4LW4A

Structural changes during cysteine desulfurase csda and sulfur-acceptor csde interactions provide insight into the trans-persulfuration
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
398
structure length
392
Chain Sequence
VFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATQQFYSLSAGFAEAQRLTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLEAMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHCAQPLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cysteine sulfinate desulfinase
publication title Structural changes during cysteine desulfurase CsdA and sulfur-acceptor CsdE interactions provide insight into the trans-persulfuration.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 137
structure length 392
sequence length 398
chains with identical sequence B
ec nomenclature ec 2.8.1.7: Cysteine desulfurase.
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4lw4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4lw4A01
4EU1A 1S0AA 3A9YA 4ZAHA 1TOIA 4LNJA 1YOOA 2YCPA 4PIWA 2W7HA 4OYTA 1AIBA 3MAFA 1UU1A 4WBTA 5EFSA 4ADDA 8AATA 3LVJA 4JF0A 4A0GA 2Q7WA 2VGZA 1N31A 2AATA 1TOEA 4WYCA 3VK4A 3VOMA 2VI9A 4W1VA 4GE4A 5J8QA 4XEWA 4NOGA 4JEVA 3PDBB 2OKKA 2OATA 3T32A 2JJHA 4MY5A 4RJYA 1QITA 2EZ2A 1ARSA 1BJOB 3HDOA 1CQ7A 1DKAA 3PDBA 4RJ0A 1AICA 3DXVA 2R2NA 4GDYA 4LC3A 4E3QA 5FT6A 1GEWA 1AMRA 1BJOA 2YOBA 2Z61A 3EZSA 3JTXA 1DGEA 4WXGA 3LVKA 5FT4A 4BHDA 1D7VA 2W7MA 3GR9A 2PB2A 5BJ3A 4XJPA 2YKYA 3IF2A 1JF9A 3N0LA 3R9AA 1MDXA 4F5KA 1GDEA 1EJIA 1TPLA 3ECDA 4OMAA 1WKGA 3K7YA 4XJLA 1N2TA 4JE5D 2BI3A 2O1BA 1J04A 2AY4A 4W5KA 4R2NA 3RI6A 4AO9A 1CJ0A 4WD2A 3PD6B 1G4XA 1H0CA 3BWNA 3WKRA 1X28A 1W7LA 1LKCA 1OHYA 1TATA 1SZUA 