2X8UA 3NUBA 2ZYJA 4BA4A 2JJHA 1DTYA 1CJ0A 3WGBA 4UOYA 1OHYA 4Q6RA 1C7NA 3ASAA 1CZEA 3F9TA 3RBLA 1YJSA 3R4TA 4MSOA 4N0WA 2VMVA 3MC6C 4U1TA 1O69A 1WYVB 3H14A 4A0HA 1DKAA 1RV4A 3VAXA 4IW7A 3NYTA 1MDZA 3DR4A 4ZDPA 2YRIA 4W1WA 2BWPA 3GZDC 3FDDA 2W7JA 4IX8A 2VLHA 4KXKA 4RAEA 2HUIA 3N4SA 3K7YA 4F5JA 2AY6A 3PD6B 1AHYA 1MAPA 3UWCA 1VEFA 1W7NA 3DU4A 2BIGA 2ZY2A 3E2ZB 1MDXA 5DJ9A 2YKXA 2EO5A 1C7GA 2YCPA 3DR7A 3G7QA 1T3IA 2ZY3A 1QJ5A 3EZ1A 3EZSA 5TF5A 2KFPA 3K40A 4AOAA 1GEXA 1WKHA 3HT4A 4XJOA 3BCBA 2VMXA 4MQPA 1AX4A 1ZC9A 2D65A 2QA3A 1YIYA 2VGSA 1RVYA 2W7FA 4EB7A 4HF8A 1X0MA 4OBUA 4CBRA 2OGEA 4OTLA 4WYGA 5I92A 4ZWVA 3BB8A 3E2FA 3TFTA 1ASCA 1G7XA 1WKGA 1ELQA 2HORA 2VGUA 5EIGB 4B98A 1C4KA 1M0PA 2AY7A 1AMRA 4IXSA 2GB3A 1WSTA 2HUUA 2XBNA 3QBOA 2W8JA 4ATPA 4F5IA 4J8LA 5M4DA 1KMJA 3QI6A 1OXPA 2BIAA 4MQQA 4WXBA 1YIZA 5EAVA 2E7JA 3DZZA 1WYTA 1GEYA 3PJ0A 1JS6A 1Z7DA 4L0OA 3TATA 2YCTA 3BCXA 4UHMA 3CQ5A 2NMPA 3EI9A 2OKJA 2FN6A 4RKDA 2QLRA 3MEBA 5EAAA 1TARA 3N0LA 4DGTA 1EQBA 4RITA 1UKJA 3NX3A 4RLGA 3WCNA 2DGKA 2OATA 4A0RA 1M0QA 1ASEA 4OT8A 3VK2A 1QJ3A 1GCKA 4EFFA 4RJ0A 1I48A 5HDMA 1J04A 1ECXA 4TN4A 2G7JA 2BIEA 2BI9A 4RIZA 2RFVA 1BQDA 5F9SA 4CXQA 2YCNA 2CTZA 2Z61A 2X5DA 1IX8A 1CQ6A 2YKUA 4PIWA 2CJGA 3L8AA 5G4JA 4P7YA 3W1JA 1DJUA 4QGRA 4WYCA 3EI7A 3NUIA 1B8GA 1I43A 3FZ7A 4ISYA 3RQ1A 1LC8A 1VP4A 3F0HA 2W8TA 2EZ2A 2FKIA 2FNUA 4U2HA 1BT4A 4A72A 5M46A 5D95A 1OHVA 4EU1A 1SZUA 1V72A 4E1OA 1V2EA 3M5UA 4Y0IA 3AEOA 1LKCA 2E7UA 4WYEA 2GMSA 2VMYA 4ZM3A 7AATA 4Q76A 2XH1A 2AY3A 5E5IA 2JISA 2Z1ZA 3JU7A 5IWQA 1I41A 3ECDA 3CBFA 3NNKA 1AICA 1AKAA 1KKJA 3TCMA 1UU2A 3FVSA 4I8AA 2R5CA 4R5ZA 1QZ9A 5EFSA 5BJ3A 1XEYA 2Z1YA 3CQ6A 1W23A 3EI5A 3K28A 4A6RA 3NRAA 1ASDA 2V0YA 5D5SA 2BI1A 3AATA 9AATA 3GBXA 3RCHA 4ADBA 1P3WA 4BA5A 1BJ4A 1MLZA 1W3UA 3RUYA 2BYLA 1LW4A 1N2TA 1YNUA 2Z9VA 3AENA 1DJ9A 2C0RA 2VMRA 4GEBA 1O61A 1H1CA 2C81A 1OHWA 2VGWA 1IVRA 1RVUA 3AELA 3FCRA 2A1VA 3PGYA 3AOVA 4XJLA 4F5FA 1DGEA 2TPLA 3B1CA 5C6UA 4E3QA 3AV7A 4OCAA 3OKSA 1AJSA 2Z9UA 2BYJA 3AEMA 1UU1A 2AEVA 3HBXA 3FQAA 4XEWA 4FFCA 1N31A 2QB3A 1I29A 2DGMA 2D7ZA 2OGAA 3EIBA 3UAKA 1D7RA 2ZY5A 2CY8A 4EB5A 1LK9A 1OXOA 1WYUA 2VGZA 5LHAA 1V2DA 3MAFB 1X28A 3VP6A 2ZC0A 5EQCA 2CB1A 2JJEA 4IY7A 1ASLA 4Y0HA 3QGUA 2CFBA 2Z9XA 2BHXA 1QIRA 2VIAA 5G4IA 5J8QA 3A9YA 2YOBA 4PFFA 2EPJA 2AY1A 3QN6A 3WLXA 4F5KA 1G4XA 1FG3A 2VI8A 3BS8A 3Q8NA 1M32A 4MQRA 2D7YA 3ELPA 1H0CA 4TMRA 1W7MA 4ATQA 2ZJGA 5FT8A 4WXGA 4AZJA 1ARSA 2GMUA 2VMNA 3MC6A 1QISA 1CQ7A 3GZCA 1WYVA 3DXVA 2E7IA 2Q7WA 3CQ4A 5DJ1A 3T32A 3ZRRA 4NOGA 4ZDOA 4E77A 4H63Q 2HP1A 3HQTA 3GZDA 4JF1A 1TOJA 3WY7A 4ZDLA 3WX9A 4DQ6A 1S06A 5K8BA 1C0NA 3FRKA 1S09A 5E4ZA 5G09A 4LNMA 4WP0A 2R2NA 1BJNA 3PD6A 2CJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B46 A;  4JEW A;  1X29 A;  4H51 A;  1AHG A;  3E2Z A;  3HL2 A;  3USF A;  3GJU A;  5JAY A;  3GWP A;  4LNL A;  5E3K A;  4F5L A;  3FDB A;  1G7W A;  3NTJ A;  4KAM A;  3NYU A;  4E3R A;  2JGT A;  3I16 A;  4ITG A;  4A00 A;  5AX8 A;  4F5H A;  1DJE A;  2HZP A;  3A8U X;  2C7T A;  2X5F A;  1CZC A;  3LVJ A;  2YHK A;  4WYF A;  3MBB A;  3W1I A;  3ISL A;  3EIA A;  4JEY A;  3DYD A;  3IHJ A;  4R2N A;  4WLJ A;  5F8V A;  4LW4 A;  4FL0 A;  5DX5 A;  1CQ8 A;  1BJO B;  1B9H A;  1SF2 A;  2W8U A;  2W7E A;  3FKD A;  1E5E A;  3PAA A;  1N8P A;  5EUN A;  1O62 A;  1IJI A;  3FFR A;  5EIG A;  3NDN A;  1X2A A;  4M2M A;  2VMU A;  2ZSL A;  4OYT A;  2W7L A;  1B4X A;  2VMQ A;  3N75 A;  1AY8 A;  3GET A;  8AAT A;  2Z67 A;  3BV0 A;  3I5T A;  4UQV A;  2EGY A;  4JEZ A;  1MGV A;  2QB2 A;  1AIB A;  4Y0D A;  3WKS A;  3WKR A;  1E5F A;  2BWO A;  2E54 A;  1LC7 A;  1PMO A;  4A0G A;  4BHD A;  1BJO A;  1GC3 A;  2AEU A;  1AMS A;  4TV7 A;  1ZOD A;  3VK3 A;  4WB0 B;  2OQX A;  1AMQ A;  4HVK A;  2JG2 A;  2W8V A;  4A6U A;  1SPA A;  3QHX A;  