1LC8A 3ASBA 3PPLA 3PD6A 4O6ZA 2BI9A 4PVFA 3G7QA 4CXQA 1TOGA 1B4XA 2R0TA 1UU2A 4Q75A 1ASEA 2W7LA 1I43A 3R4TA 2VIBA 1E5EA 3UWCA 2YKUA 1G4VA 5M4BA 3QI6A 4IXOA 1O62A 4ZM4A 2BI5A 2E54A 1RVYA 2DGLA 2GMUA 2BWPA 3H7FA 4L0OA 4A6TA 4WP0A 5TF5A 5D5SA 1AHGA 4K2BA 1C7GA 3FZ7A 1FC4A 2W8WA 3FRKA 2JGTA 4RM1A 5G2PA 1MLYA 3EUCA 1GEYA 2AEUA 3I16A 4WYGA 3FFRA 1P3WA 1YNUA 1CZEA 2GMSA 3A9XA 3AATA 2W7EA 4LNLA 3NTJA 5BJ4A 4GE7A 4ITXA 4WYEA 2ZY4A 4FL0A 1M7YA 3JZLA 1LC7A 2ZUKA 2W7DA 4WLJA 4E1OA 3K28A 1Y4IA 1ASBA 1AHEA 3NYUA 4P7YA 2EZ1A 3DRDA 1M4NA 5IWQA 3BN1A 2AY6A 3LVLB 4TV7A 3FZ6A 3EI9A 3QGUA 3P6KA 2Z1ZA 4R8DA 5AX8A 1O69A 1BT4A 2YHKA 3BWOA 3JU7A 4Y0IA 4B9BA 2Z1YA 4A0RA 1V2DA 3DYDA 3FZ8A 3GJUA 3A8UX 1ASGA 4H51A 4R5ZA 2OGEA 4W1XA 3BCXA 5JAYA 2HOYA 3BB8A 2W8JA 3DZZA 4OCAA 1W3UA 1TARA 2HZPA 4JEXA 1FG7A 4GRXA 4BA5A 1BJNA 4TN4A 1C0NA 1GC0A 2VGSA 3QN6A 2HUIA 7AATA 1I41A 4MGRA 4WXFA 5M46A 1AJRA 4B98A 3F6TA 2DKJA 3N75A 3P1TA 5LHAA 4A72A 1FG3A 2D63A 4F5FA 1OATA 5DX5A 2YKXA 1WYUB 3FVXA 1ELUA 2ZY5A 3HMUA 1AAWA 2OQXA 3B1CA 1YJSA 1C7NA 1O4SA 2ZJGA 1AAMA 2YRRA 3BC8A 3LV2A 4IY7A 4J8LA 2CTZA 4EB7A 3E2ZA 4JF1A 3WX9A 2O7CA 1GCKA 1WYUA 3ZZJA 4Y0HA 1AY4A 3TFTA 4RKCA 4IYOB 4F5JA 1MDZA 4MKKA 4BA4A 1M0QA 1ARHA 2D5YA 5I92A 2YCTA 2PB0A 1SPAA 3ELPA 1M0NA 4IYOA 2CSTA 4XJOA 3AEMC 4CXRA 1ASCA 1V72A 3HQTA 3LY1A 2BI1A 1BQDA 2VMSA 1M6SA 1ZODA 2DGKA 3K40A 1UKJA 1B9HA 1KMJA 1YIZA 3AEOA 1PFFA 3JW9A 2ZYJA 4EB5A 3W1HA 4XK1A 4F5GA 1GD9A 1BQAA 2PO3A 4MSOA 5G4JA 3ELEA 2W7FA 3ZZKA 3LWSA 1B5PA 1YJYA 2CJDA 2D66A 3NUBA 4ZDPA 5DB5A 2FNIA 3ZRRA 1H1CA 1Z3ZA 1DTYA 2AY9A 2JJGA 2QBTA 4CBSA 3VAXA 2AY7A 4A00A 2VMVA 2W7GA 1ZC9A 2BIAA 5EIGB 1RVUA 1MLZA 2HOZA 3COGA 4EFFA 5EAVA 2W8TA 1ORDA 3DR7A 1C4KA 2QMAA 3MKJA 2GQNA 1D7SA 5DJ9A 5M49A 5EIGA 1EG5A 1XI9A 4WYAA 4BQ0A 3JWBA 2VLFA 3AEJA 4Q31A 2VGWA 4KXKA 3NRAA 1X0MA 1V2EA 4FFCA 2ZP7A 4OBVA 3FFHA 1Z7DA 1IX8A 2C44A 2D65A 3DXWA 4A6RA 3E2FA 3WGBA 9AATA 1W7NA 3FCRA 1AMAA 1AIAA 4BMKA 4GEBA 4LNMA 3MC6A 4QGRA 2BKWA 2D64A 3FQ8A 4PFFA 2V0YA 3II0A 4JE5A 1ECXA 2BHXA 1IUGA 3HBXA 3KGWA 1B9IA 5EUEA 4F5IA 2VGUA 1OHWA 1LK9A 3ASAA 3B46A 2C81A 3GZDC 4IXSA 4P3MA 1OHVA 3WLXA 1D7UA 3B1EA 3N5MA 3PDXA 4ITGA 2CJHA 4MQPA 5DJ1A 4WXBA 3A2BA 3D6KA 1DFOA 2CB1A 3CQ6A 3FDDA 1AKAA 1IX6A 3FD0A 1S07A 4W1WA 1BJWA 4DQ6A 2HP1A 1KL1A 3AELA 4M2MA 3VP6A 5F9SA 1SVVA 4ADBA 1ASDA 2BWNA 4XQ2A 1RV4A 3L8AA 4ZWVA 4GE9A 3AV7A 1M32A 2AY1A 1J32A 2EO5A 3OP7A 2AY3A 1QJ5A 3WKSA 2Z20A 3CQ5A 1D2FA 4I8AA 1O61A 2R5CB 4WLHA 2ORDA 2X3LA 3KGXA 3FDBA 3H14A 3PJ0A 4AZJA 1M0OA 1JS3A 1KKPA 1WKHA 2R5CA 2RFVA 3FVSA 4IW7A 3TFUA 3FKDA 2JG2A 1AKCA 1GC2A 4RIZA 1YIYA 2VMOA 1G7XA 5EUNA 2Z67A 2VMYA 1ELQA 1BJ4A 3DU4A 5E5IA 2FN6A 3ZRQA 5C6UA 2Z9VA 3Q8NA 4AO4A 1AMSA 2Z9XA 4F5LA 4UHMA 4AOAA 1M0PA 1MDOA 2DGMA 1WYTB 3B1DA 4CBRA 2ZSLA 3CAIA 2ZY2A 1IVRA 4UHNA 2AY2A 4HVKA 3I4JA 2CY8A 1C7OA 1AKBA 1GBNA 3BS8A 3E2YA 3JWAA 1UU0A 3GZCA 1WYTA 1MAQA 1IJIA 2CFBA 4A0HA 3TATA 1DGDA 4IX8A 1IBJA 1GC4A 1VEFA 3G0TA 3RBLA 3GBXA 1CL2A 4ISYA 4ZWMA 4N0BA 2HUFA 3NYTA 1DJ9A 1ASFA 3EI6A 3NUIA 2CANA 1TASA 5K8BA 4ZASA 1C9CA 3NDNA 3PIUA 4M2JA 4AH3A 2WKAA 4MQQA 4ATQA 4F5HA 1AHFA 2HOXA 3BWNC 1ARGA 4MKJA 2YKVA 4W8IA 2Z9UA 3OKSA 1QIRA 4LW4A 2X5FA 1G7WA 1SFFA 1QGNA 3M5UA 3ISLA 2AY5A 3GETA 2VMZA 1VP4A 1AMQA 4WB0B 4EMYA 1YJZA 1X29A 2D7YA 2ZC0A 3E6GA 1YAAA 1AX4A 4RITA 4OBUA 4MQRA 2YCNA 3VK2A 2O0RA 4WB0A 3WGCA 1AY5A 4W91A 1MGVA 4Q76A 4AZKA 5E4ZA 1AY8A 5G2QA 4ZDLA 3WCNA 5M4DA 3BCBA 1V2FA 1WSTA 