1TOE A;  1TOK A;  3AEJ C;  2O1B A;  1ASM A;  3HVY A;  1M7Y A;  3PPL A;  3A9X A;  3QM2 A;  3TQX A;  4AZK A;  4WLH A;  1TAS A;  5HXX A;  1EJI A;  2YKY A;  3ASB A;  4JEV A;  5FT6 A;  3COG A;  5M4B A;  3JWB A;  3LVK A;  4J5U A;  4IYO B;  2VGV A;  3PDB B;  2W8W A;  3NU7 A;  3RI6 A;  4W1X A;  1ART A;  4AO9 A;  1TOG A;  2FM1 A;  2PB0 A;  4WB0 A;  4ADD A;  1LW5 A;  2DKB A;  2AY4 A;  4PFN A;  4KYO A;  1CS1 A;  2CJH A;  3H7F A;  2HOX A;  4R5F A;  3JZL A;  1TAT A;  3B1E A;  3EI6 A;  3ZZK A;  5HHY A;  1CL2 A;  1AKB A;  2PO3 A;  2VIB A;  3BCA A;  1YAA A;  1C9C A;  1Z3Z A;  3RBF A;  4GSA A;  3FQ8 A;  4RM1 A;  4EMY A;  1M0N A;  4W1V A;  4XJM A;  4RJY A;  2W7I A;  3ACZ A;  3A2B A;  1JS3 A;  1S0A A;  4M2J A;  2DOU A;  1SFF A;  1ORD A;  2EH6 A;  2O7C A;  1LS3 A;  4ADC A;  4K2I A;  2WK7 A;  3HDO A;  3L44 A;  2BI3 A;  2D66 A;  4JEX A;  3E9K A;  1IBJ A;  5LH9 A;  3NYS A;  1D7V A;  4OMA A;  1S08 A;  2AY5 A;  3NU8 A;  3PIU A;  1QIT A;  4O6Z A;  2GQN A;  2VMP A;  4GDY A;  1AY5 A;  3ZRQ A;  1FG7 A;  2QBT A;  1GC0 A;  3IF2 A;  1D7U A;  4MKJ A;  1MAQ A;  3VK4 A;  3GSB A;  2FNI A;  2VGT A;  4Q31 A;  2HOZ A;  3WGC A;  5EUD A;  1AKC A;  1B5P A;  2CST A;  2VMO A;  2YRR A;  3ELE A;  4IXO A;  1LC5 A;  4F5M A;  2ZSM A;  1GD9 A;  4XK1 A;  4XQ2 A;  3GR9 A;  1ELU A;  2QMA A;  4AH3 A;  3LVM A;  4K2B A;  3A9Z A;  3DOD A;  4F5G A;  2BKW A;  4UHN A;  4ZAS A;  3UE8 A;  1IX7 A;  3MAF A;  3FFH A;  4CXR A;  2W7M A;  1AAW A;  1SZK A;  1W7L A;  4PVF A;  1MLY A;  2D5Y A;  4ZLV A;  1DFO A;  1YJZ A;  2ZUK A;  3FVX A;  3ATH A;  5M49 A;  2AY9 A;  2FYF A;  1YOO A;  3KE3 A;  2D61 A;  3BN1 A;  1YJY A;  2CIN A;  3I4J A;  4XAU A;  3QPG A;  2Z9W A;  3AEP A;  3FZ6 A;  4IXZ A;  1J32 A;  4ITX A;  4W5K A;  4R8D A;  4B9B A;  1SVV A;  1PFF A;  1PMM A;  1ASA A;  3LG0 A;  2HUF A;  1ASG A;  4MY5 A;  4XJP A;  4ZSY A;  1ARG A;  1ASN A;  3CAI A;  3EI8 A;  1IUG A;  2CH1 A;  4GE7 A;  1IAX A;  2G6W A;  3FQ7 A;  4JE5 A;  3HLM A;  2WK9 A;  4RKC A;  1TPL A;  3B1D A;  3F6T A;  4LC3 A;  4GRX A;  3LY1 A;  3JWA A;  3W1H A;  1OAT A;  1WYT B;  3OP7 A;  3ZZJ A;  4LNJ A;  1IX6 A;  1IAY A;  2WKA A;  1JG8 A;  1G4V A;  3KGX A;  2V1P A;  1GEW A;  3AOW A;  1BW0 A;  3MAD A;  3LV2 A;  2AY2 A;  4CVQ A;  1KL1 A;  4BQ0 A;  1KKP A;  3VOM A;  1ARI A;  2JJF A;  3BWO A;  4A0F A;  2HOY A;  5EUE A;  3R9A A;  4WD2 A;  1AMA A;  2D63 A;  2BWN A;  3DC1 A;  3LWS A;  2CH2 A;  4GE9 A;  2CAN A;  1ARH A;  2VMZ A;  3FD0 A;  2VI9 A;  4AO4 A;  1BKG A;  2JJG A;  1AHE A;  1C7O A;  2R5E A;  3KKI A;  2D64 A;  2PB2 A;  3ZRP A;  3G8M A;  2ZP7 A;  2C44 A;  1V2F A;  1DGD A;  1D7S A;  2EZ1 A;  4Q75 A;  3LVL B;  1B5O A;  3D6K A;  4ZM4 A;  1AAM A;  2O0R A;  3P1T A;  4ZAH A;  2Z20 A;  3TFU A;  1AY4 A;  2DGL A;  2VMT A;  3E6G A;  3BC8 A;  3WCO A;  1S07 A;  2W7H A;  3G0T A;  2HP2 A;  2YKV A;  4W8I A;  1PG8 A;  5BJ4 A;  4A6T A;  3FZ8 A;  1XI9 A;  4F4E A;  2BI5 A;  2F8J A;  1EG5 A;  2ORD A;  4CBS A;  2R5C B;  1M0O A;  2BI2 A;  5FT5 A;  2W7G A;  4WYA A;  5G0A A;  1TOI A;  2GSA A;  2AAT A;  1AJR A;  1Y4I A;  3P6K A;  4LW2 A;  1KL2 A;  4JE5 D;  4OBV A;  2R0T A;  2DR1 A;  4ZWM A;  1ASB A;  3BWN C;  1VJO A;  3DRD A;  3DXW A;  2VMW A;  4MKK A;  5DB5 A;  3FVU A;  3RCH B;  1GDE A;  1AHX A;  2OKK A;  2WK8 A;  2AY8 A;  1ASF A;  3AEJ A;  1RV3 A;  3E77 A;  3II0 A;  3N5M A;  4N0B A;  2VMS A;  3AEN B;  5G2P A;  1ZOB A;  2W7K A;  1CL1 A;  1UU0 A;  3MKJ A;  4OC9 A;  3FTB A;  3PDX A;  3EUC A;  1GC4 A;  1BJW A;  4IYO A;  2VYC A;  1B9I A;  3PDB A;  4W91 A;  1AIA A;  2W7D A;  2FQ6 A;  3PA9 A;  4JF0 A;  3BWN A;  4UHO A;  4WYD A;  1U08 A;  4DBC A;  4MGR A;  5G2Q A;  1AJS B;  3WZF A;  1O4S A;  3JW9 A;  2ZY4 A;  4ADE A;  1M6S A;  3JTX A;  4WXF A;  5FT4 A;  2X3L A;  4ZSW A;  3AEM C;  1QGN A;  1KMK A;  1BS0 A;  1BQA A;  4P3M A;  