1EQBA 3RQ1A 4XJMA 5FT8A 2HORA 2BWOA 1KKJA 5G4IA 1QJ3A 3QBOA 1CS1A 2TPLA 2BIGA 3BV0A 2YRIA 3RUYA 3FQAA 4CVQA 2XH1A 4WYFA 3PA9A 4KYOA 3MAUA 1OXOA 4K2IA 2D61A 3QHXA 2QLRA 2HP2A 4R5FA 2CINA 2DOUA 5EAAA 3NYSA 3HVYA 4OT8A 3RBFA 3UAKA 3F0HA 1W7MA 5G0AA 3MBBA 3QPGA 2BYLA 2FM1A 2JJEA 3EI8A 3B8XA 1S06A 3DR4A 4HF8A 4ZLVA 2BI2A 4WYDA 1ASMA 2G6WA 1D7RA 2CH2A 3WY7A 3PGYA 4RKDA 4M2KA 3MADA 4UHOA 5EQCA 1I48A 2VMRA 1BW0A 4UQVA 4ZSYA 2ZY3A 1CQ6A 3E77A 3E9KA 3A9ZA 3EI5A 1ZOBA 1SF2A 1VJOA 1T3IA 2OGAA 2OKJA 3AOVA 1ASLA 4N0WA 1I29A 3BCAA 2F8JA 2FNUA 4K2MA 1BKGA 3NU8A 4DBCA 2Z9WA 2EPJA 1W23A 1RV3A 3PAAA 3EZ1A 1LW4A 1CZCA 2BIEA 2QA3A 1IAXA 1CQ8A 1PMOA 1PMMA 2E7JA 3FQ7A 4KAMA 1IX7A 4JEYA 2VMQA 4IXZA 2VMWA 3EI7A 2ZSMA 1BS0A 2VI8A 2W7JA 2X5DA 4GSAA 4E3RA 1B5OA 1GC3A 4E77A 3AENB 2DR1A 3CQ4A 2W8VA 3ATHA 3DC1A 4Y0DA 2EH6A 2GB3A 5HDMA 3AENA 3FSLA 2C0RA 3L44A 3RCHB 1DJUA 3KE3A 2VGTA 1GEXA 1S09A 3UE8A 1QZ9A 1ASNA 2QB2A 1ARTA 3G8MA 3NU7A 4ZM3A 3MEBA 3I5TA 1OXPA 2FYFA 3NNKA 3RCHA 1JG8A 1XEYA 2VGVA 4U1TA 3AEMA 1AHYA 1JS6A 5HXXA 5D95A 2VIAA 3ACZA 5FT5A 4Q6RA 2VMXA 3DODA 1LW5A 1LC5A 5E3KA 4ZSWA 3TQXA 3FVUA 1PG8A 3W1IA 4TMRA 1KL2A 3LVMA 1MAPA 2VLHA 5G09A 2NMPA 4JEWA 4F4EA 5F8VA 2AY8A 2AEVA 5HHYA 2CH1A 3HLMA 4JEZA 2E7UA 2QB3A 3AEJC 2JISA 3ZRPA 4PFNA 1SZKA 4F5MA 4ZDOA 2XBNA 4A6UA 1TOKA 2X8UA 3AOWA 4UOYA 2VYCA 3WZFA 1B8GA 1CL1A 1AJSB 4RAEA 3NX3A 2DKBA 3LG0A 3MC6C 2VMUA 3EIAA 5EUDA 1AJSA 3CBFA 3IHJA 3GWPA 4ATPA 4RLGA 3HT4A 4OC9A 3VK3A 3QM2A 1KMKA 3FTBA 1X2AA 2R5EA 3AEPA 2CJGA 2VMPA 1N8PA 1WYVB 1LS3A 1ARIA 2V1PA 1TOJA 1SZSA 4U2HA 2C7TA 2VMTA 4DGTA 1DJEA 2HUUA 3F9TA 1WYVA 2WK8A 3E2ZB 2GSAA 3GZDA 2JJFA 3W1JA 4J5UA 1QISA 3USFA 1AHXA 3KKIA 4XAUA 2D7ZA 2E7IA 1S08A 3EIBA 1U08A 2W7KA 2WK7A 3WCOA 2BYJA 3GSBA 2W7IA 5LH9A 4LW2A 2VMNA 2EGYA 1ASAA 2W8UA 1IAYA 4A0FA 4ADEA 3TCMA 2WK9A 3HL2A 4ADCA 2FQ6A 4OTLA 1E5FA 3MAFB