1FC4 A;  3B8X A;  1SZS A;  4WBT A;  3HMU A;  1WYU B;  3KGW A;  4GE4 A;  2DKJ A;  4K2M A;  1AHF A;  4M2K A;  1GC2 A;  2VLF A;  1D2F A;  1JF9 A;  4BMK A;  1MDO A;  3MAU A;  1M4N A;  1GBN A;  3E2Y A;  3FSL A;  2X8U A;  3NUB A;  2ZYJ A;  4BA4 A;  2JJH A;  1DTY A;  1CJ0 A;  3WGB A;  4UOY A;  1OHY A;  4Q6R A;  1C7N A;  3ASA A;  1CZE A;  3F9T A;  3RBL A;  1YJS A;  3R4T A;  4MSO A;  4N0W A;  2VMV A;  3MC6 C;  4U1T A;  1O69 A;  1WYV B;  3H14 A;  4A0H A;  1DKA A;  1RV4 A;  3VAX A;  4IW7 A;  3NYT A;  1MDZ A;  3DR4 A;  4ZDP A;  2YRI A;  4W1W A;  2BWP A;  3GZD C;  3FDD A;  2W7J A;  4IX8 A;  2VLH A;  4KXK A;  4RAE A;  2HUI A;  3K7Y A;  4F5J A;  2AY6 A;  3PD6 B;  1AHY A;  1MAP A;  3UWC A;  1VEF A;  1W7N A;  3DU4 A;  2BIG A;  2ZY2 A;  3E2Z B;  1MDX A;  5DJ9 A;  2YKX A;  2EO5 A;  1C7G A;  2YCP A;  3DR7 A;  3G7Q A;  1T3I A;  2ZY3 A;  1QJ5 A;  3EZ1 A;  3EZS A;  5TF5 A;  3K40 A;  4AOA A;  1GEX A;  1WKH A;  3HT4 A;  4XJO A;  3BCB A;  2VMX A;  4MQP A;  1AX4 A;  1ZC9 A;  2D65 A;  2QA3 A;  1YIY A;  2VGS A;  1RVY A;  2W7F A;  4EB7 A;  4HF8 A;  1X0M A;  4OBU A;  4CBR A;  2OGE A;  4OTL A;  4WYG A;  5I92 A;  4ZWV A;  3BB8 A;  3E2F A;  3TFT A;  1ASC A;  1G7X A;  1WKG A;  1ELQ A;  2HOR A;  2VGU A;  5EIG B;  4B98 A;  1C4K A;  1M0P A;  2AY7 A;  1AMR A;  4IXS A;  2GB3 A;  1WST A;  2HUU A;  2XBN A;  3QBO A;  2W8J A;  4ATP A;  4F5I A;  4J8L A;  5M4D A;  1KMJ A;  3QI6 A;  1OXP A;  2BIA A;  4MQQ A;  4WXB A;  1YIZ A;  5EAV A;  2E7J A;  3DZZ A;  1WYT A;  1GEY A;  3PJ0 A;  1JS6 A;  1Z7D A;  4L0O A;  3TAT A;  2YCT A;  3BCX A;  4UHM A;  3CQ5 A;  2NMP A;  3EI9 A;  2OKJ A;  2FN6 A;  4RKD A;  2QLR A;  3MEB A;  5EAA A;  1TAR A;  3N0L A;  4DGT A;  1EQB A;  4RIT A;  1UKJ A;  3NX3 A;  4RLG A;  3WCN A;  2DGK A;  2OAT A;  4A0R A;  1M0Q A;  1ASE A;  4OT8 A;  3VK2 A;  1QJ3 A;  1GCK A;  4EFF A;  4RJ0 A;  1I48 A;  5HDM A;  1J04 A;  1ECX A;  4TN4 A;  2BIE A;  2BI9 A;  4RIZ A;  2RFV A;  1BQD A;  5F9S A;  4CXQ A;  2YCN A;  2CTZ A;  2Z61 A;  2X5D A;  1IX8 A;  1CQ6 A;  2YKU A;  4PIW A;  2CJG A;  3L8A A;  5G4J A;  4P7Y A;  3W1J A;  1DJU A;  4QGR A;  4WYC A;  3EI7 A;  3NUI A;  1B8G A;  1I43 A;  3FZ7 A;  4ISY A;  3RQ1 A;  1LC8 A;  1VP4 A;  3F0H A;  2W8T A;  2EZ2 A;  2FNU A;  4U2H A;  1BT4 A;  4A72 A;  5M46 A;  5D95 A;  1OHV A;  4EU1 A;  1SZU A;  1V72 A;  4E1O A;  1V2E A;  3M5U A;  4Y0I A;  3AEO A;  1LKC A;  2E7U A;  4WYE A;  2GMS A;  2VMY A;  4ZM3 A;  7AAT A;  4Q76 A;  2XH1 A;  2AY3 A;  5E5I A;  2JIS A;  2Z1Z A;  3JU7 A;  5IWQ A;  1I41 A;  3ECD A;  3CBF A;  3NNK A;  1AIC A;  1AKA A;  1KKJ A;  3TCM A;  1UU2 A;  3FVS A;  4I8A A;  2R5C A;  4R5Z A;  1QZ9 A;  5EFS A;  5BJ3 A;  1XEY A;  2Z1Y A;  3CQ6 A;  1W23 A;  3EI5 A;  3K28 A;  4A6R A;  3NRA A;  1ASD A;  2V0Y A;  5D5S A;  2BI1 A;  3AAT A;  9AAT A;  3GBX A;  3RCH A;  4ADB A;  1P3W A;  4BA5 A;  1BJ4 A;  1MLZ A;  1W3U A;  3RUY A;  2BYL A;  1LW4 A;  1N2T A;  1YNU A;  2Z9V A;  3AEN A;  1DJ9 A;  2C0R A;  2VMR A;  4GEB A;  1O61 A;  1H1C A;  2C81 A;  1OHW A;  2VGW A;  1IVR A;  1RVU A;  3AEL A;  3FCR A;  3PGY A;  3AOV A;  4XJL A;  4F5F A;  1DGE A;  2TPL A;  3B1C A;  5C6U A;  4E3Q A;  3AV7 A;  4OCA A;  3OKS A;  1AJS A;  2Z9U A;  2BYJ A;  3AEM A;  1UU1 A;  2AEV A;  3HBX A;  3FQA A;  4XEW A;  4FFC A;  1N31 A;  2QB3 A;  1I29 A;  2DGM A;  2D7Z A;  2OGA A;  3EIB A;  3UAK A;  1D7R A;  2ZY5 A;  2CY8 A;  4EB5 A;  1LK9 A;  1OXO A;  1WYU A;  2VGZ A;  5LHA A;  1V2D A;  3MAF B;  1X28 A;  3VP6 A;  2ZC0 A;  5EQC A;  2CB1 A;  2JJE A;  4IY7 A;  1ASL A;  4Y0H A;  3QGU A;  2CFB A;  2Z9X A;  2BHX A;  1QIR A;  2VIA A;  5G4I A;  5J8Q A;  3A9Y A;  2YOB A;  4PFF A;  2EPJ A;  2AY1 A;  3QN6 A;  3WLX A;  4F5K A;  1G4X A;  1FG3 A;  2VI8 A;  3BS8 A;  3Q8N A;  1M32 A;  4MQR A;  2D7Y A;  3ELP A;  1H0C A;  4TMR A;  1W7M A;  4ATQ A;  2ZJG A;  5FT8 A;  4WXG A;  4AZJ A;  1ARS A;  2GMU A;  2VMN A;  3MC6 A;  1QIS A;  1CQ7 A;  3GZC A;  1WYV A;  3DXV A;  2E7I A;  2Q7W A;  3CQ4 A;  5DJ1 A;  3T32 A;  3ZRR A;  4NOG A;  4ZDO A;  4E77 A;  2HP1 A;  3HQT A;  3GZD A;  4JF1 A;  1TOJ A;  3WY7 A;  4ZDL A;  3WX9 A;  4DQ6 A;  1S06 A;  5K8B A;  1C0N A;  3FRK A;  1S09 A;  5E4Z A;  5G09 A;  4LNM A;  4WP0 A;  2R2N A;  1BJN A;  3PD6 A;  2CJD A; 
#chains in the Genus database with same CATH topology
 3B46 A;  4JEW A;  1X29 A;  4H51 A;  1AHG A;  3E2Z A;  3HL2 A;  3USF A;  3GJU A;  5JAY A;  3GWP A;  4LNL A;  5E3K A;  4F5L A;  3FDB A;  1G7W A;  3NTJ A;  4KAM A;  3NYU A;  4E3R A;  2JGT A;  3I16 A;  4ITG A;  4A00 A;  5AX8 A;  4F5H A;  1DJE A;  2HZP A;  3A8U X;  2C7T A;  2X5F A;  1CZC A;  3LVJ A;  2YHK A;  4WYF A;  3MBB A;  3W1I A;  3ISL A;  3EIA A;  4JEY A;  3DYD A;  3IHJ A;  4R2N A;  4WLJ A;  5F8V A;  4LW4 A;  4FL0 A;  5DX5 A;  1CQ8 A;  1BJO B;  1B9H A;  1SF2 A;  2W8U A;  2W7E A;  3FKD A;  1E5E A;  3PAA A;  1N8P A;  5EUN A;  1O62 A;  1IJI A;  3FFR A;  5EIG A;  5KTB A;  3NDN A;  1X2A A;  4M2M A;  2VMU A;  2ZSL A;  4OYT A;  2W7L A;  1B4X A;  2VMQ A;  3N75 A;  1AY8 A;  3GET A;  3N4R A;  8AAT A;  2Z67 A;  3BV0 A;  3I5T A;  4UQV A;  2EGY A;  4JEZ A;  1MGV A;  2QB2 A;  1AIB A;  4Y0D A;  3WKS A;  3WKR A;  1E5F A;  2BWO A;  2E54 A;  1LC7 A;  1PMO A;  4A0G A;  4BHD A;  1BJO A;  1GC3 A;  2AEU A;  1AMS A;  4TV7 A;  1ZOD A;  2WB6 A;  3VK3 A;  4WB0 B;  2OQX A;  1AMQ A;  4HVK A;  2JG2 A;  2W8V A;  4A6U A;  1SPA A;  3QHX A;  1TOE A;  1TOK A;  3AEJ C;  2O1B A;  1ASM A;  3HVY A;  1M7Y A;  3PPL A;  3A9X A;  3QM2 A;  3TQX A;  4AZK A;  4WLH A;  1TAS A;  5HXX A;  1EJI A;  2YKY A;  3ASB A;  4JEV A;  5FT6 A;  3COG A;  5M4B A;  3JWB A;  3LVK A;  4J5U A;  4IYO B;  2VGV A;  3PDB B;  2W8W A;  3NU7 A;  3RI6 A;  4K05 A;  4W1X A;  1ART A;  4AO9 A;  1TOG A;  2FM1 A;  2PB0 A;  4WB0 A;  4ADD A;  1LW5 A;  3N4X A;  2DKB A;  3H9X A;  2AY4 A;  4PFN A;  4KYO A;  1CS1 A;  2CJH A;  3H7F A;  2HOX A;  4R5F A;  3JZL A;  1TAT A;  3B1E A;  3EI6 A;  3ZZK A;  5HHY A;  1CL2 A;  1AKB A;  2PO3 A;  2VIB A;  3BCA A;  1YAA A;  1C9C A;  1Z3Z A;  3RBF A;  4GSA A;  3FQ8 A;  4RM1 A;  4EMY A;  1M0N A;  4W1V A;  4XJM A;  4RJY A;  2W7I A;  3ACZ A;  3A2B A;  1JS3 A;  1S0A A;  4M2J A;  2DOU A;  1SFF A;  1ORD A;  2EH6 A;  2O7C A;  1LS3 A;  4ADC A;  4K2I A;  2WK7 A;  3HDO A;  3L44 A;  2BI3 A;  2D66 A;  4JEX A;  3E9K A;  1IBJ A;  5LH9 A;  3NYS A;  1D7V A;  4OMA A;  1S08 A;  2AY5 A;  3NU8 A;  3PIU A;  1QIT A;  4O6Z A;  2GQN A;  2VMP A;  4GDY A;  1AY5 A;  3ZRQ A;  1FG7 A;  2QBT A;  1GC0 A;  3IF2 A;  1D7U A;  4MKJ A;  1MAQ A;  3VK4 A;  3GSB A;  2FNI A;  2VGT A;  4Q31 A;  2HOZ A;  3WGC A;  5EUD A;  1AKC A;  1B5P A;  2CST A;  2VMO A;  2YRR A;  3ELE A;  4IXO A;  1LC5 A;  1KAF A;  4F5M A;  2ZSM A;  1GD9 A;  4XK1 A;  4XQ2 A;  3GR9 A;  1ELU A;  2QMA A;  4AH3 A;  3LVM A;  4K2B A;  3A9Z A;  3DOD A;  4F5G A;  2BKW A;  4UHN A;  4ZAS A;  3UE8 A;  1IX7 A;  3MAF A;  3FFH A;  4CXR A;  2W7M A;  1AAW A;  1SZK A;  1W7L A;  4PVF A;  1MLY A;  2D5Y A;  4ZLV A;  1DFO A;  1YJZ A;  2ZUK A;  3FVX A;  3ATH A;  5M49 A;  2AY9 A;  2FYF A;  1YOO A;  3KE3 A;  2D61 A;  3BN1 A;  1YJY A;  2CIN A;  3I4J A;  4XAU A;  3QPG A;  2Z9W A;  3AEP A;  3FZ6 A;  4IXZ A;  1J32 A;  4ITX A;  4W5K A;  4R8D A;  4B9B A;  1SVV A;  1PFF A;  1PMM A;  1ASA A;  3LG0 A;  2HUF A;  1ASG A;  4MY5 A;  4XJP A;  4ZSY A;  1ARG A;  1ASN A;  3CAI A;  3EI8 A;  1IUG A;  2CH1 A;  4GE7 A;  1IAX A;  2G6W A;  3FQ7 A;  4JE5 A;  3HLM A;  3N7N A;  2WK9 A;  4RKC A;  1TPL A;  3B1D A;  3F6T A;  4LC3 A;  4GRX A;  3LY1 A;  3JWA A;  3W1H A;  1OAT A;  1WYT B;  3OP7 A;  3ZZJ A;  4LNJ A;  1IX6 A;  1IAY A;  2WKA A;  1JG8 A;  1G4V A;  3KGX A;  2V1P A;  1GEW A;  3AOW A;  1BW0 A;  