chains in the Genus database with same CATH superfamily
4EU1A 1S0AA 3A9YA 4ZAHA 1TOIA 4LNJA 1YOOA 2YCPA 4PIWA 2W7HA 4OYTA 1AIBA 3MAFA 4H63Q 1UU1A 4WBTA 5EFSA 4ADDA 8AATA 3LVJA 4JF0A 4A0GA 2Q7WA 2VGZA 1N31A 2AATA 1TOEA 4WYCA 3VK4A 3VOMA 2VI9A 4W1VA 4GE4A 5J8QA 4XEWA 4NOGA 4JEVA 3PDBB 2OKKA 2OATA 3T32A 2JJHA 4MY5A 4RJYA 1QITA 2EZ2A 1ARSA 1BJOB 3HDOA 1CQ7A 1DKAA 3PDBA 4RJ0A 1AICA 3DXVA 2R2NA 4GDYA 4LC3A 4E3QA 5FT6A 1GEWA 1AMRA 1BJOA 2YOBA 3N4SA 2Z61A 3EZSA 3JTXA 1DGEA 4WXGA 3LVKA 5FT4A 4BHDA 1D7VA 2W7MA 3GR9A 2PB2A 5BJ3A 2EYQA 4XJPA 2YKYA 3IF2A 1JF9A 3N0LA 3R9AA 1MDXA 4F5KA 1GDEA 1EJIA 1TPLA 3ECDA 4OMAA 1WKGA 3K7YA 4XJLA 1N2TA 4JE5D 2BI3A 2O1BA 1J04A 2AY4A 4W5KA 4R2NA 3RI6A 4AO9A 1CJ0A 4WD2A 3PD6B 1G4XA 1H0CA 3BWNA 3WKRA 1X28A 1W7LA 1LKCA 1OHYA 1TATA 1SZUA 1LC8A 3ASBA 3PPLA 3PD6A 4O6ZA 2BI9A 4PVFA 3G7QA 4CXQA 1TOGA 1B4XA 2R0TA 1UU2A 4Q75A 1ASEA 2W7LA 1I43A 3R4TA 2VIBA 1E5EA 3UWCA 2YKUA 1G4VA 5M4BA 3QI6A 4IXOA 1O62A 4ZM4A 2BI5A 2E54A 1RVYA 2DGLA 2GMUA 2BWPA 3H7FA 4L0OA 4A6TA 4WP0A 5TF5A 5D5SA 1AHGA 4K2BA 1C7GA 3FZ7A 1FC4A 2W8WA 3FRKA 2JGTA 4RM1A 5G2PA 1MLYA 3EUCA 1GEYA 2AEUA 3I16A 4WYGA 3FFRA 1P3WA 1YNUA 1CZEA 2GMSA 3A9XA 3AATA 2W7EA 4LNLA 3NTJA 5BJ4A 4GE7A 4ITXA 4WYEA 2ZY4A 4FL0A 1M7YA 3JZLA 1LC7A 2ZUKA 2W7DA 4WLJA 4E1OA 3K28A 1Y4IA 1ASBA 1AHEA 3NYUA 2QSRA 4P7YA 2EZ1A 3DRDA 1M4NA 5IWQA 3BN1A 2AY6A 3LVLB 3N4XA 4TV7A 3FZ6A 3EI9A 3QGUA 2FKIA 3P6KA 2Z1ZA 4R8DA 5AX8A 1O69A 1BT4A 2YHKA 3BWOA 3JU7A 4Y0IA 4B9BA 2Z1YA 4A0RA 1V2DA 3DYDA 3FZ8A 3GJUA 3A8UX 1ASGA 4H51A 4R5ZA 2OGEA 4W1XA 3BCXA 5JAYA 2HOYA 