3MAD A;  3LV2 A;  2AY2 A;  4CVQ A;  1KL1 A;  4BQ0 A;  1KKP A;  3VOM A;  1ARI A;  2JJF A;  3BWO A;  4A0F A;  2HOY A;  5EUE A;  3R9A A;  4WD2 A;  1AMA A;  2D63 A;  2BWN A;  3DC1 A;  3LWS A;  2CH2 A;  4GE9 A;  2CAN A;  1ARH A;  2VMZ A;  3FD0 A;  2VI9 A;  4AO4 A;  1BKG A;  2JJG A;  1AHE A;  1C7O A;  2R5E A;  3KKI A;  2D64 A;  2PB2 A;  3ZRP A;  3G8M A;  2QSR A;  2ZP7 A;  2C44 A;  1V2F A;  1DGD A;  1D7S A;  2EZ1 A;  4Q75 A;  3LVL B;  1B5O A;  3D6K A;  4ZM4 A;  1AAM A;  2O0R A;  3P1T A;  4ZAH A;  2Z20 A;  3TFU A;  1AY4 A;  2DGL A;  2VMT A;  3E6G A;  3BC8 A;  3WCO A;  1S07 A;  2W7H A;  3G0T A;  2HP2 A;  2YKV A;  4W8I A;  1PG8 A;  5BJ4 A;  4A6T A;  3FZ8 A;  1XI9 A;  4F4E A;  2BI5 A;  2F8J A;  1EG5 A;  2ORD A;  4CBS A;  2R5C B;  1M0O A;  2BI2 A;  5FT5 A;  2W7G A;  4WYA A;  5G0A A;  1TOI A;  2GSA A;  2AAT A;  1AJR A;  1Y4I A;  3P6K A;  4LW2 A;  1KL2 A;  4JE5 D;  4OBV A;  2EYQ A;  2R0T A;  2DR1 A;  4ZWM A;  1ASB A;  3BWN C;  1VJO A;  3DRD A;  3DXW A;  2VMW A;  4MKK A;  5DB5 A;  3FVU A;  3RCH B;  1GDE A;  1AHX A;  2OKK A;  2WK8 A;  2AY8 A;  1ASF A;  3AEJ A;  1RV3 A;  3E77 A;  3II0 A;  3N5M A;  4N0B A;  2VMS A;  3AEN B;  5G2P A;  1ZOB A;  2W7K A;  1CL1 A;  1UU0 A;  3MKJ A;  4OC9 A;  3FTB A;  3PDX A;  3EUC A;  1GC4 A;  1BJW A;  4IYO A;  2VYC A;  1B9I A;  3PDB A;  4W91 A;  1AIA A;  2W7D A;  2FQ6 A;  3PA9 A;  4JF0 A;  3BWN A;  4UHO A;  4WYD A;  1U08 A;  4DBC A;  4MGR A;  5G2Q A;  1AJS B;  3WZF A;  1O4S A;  3JW9 A;  2ZY4 A;  4ADE A;  1M6S A;  3JTX A;  4WXF A;  5FT4 A;  2X3L A;  4ZSW A;  3AEM C;  1QGN A;  1KMK A;  1BS0 A;  1BQA A;  4P3M A;  1FC4 A;  3B8X A;  1SZS A;  4WBT A;  3HMU A;  1WYU B;  3KGW A;  4GE4 A;  2DKJ A;  4K2M A;  1AHF A;  4M2K A;  1GC2 A;  2VLF A;  1D2F A;  1JF9 A;  4BMK A;  1MDO A;  3MAU A;  1M4N A;  1GBN A;  3E2Y A;  3FSL A;  2X8U A;  3NUB A;  2ZYJ A;  4BA4 A;  2JJH A;  1DTY A;  1CJ0 A;  3WGB A;  4UOY A;  1OHY A;  4Q6R A;  1C7N A;  3ASA A;  1CZE A;  3F9T A;  3RBL A;  1YJS A;  3R4T A;  4MSO A;  4N0W A;  2VMV A;  3MC6 C;  4U1T A;  1O69 A;  1WYV B;  3H14 A;  4A0H A;  1DKA A;  1RV4 A;  3VAX A;  4IW7 A;  3NYT A;  1MDZ A;  3DR4 A;  4ZDP A;  2YRI A;  4W1W A;  2BWP A;  3GZD C;  3FDD A;  2W7J A;  4IX8 A;  2VLH A;  4KXK A;  4RAE A;  2HUI A;  3N4S A;  3K7Y A;  4F5J A;  2AY6 A;  3PD6 B;  1AHY A;  1MAP A;  3UWC A;  1VEF A;  1W7N A;  3DU4 A;  2BIG A;  2ZY2 A;  3E2Z B;  1MDX A;  5DJ9 A;  2YKX A;  2EO5 A;  1C7G A;  2YCP A;  3DR7 A;  3G7Q A;  1T3I A;  2ZY3 A;  1QJ5 A;  3EZ1 A;  3EZS A;  5TF5 A;  2KFP A;  3K40 A;  4AOA A;  1GEX A;  1WKH A;  3HT4 A;  4XJO A;  3BCB A;  2VMX A;  4MQP A;  1AX4 A;  1ZC9 A;  2D65 A;  2QA3 A;  1YIY A;  2VGS A;  1RVY A;  2W7F A;  4EB7 A;  4HF8 A;  1X0M A;  4OBU A;  4CBR A;  2OGE A;  4OTL A;  4WYG A;  5I92 A;  4ZWV A;  3BB8 A;  3E2F A;  3TFT A;  1ASC A;  1G7X A;  1WKG A;  1ELQ A;  2HOR A;  2VGU A;  5EIG B;  4B98 A;  1C4K A;  1M0P A;  2AY7 A;  1AMR A;  4IXS A;  2GB3 A;  1WST A;  2HUU A;  2XBN A;  3QBO A;  2W8J A;  4ATP A;  4F5I A;  4J8L A;  5M4D A;  1KMJ A;  3QI6 A;  1OXP A;  2BIA A;  4MQQ A;  4WXB A;  1YIZ A;  5EAV A;  2E7J A;  3DZZ A;  1WYT A;  1GEY A;  3PJ0 A;  1JS6 A;  1Z7D A;  4L0O A;  3TAT A;  2YCT A;  3BCX A;  4UHM A;  3CQ5 A;  2NMP A;  3EI9 A;  2OKJ A;  2FN6 A;  4RKD A;  2QLR A;  3MEB A;  5EAA A;  1TAR A;  3N0L A;  4DGT A;  1EQB A;  4RIT A;  1UKJ A;  3NX3 A;  4RLG A;  3WCN A;  2DGK A;  2OAT A;  4A0R A;  1M0Q A;  1ASE A;  4OT8 A;  3VK2 A;  1QJ3 A;  1GCK A;  4EFF A;  4RJ0 A;  1I48 A;  5HDM A;  1J04 A;  1ECX A;  4TN4 A;  2G7J A;  2BIE A;  2BI9 A;  4RIZ A;  2RFV A;  1BQD A;  5F9S A;  4CXQ A;  2YCN A;  2CTZ A;  2Z61 A;  2X5D A;  1IX8 A;  1CQ6 A;  2YKU A;  4PIW A;  2CJG A;  3L8A A;  5G4J A;  4P7Y A;  3W1J A;  1DJU A;  4QGR A;  4WYC A;  3EI7 A;  3NUI A;  1B8G A;  1I43 A;  3FZ7 A;  4ISY A;  3RQ1 A;  1LC8 A;  1VP4 A;  3F0H A;  2W8T A;  2EZ2 A;  2FKI A;  2FNU A;  4U2H A;  1BT4 A;  4A72 A;  5M46 A;  5D95 A;  1OHV A;  4EU1 A;  1SZU A;  1V72 A;  4E1O A;  1V2E A;  3M5U A;  4Y0I A;  3AEO A;  1LKC A;  2E7U A;  4WYE A;  2GMS A;  2VMY A;  4ZM3 A;  7AAT A;  4Q76 A;  2XH1 A;  2AY3 A;  5E5I A;  2JIS A;  2Z1Z A;  3JU7 A;  5IWQ A;  1I41 A;  3ECD A;  3CBF A;  3NNK A;  1AIC A;  1AKA A;  1KKJ A;  3TCM A;  1UU2 A;  3FVS A;  4I8A A;  2R5C A;  4R5Z A;  1QZ9 A;  5EFS A;  5BJ3 A;  1XEY A;  2Z1Y A;  3CQ6 A;  1W23 A;  3EI5 A;  3K28 A;  4A6R A;  3NRA A;  1ASD A;  2V0Y A;  5D5S A;  2BI1 A;  3AAT A;  9AAT A;  3GBX A;  3RCH A;  4ADB A;  1P3W A;  4BA5 A;  1BJ4 A;  1MLZ A;  1W3U A;  3RUY A;  2BYL A;  1LW4 A;  1N2T A;  1YNU A;  2Z9V A;  3AEN A;  1DJ9 A;  2C0R A;  2VMR A;  4GEB A;  1O61 A;  1H1C A;  2C81 A;  1OHW A;  2VGW A;  1IVR A;  1RVU A;  3AEL A;  3FCR A;  2A1V A;  3PGY A;  3AOV A;  4XJL A;  4F5F A;  1DGE A;  2TPL A;  3B1C A;  5C6U A;  4E3Q A;  3AV7 A;  4OCA A;  3OKS A;  1AJS A;  2Z9U A;  2BYJ A;  3AEM A;  1UU1 A;  2AEV A;  3HBX A;  3FQA A;  4XEW A;  4FFC A;  1N31 A;  2QB3 A;  1I29 A;  2DGM A;  2D7Z A;  2OGA A;  3EIB A;  3UAK A;  1D7R A;  2ZY5 A;  2CY8 A;  4EB5 A;  1LK9 A;  1OXO A;  1WYU A;  2VGZ A;  5LHA A;  1V2D A;  3MAF B;  1X28 A;  3VP6 A;  2ZC0 A;  5EQC A;  2CB1 A;  2JJE A;  4IY7 A;  1ASL A;  4Y0H A;  3QGU A;  2CFB A;  2Z9X A;  2BHX A;  1QIR A;  2VIA A;  5G4I A;  5J8Q A;  3A9Y A;  2YOB A;  4PFF A;  2EPJ A;  2AY1 A;  3QN6 A;  3WLX A;  4F5K A;  1G4X A;  1FG3 A;  2VI8 A;  3BS8 A;  3Q8N A;  1M32 A;  4MQR A;  2D7Y A;  3ELP A;  1H0C A;  4TMR A;  1W7M A;  4ATQ A;  2ZJG A;  5FT8 A;  4WXG A;  4AZJ A;  1ARS A;  2GMU A;  2VMN A;  3MC6 A;  1QIS A;  1CQ7 A;  3GZC A;  1WYV A;  3DXV A;  2E7I A;  2Q7W A;  3CQ4 A;  5DJ1 A;  3T32 A;  3ZRR A;  4NOG A;  4ZDO A;  4E77 A;  4H63 Q;  2HP1 A;  3HQT A;  3GZD A;  4JF1 A;  1TOJ A;  3WY7 A;  4ZDL A;  3WX9 A;  4DQ6 A;  1S06 A;  5K8B A;  1C0N A;  3FRK A;  1S09 A;  5E4Z A;  5G09 A;  4LNM A;  4WP0 A;  2R2N A;  1BJN A;  3PD6 A;  2CJD A; 
#chains in the Genus database with same CATH homology
 3B46 A;  4JEW A;  1X29 A;  4H51 A;  1AHG A;  3E2Z A;  3HL2 A;  3USF A;  3GJU A;  5JAY A;  3GWP A;  4LNL A;  5E3K A;  4F5L A;  3FDB A;  1G7W A;  3NTJ A;  4KAM A;  3NYU A;  4E3R A;  2JGT A;  3I16 A;  4ITG A;  4A00 A;  5AX8 A;  4F5H A;  1DJE A;  2HZP A;  3A8U X;  2C7T A;  2X5F A;  1CZC A;  3LVJ A;  2YHK A;  4WYF A;  3MBB A;  3W1I A;  3ISL A;  3EIA A;  4JEY A;  3DYD A;  3IHJ A;  4R2N A;  4WLJ A;  5F8V A;  4LW4 A;  4FL0 A;  5DX5 A;  1CQ8 A;  1BJO B;  1B9H A;  1SF2 A;  2W8U A;  2W7E A;  3FKD A;  1E5E A;  3PAA A;  1N8P A;  5EUN A;  1O62 A;  1IJI A;  3FFR A;  5EIG A;  5KTB A;  3NDN A;  1X2A A;  4M2M A;  2VMU A;  2ZSL A;  4OYT A;  2W7L A;  1B4X A;  2VMQ A;  3N75 A;  1AY8 A;  3GET A;  3N4R A;  8AAT A;  2Z67 A;  3BV0 A;  3I5T A;  4UQV A;  2EGY A;  4JEZ A;  1MGV A;  2QB2 A;  1AIB A;  4Y0D A;  3WKS A;  3WKR A;  1E5F A;  2BWO A;  2E54 A;  1LC7 A;  1PMO A;  4A0G A;  4BHD A;  1BJO A;  1GC3 A;  2AEU A;  1AMS A;  4TV7 A;  1ZOD A;  2WB6 A;  3VK3 A;  4WB0 B;  2OQX A;  1AMQ A;  4HVK A;  2JG2 A;  2W8V A;  4A6U A;  1SPA A;  3QHX A;  1TOE A;  1TOK A;  3AEJ C;  2O1B A;  1ASM A;  3HVY A;  1M7Y A;  3PPL A;  3A9X A;  3QM2 A;  3TQX A;  4AZK A;  4WLH A;  1TAS A;  5HXX A;  1EJI A;  2YKY A;  3ASB A;  4JEV A;  5FT6 A;  3COG A;  5M4B A;  3JWB A;  3LVK A;  4J5U A;  4IYO B;  2VGV A;  3PDB B;  2W8W A;  3NU7 A;  3RI6 A;  4K05 A;  4W1X A;  1ART A;  4AO9 A;  1TOG A;  2FM1 A;  2PB0 A;  4WB0 A;  4ADD A;  1LW5 A;  3N4X A;  2DKB A;  3H9X A;  2AY4 A;  4PFN A;  4KYO A;  1CS1 A;  2CJH A;  3H7F A;  2HOX A;  4R5F A;  3JZL A;  1TAT A;  3B1E A;  3EI6 A;  3ZZK A;  5HHY A;  1CL2 A;  1AKB A;  2PO3 A;  2VIB A;  