3BB8A 2W8JA 3DZZA 4OCAA 1W3UA 1TARA 2HZPA 4JEXA 1FG7A 4GRXA 4BA5A 1BJNA 4TN4A 1C0NA 1GC0A 2VGSA 3QN6A 2HUIA 7AATA 1I41A 3H9XA 4MGRA 4WXFA 5M46A 1AJRA 4B98A 3F6TA 2DKJA 3N75A 3P1TA 5LHAA 4A72A 1FG3A 2D63A 4F5FA 1OATA 5DX5A 2YKXA 1WYUB 3FVXA 1ELUA 2ZY5A 3HMUA 1AAWA 2OQXA 3B1CA 1YJSA 1C7NA 1O4SA 2ZJGA 1AAMA 2YRRA 3BC8A 3LV2A 4IY7A 4J8LA 2CTZA 4EB7A 3E2ZA 4JF1A 3WX9A 2O7CA 1GCKA 1WYUA 3ZZJA 4Y0HA 1AY4A 3TFTA 4RKCA 4IYOB 4F5JA 1MDZA 4MKKA 4BA4A 1M0QA 1ARHA 2D5YA 5I92A 2YCTA 2PB0A 1SPAA 3ELPA 1M0NA 4IYOA 2CSTA 4XJOA 3AEMC 4CXRA 1ASCA 1V72A 3HQTA 3LY1A 2BI1A 1BQDA 2VMSA 1M6SA 1ZODA 2DGKA 3K40A 1UKJA 4K05A 1B9HA 1KMJA 1YIZA 3AEOA 1PFFA 3JW9A 2ZYJA 4EB5A 3W1HA 4XK1A 4F5GA 1GD9A 1BQAA 2PO3A 4MSOA 5G4JA 3ELEA 2W7FA 3ZZKA 3LWSA 1B5PA 1YJYA 2CJDA 2D66A 3NUBA 4ZDPA 5DB5A 2FNIA 3ZRRA 1H1CA 1Z3ZA 1DTYA 2AY9A 2JJGA 2QBTA 2A1VA 4CBSA 3VAXA 2AY7A 4A00A 2VMVA 2W7GA 1ZC9A 2BIAA 5EIGB 1RVUA 1MLZA 2HOZA 3COGA 4EFFA 5EAVA 2W8TA 1ORDA 3DR7A 1C4KA 2QMAA 3MKJA 2GQNA 1D7SA 5DJ9A 5M49A 5EIGA 1EG5A 1XI9A 4WYAA 4BQ0A 3JWBA 2VLFA 3AEJA 4Q31A 2VGWA 4KXKA 3NRAA 1X0MA 1V2EA 4FFCA 2ZP7A 4OBVA 3FFHA 1Z7DA 1IX8A 2C44A 2D65A 3DXWA 4A6RA 3E2FA 3WGBA 9AATA 1W7NA 3FCRA 1AMAA 1AIAA 4BMKA 4GEBA 4LNMA 3MC6A 4QGRA 2BKWA 2D64A 3FQ8A 4PFFA 3N4RA 2V0YA 3II0A 4JE5A 1ECXA 2BHXA 1IUGA 3HBXA 3KGWA 1B9IA 5EUEA 4F5IA 2VGUA 1OHWA 1LK9A 3ASAA 3B46A 2C81A 3GZDC 4IXSA 4P3MA 1OHVA 3WLXA 1D7UA 3B1EA 3N5MA 3PDXA 4ITGA 2CJHA 4MQPA 5DJ1A 4WXBA 3A2BA 3D6KA 1DFOA 2CB1A 3CQ6A 3FDDA 1AKAA 1IX6A 3FD0A 1S07A 4W1WA 1BJWA 4DQ6A 2HP1A 1KL1A 3AELA 4M2MA 3VP6A 5F9SA 1SVVA 4ADBA 1ASDA 2BWNA 4XQ2A 1RV4A 3L8AA 4ZWVA 4GE9A 3AV7A 1M32A 2AY1A 1J32A 2EO5A 3OP7A 2AY3A 1QJ5A 3WKSA 2Z20A 3CQ5A 1D2FA 4I8AA 1O61A 