3BCA A;  1YAA A;  1C9C A;  1Z3Z A;  3RBF A;  4GSA A;  3FQ8 A;  4RM1 A;  4EMY A;  1M0N A;  4W1V A;  4XJM A;  4RJY A;  2W7I A;  3ACZ A;  3A2B A;  1JS3 A;  1S0A A;  4M2J A;  2DOU A;  1SFF A;  1ORD A;  2EH6 A;  2O7C A;  1LS3 A;  4ADC A;  4K2I A;  2WK7 A;  3HDO A;  3L44 A;  2BI3 A;  2D66 A;  4JEX A;  3E9K A;  1IBJ A;  5LH9 A;  3NYS A;  1D7V A;  4OMA A;  1S08 A;  2AY5 A;  3NU8 A;  3PIU A;  1QIT A;  4O6Z A;  2GQN A;  2VMP A;  4GDY A;  1AY5 A;  3ZRQ A;  1FG7 A;  2QBT A;  1GC0 A;  3IF2 A;  1D7U A;  4MKJ A;  1MAQ A;  3VK4 A;  3GSB A;  2FNI A;  2VGT A;  4Q31 A;  2HOZ A;  3WGC A;  5EUD A;  1AKC A;  1B5P A;  2CST A;  2VMO A;  2YRR A;  3ELE A;  4IXO A;  1LC5 A;  4F5M A;  2ZSM A;  1GD9 A;  4XK1 A;  4XQ2 A;  3GR9 A;  1ELU A;  2QMA A;  4AH3 A;  3LVM A;  4K2B A;  3A9Z A;  3DOD A;  4F5G A;  2BKW A;  4UHN A;  4ZAS A;  3UE8 A;  1IX7 A;  3MAF A;  3FFH A;  4CXR A;  2W7M A;  1AAW A;  1SZK A;  1W7L A;  4PVF A;  1MLY A;  2D5Y A;  4ZLV A;  1DFO A;  1YJZ A;  2ZUK A;  3FVX A;  3ATH A;  5M49 A;  2AY9 A;  2FYF A;  1YOO A;  3KE3 A;  2D61 A;  3BN1 A;  1YJY A;  2CIN A;  3I4J A;  4XAU A;  3QPG A;  2Z9W A;  3AEP A;  3FZ6 A;  4IXZ A;  1J32 A;  4ITX A;  4W5K A;  4R8D A;  4B9B A;  1SVV A;  1PFF A;  1PMM A;  1ASA A;  3LG0 A;  2HUF A;  1ASG A;  4MY5 A;  4XJP A;  4ZSY A;  1ARG A;  1ASN A;  3CAI A;  3EI8 A;  1IUG A;  2CH1 A;  4GE7 A;  1IAX A;  2G6W A;  3FQ7 A;  4JE5 A;  3HLM A;  3N7N A;  2WK9 A;  4RKC A;  1TPL A;  3B1D A;  3F6T A;  4LC3 A;  4GRX A;  3LY1 A;  3JWA A;  3W1H A;  1OAT A;  1WYT B;  3OP7 A;  3ZZJ A;  4LNJ A;  1IX6 A;  1IAY A;  2WKA A;  1JG8 A;  1G4V A;  3KGX A;  2V1P A;  1GEW A;  3AOW A;  1BW0 A;  3MAD A;  3LV2 A;  2AY2 A;  4CVQ A;  1KL1 A;  4BQ0 A;  1KKP A;  3VOM A;  1ARI A;  2JJF A;  3BWO A;  4A0F A;  2HOY A;  5EUE A;  3R9A A;  4WD2 A;  1AMA A;  2D63 A;  2BWN A;  3DC1 A;  3LWS A;  2CH2 A;  4GE9 A;  2CAN A;  1ARH A;  2VMZ A;  3FD0 A;  2VI9 A;  4AO4 A;  1BKG A;  2JJG A;  1AHE A;  1C7O A;  2R5E A;  3KKI A;  2D64 A;  2PB2 A;  3ZRP A;  3G8M A;  2QSR A;  2ZP7 A;  2C44 A;  1V2F A;  1DGD A;  1D7S A;  2EZ1 A;  4Q75 A;  3LVL B;  1B5O A;  3D6K A;  4ZM4 A;  1AAM A;  2O0R A;  3P1T A;  4ZAH A;  2Z20 A;  3TFU A;  1AY4 A;  2DGL A;  2VMT A;  3E6G A;  3BC8 A;  3WCO A;  1S07 A;  2W7H A;  3G0T A;  2HP2 A;  2YKV A;  4W8I A;  1PG8 A;  5BJ4 A;  4A6T A;  3FZ8 A;  1XI9 A;  4F4E A;  2BI5 A;  2F8J A;  1EG5 A;  2ORD A;  4CBS A;  2R5C B;  1M0O A;  2BI2 A;  5FT5 A;  2W7G A;  4WYA A;  5G0A A;  1TOI A;  2GSA A;  2AAT A;  1AJR A;  1Y4I A;  3P6K A;  4LW2 A;  1KL2 A;  4JE5 D;  4OBV A;  2EYQ A;  2R0T A;  2DR1 A;  4ZWM A;  1ASB A;  3BWN C;  1VJO A;  3DRD A;  3DXW A;  2VMW A;  4MKK A;  5DB5 A;  3FVU A;  3RCH B;  1GDE A;  1AHX A;  2OKK A;  2WK8 A;  2AY8 A;  1ASF A;  3AEJ A;  1RV3 A;  3E77 A;  3II0 A;  3N5M A;  4N0B A;  2VMS A;  3AEN B;  5G2P A;  1ZOB A;  2W7K A;  1CL1 A;  1UU0 A;  3MKJ A;  4OC9 A;  3FTB A;  3PDX A;  3EUC A;  1GC4 A;  1BJW A;  4IYO A;  2VYC A;  1B9I A;  3PDB A;  4W91 A;  1AIA A;  2W7D A;  2FQ6 A;  3PA9 A;  4JF0 A;  3BWN A;  4UHO A;  4WYD A;  1U08 A;  4DBC A;  4MGR A;  5G2Q A;  1AJS B;  3WZF A;  1O4S A;  3JW9 A;  2ZY4 A;  4ADE A;  1M6S A;  3JTX A;  4WXF A;  5FT4 A;  2X3L A;  4ZSW A;  3AEM C;  1QGN A;  1KMK A;  1BS0 A;  1BQA A;  4P3M A;  1FC4 A;  3B8X A;  1SZS A;  4WBT A;  3HMU A;  1WYU B;  3KGW A;  4GE4 A;  2DKJ A;  4K2M A;  1AHF A;  4M2K A;  1GC2 A;  2VLF A;  1D2F A;  1JF9 A;  4BMK A;  1MDO A;  3MAU A;  1M4N A;  1GBN A;  3E2Y A;  3FSL A;  2X8U A;  3NUB A;  2ZYJ A;  4BA4 A;  2JJH A;  1DTY A;  1CJ0 A;  3WGB A;  4UOY A;  1OHY A;  4Q6R A;  1C7N A;  3ASA A;  1CZE A;  3F9T A;  3RBL A;  1YJS A;  3R4T A;  4MSO A;  4N0W A;  2VMV A;  3MC6 C;  4U1T A;  1O69 A;  1WYV B;  3H14 A;  4A0H A;  1DKA A;  1RV4 A;  3VAX A;  4IW7 A;  3NYT A;  1MDZ A;  