2R5CB 4WLHA 2KFPA 2ORDA 2X3LA 3KGXA 3FDBA 3H14A 3PJ0A 4AZJA 1KAFA 1M0OA 1JS3A 1KKPA 1WKHA 2R5CA 2RFVA 3FVSA 4IW7A 3TFUA 3FKDA 2JG2A 1AKCA 1GC2A 4RIZA 1YIYA 2VMOA 1G7XA 5EUNA 2Z67A 2VMYA 1ELQA 1BJ4A 3DU4A 5E5IA 2FN6A 3ZRQA 5C6UA 2Z9VA 3Q8NA 4AO4A 1AMSA 2Z9XA 4F5LA 4UHMA 4AOAA 1M0PA 1MDOA 2DGMA 1WYTB 3B1DA 4CBRA 2ZSLA 3CAIA 2ZY2A 1IVRA 4UHNA 2AY2A 4HVKA 3I4JA 2CY8A 1C7OA 1AKBA 1GBNA 3BS8A 3E2YA 3JWAA 1UU0A 3GZCA 1WYTA 1MAQA 1IJIA 2CFBA 4A0HA 3TATA 1DGDA 4IX8A 1IBJA 1GC4A 1VEFA 3G0TA 3RBLA 3GBXA 1CL2A 4ISYA 4ZWMA 4N0BA 2HUFA 3NYTA 1DJ9A 1ASFA 3EI6A 3NUIA 2CANA 1TASA 5K8BA 4ZASA 1C9CA 3NDNA 3PIUA 4M2JA 4AH3A 2WKAA 4MQQA 4ATQA 4F5HA 1AHFA 2HOXA 3BWNC 1ARGA 4MKJA 2YKVA 4W8IA 2Z9UA 3OKSA 1QIRA 4LW4A 2X5FA 1G7WA 1SFFA 1QGNA 3M5UA 3ISLA 2AY5A 3GETA 2VMZA 1VP4A 1AMQA 4WB0B 4EMYA 1YJZA 1X29A 2D7YA 2ZC0A 3E6GA 1YAAA 1AX4A 4RITA 4OBUA 4MQRA 2YCNA 3VK2A 2O0RA 4WB0A 3WGCA 1AY5A 4W91A 1MGVA 4Q76A 4AZKA 5E4ZA 1AY8A 5G2QA 4ZDLA 3WCNA 5M4DA 3BCBA 1V2FA 1WSTA 1EQBA 3RQ1A 4XJMA 5FT8A 2HORA 2BWOA 1KKJA 5G4IA 1QJ3A 3QBOA 1CS1A 2TPLA 2BIGA 3BV0A 2YRIA 3RUYA 3FQAA 4CVQA 2XH1A 4WYFA 3PA9A 4KYOA 3MAUA 1OXOA 4K2IA 2D61A 3QHXA 2QLRA 2HP2A 4R5FA 2CINA 2DOUA 5EAAA 3NYSA 3HVYA 4OT8A 3RBFA 3UAKA 3F0HA 1W7MA 5G0AA 3MBBA 3QPGA 2BYLA 2FM1A 2JJEA 3EI8A 3B8XA 1S06A 3DR4A 4HF8A 4ZLVA 2BI2A 4WYDA 1ASMA 2G6WA 1D7RA 2CH2A 3WY7A 3PGYA 4RKDA 4M2KA 3MADA 4UHOA 5EQCA 1I48A 2VMRA 1BW0A 4UQVA 4ZSYA 2ZY3A 1CQ6A 3E77A 3E9KA 3A9ZA 3EI5A 1ZOBA 1SF2A 1VJOA 1T3IA 2OGAA 2OKJA 3AOVA 1ASLA 4N0WA 1I29A 3BCAA 2F8JA 2FNUA 4K2MA 1BKGA 3NU8A 4DBCA 2Z9WA 2EPJA 1W23A 1RV3A 3PAAA 5KTBA 3EZ1A 1LW4A 1CZCA 2BIEA 2QA3A 1IAXA 1CQ8A 1PMOA 1PMMA 2E7JA 3FQ7A 4KAMA 1IX7A 4JEYA 2VMQA 4IXZA 2VMWA 