3DR4 A;  4ZDP A;  2YRI A;  4W1W A;  2BWP A;  3GZD C;  3FDD A;  2W7J A;  4IX8 A;  2VLH A;  4KXK A;  4RAE A;  2HUI A;  3N4S A;  3K7Y A;  4F5J A;  2AY6 A;  3PD6 B;  1AHY A;  1MAP A;  3UWC A;  1VEF A;  1W7N A;  3DU4 A;  2BIG A;  2ZY2 A;  3E2Z B;  1MDX A;  5DJ9 A;  2YKX A;  2EO5 A;  1C7G A;  2YCP A;  3DR7 A;  3G7Q A;  1T3I A;  2ZY3 A;  1QJ5 A;  3EZ1 A;  3EZS A;  5TF5 A;  2KFP A;  3K40 A;  4AOA A;  1GEX A;  1WKH A;  3HT4 A;  4XJO A;  3BCB A;  2VMX A;  4MQP A;  1AX4 A;  1ZC9 A;  2D65 A;  2QA3 A;  1YIY A;  2VGS A;  1RVY A;  2W7F A;  4EB7 A;  4HF8 A;  1X0M A;  4OBU A;  4CBR A;  2OGE A;  4OTL A;  4WYG A;  5I92 A;  4ZWV A;  3BB8 A;  3E2F A;  3TFT A;  1ASC A;  1G7X A;  1WKG A;  1ELQ A;  2HOR A;  2VGU A;  5EIG B;  4B98 A;  1C4K A;  1M0P A;  2AY7 A;  1AMR A;  4IXS A;  2GB3 A;  1WST A;  2HUU A;  2XBN A;  3QBO A;  2W8J A;  4ATP A;  4F5I A;  4J8L A;  5M4D A;  1KMJ A;  3QI6 A;  1OXP A;  2BIA A;  4MQQ A;  4WXB A;  1YIZ A;  5EAV A;  2E7J A;  3DZZ A;  1WYT A;  1GEY A;  3PJ0 A;  1JS6 A;  1Z7D A;  4L0O A;  3TAT A;  2YCT A;  3BCX A;  4UHM A;  3CQ5 A;  2NMP A;  3EI9 A;  2OKJ A;  2FN6 A;  4RKD A;  2QLR A;  3MEB A;  5EAA A;  1TAR A;  3N0L A;  4DGT A;  1EQB A;  4RIT A;  1UKJ A;  3NX3 A;  4RLG A;  3WCN A;  2DGK A;  2OAT A;  4A0R A;  1M0Q A;  1ASE A;  4OT8 A;  3VK2 A;  1QJ3 A;  1GCK A;  4EFF A;  4RJ0 A;  1I48 A;  5HDM A;  1J04 A;  1ECX A;  4TN4 A;  2G7J A;  2BIE A;  2BI9 A;  4RIZ A;  2RFV A;  1BQD A;  5F9S A;  4CXQ A;  2YCN A;  2CTZ A;  2Z61 A;  2X5D A;  1IX8 A;  1CQ6 A;  2YKU A;  4PIW A;  2CJG A;  3L8A A;  5G4J A;  4P7Y A;  3W1J A;  1DJU A;  4QGR A;  4WYC A;  3EI7 A;  3NUI A;  1B8G A;  1I43 A;  3FZ7 A;  4ISY A;  3RQ1 A;  1LC8 A;  1VP4 A;  3F0H A;  2W8T A;  2EZ2 A;  2FKI A;  2FNU A;  4U2H A;  1BT4 A;  4A72 A;  5M46 A;  5D95 A;  1OHV A;  4EU1 A;  1SZU A;  1V72 A;  4E1O A;  1V2E A;  3M5U A;  4Y0I A;  3AEO A;  1LKC A;  2E7U A;  4WYE A;  2GMS A;  2VMY A;  4ZM3 A;  7AAT A;  4Q76 A;  2XH1 A;  2AY3 A;  5E5I A;  2JIS A;  2Z1Z A;  3JU7 A;  5IWQ A;  1I41 A;  3ECD A;  3CBF A;  3NNK A;  1AIC A;  1AKA A;  1KKJ A;  3TCM A;  1UU2 A;  3FVS A;  4I8A A;  2R5C A;  4R5Z A;  1QZ9 A;  5EFS A;  5BJ3 A;  1XEY A;  2Z1Y A;  3CQ6 A;  1W23 A;  3EI5 A;  3K28 A;  4A6R A;  3NRA A;  1ASD A;  2V0Y A;  5D5S A;  2BI1 A;  3AAT A;  9AAT A;  3GBX A;  3RCH A;  4ADB A;  1P3W A;  4BA5 A;  1BJ4 A;  1MLZ A;  1W3U A;  3RUY A;  2BYL A;  1LW4 A;  1N2T A;  1YNU A;  2Z9V A;  3AEN A;  1DJ9 A;  2C0R A;  2VMR A;  4GEB A;  1O61 A;  1H1C A;  2C81 A;  1OHW A;  2VGW A;  1IVR A;  1RVU A;  3AEL A;  3FCR A;  2A1V A;  3PGY A;  3AOV A;  4XJL A;  4F5F A;  1DGE A;  2TPL A;  3B1C A;  5C6U A;  4E3Q A;  3AV7 A;  4OCA A;  3OKS A;  1AJS A;  2Z9U A;  2BYJ A;  3AEM A;  1UU1 A;  2AEV A;  3HBX A;  3FQA A;  4XEW A;  4FFC A;  1N31 A;  2QB3 A;  1I29 A;  2DGM A;  2D7Z A;  2OGA A;  3EIB A;  3UAK A;  1D7R A;  2ZY5 A;  2CY8 A;  4EB5 A;  1LK9 A;  1OXO A;  1WYU A;  2VGZ A;  5LHA A;  1V2D A;  3MAF B;  1X28 A;  3VP6 A;  2ZC0 A;  5EQC A;  2CB1 A;  2JJE A;  4IY7 A;  1ASL A;  4Y0H A;  3QGU A;  2CFB A;  2Z9X A;  2BHX A;  1QIR A;  2VIA A;  5G4I A;  5J8Q A;  3A9Y A;  2YOB A;  4PFF A;  2EPJ A;  2AY1 A;  3QN6 A;  3WLX A;  4F5K A;  1G4X A;  1FG3 A;  2VI8 A;  3BS8 A;  3Q8N A;  1M32 A;  4MQR A;  2D7Y A;  3ELP A;  1H0C A;  4TMR A;  1W7M A;  4ATQ A;  2ZJG A;  5FT8 A;  4WXG A;  4AZJ A;  1ARS A;  2GMU A;  2VMN A;  3MC6 A;  1QIS A;  1CQ7 A;  3GZC A;  1WYV A;  3DXV A;  2E7I A;  2Q7W A;  3CQ4 A;  5DJ1 A;  3T32 A;  3ZRR A;  4NOG A;  4ZDO A;  4E77 A;  4H63 Q;  2HP1 A;  3HQT A;  3GZD A;  4JF1 A;  1TOJ A;  3WY7 A;  4ZDL A;  3WX9 A;  4DQ6 A;  1S06 A;  5K8B A;  1C0N A;  3FRK A;  1S09 A;  5E4Z A;  5G09 A;  4LNM A;  4WP0 A;  2R2N A;  1BJN A;  3PD6 A;  2CJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...