3EI7A 2ZSMA 1BS0A 2VI8A 2W7JA 2X5DA 4GSAA 4E3RA 1B5OA 1GC3A 4E77A 3AENB 2DR1A 3CQ4A 2W8VA 3ATHA 3DC1A 4Y0DA 2EH6A 2GB3A 5HDMA 3N7NA 3AENA 3FSLA 2C0RA 3L44A 2G7JA 3RCHB 1DJUA 3KE3A 2VGTA 1GEXA 1S09A 3UE8A 1QZ9A 1ASNA 2QB2A 1ARTA 3G8MA 3NU7A 2WB6A 4ZM3A 3MEBA 3I5TA 1OXPA 2FYFA 3NNKA 3RCHA 1JG8A 1XEYA 2VGVA 4U1TA 3AEMA 1AHYA 1JS6A 5HXXA 5D95A 2VIAA 3ACZA 5FT5A 4Q6RA 2VMXA 3DODA 1LW5A 1LC5A 5E3KA 4ZSWA 3TQXA 3FVUA 1PG8A 3W1IA 4TMRA 1KL2A 3LVMA 1MAPA 2VLHA 5G09A 2NMPA 4JEWA 4F4EA 5F8VA 2AY8A 2AEVA 5HHYA 2CH1A 3HLMA 4JEZA 2E7UA 2QB3A 3AEJC 2JISA 3ZRPA 4PFNA 1SZKA 4F5MA 4ZDOA 2XBNA 4A6UA 1TOKA 2X8UA 3AOWA 4UOYA 2VYCA 3WZFA 1B8GA 1CL1A 1AJSB 4RAEA 3NX3A 2DKBA 3LG0A 3MC6C 2VMUA 3EIAA 5EUDA 1AJSA 3CBFA 3IHJA 3GWPA 4ATPA 4RLGA 3HT4A 4OC9A 3VK3A 3QM2A 1KMKA 3FTBA 1X2AA 2R5EA 3AEPA 2CJGA 2VMPA 1N8PA 1WYVB 1LS3A 1ARIA 2V1PA 1TOJA 1SZSA 4U2HA 2C7TA 2VMTA 4DGTA 1DJEA 2HUUA 3F9TA 1WYVA 2WK8A 3E2ZB 2GSAA 3GZDA 2JJFA 3W1JA 4J5UA 1QISA 3USFA 1AHXA 3KKIA 4XAUA 2D7ZA 2E7IA 1S08A 3EIBA 1U08A 2W7KA 2WK7A 3WCOA 2BYJA 3GSBA 2W7IA 5LH9A 4LW2A 2VMNA 2EGYA 1ASAA 2W8UA 1IAYA 4A0FA 4ADEA 3TCMA 2WK9A 3HL2A 4ADCA 2FQ6A 4OTLA 1E5FA 3MAFB
chains in the Genus database with same CATH topology
4EU1A 1S0AA 3A9YA 4ZAHA 1TOIA 4LNJA 1YOOA 2YCPA 4PIWA 2W7HA 4OYTA 1AIBA 3MAFA 4H63Q 1UU1A 4WBTA 5EFSA 4ADDA 8AATA 3LVJA 4JF0A 4A0GA 2Q7WA 2VGZA 1N31A 2AATA 1TOEA 4WYCA 3VK4A 3VOMA 2VI9A 4W1VA 4GE4A 5J8QA 4XEWA 4NOGA 4JEVA 3PDBB 2OKKA 2OATA 3T32A 2JJHA 4MY5A 4RJYA 1QITA 2EZ2A 1ARSA 1BJOB 3HDOA 1CQ7A 1DKAA 3PDBA 4RJ0A 1AICA 3DXVA 2R2NA 4GDYA 4LC3A 4E3QA 5FT6A 1GEWA 1AMRA 1BJOA 2YOBA 3N4SA 2Z61A 3EZSA 3JTXA 1DGEA 4WXGA 3LVKA 5FT4A 4BHDA 1D7VA 2W7MA 3GR9A 2PB2A 5BJ3A 2EYQA 4XJPA 2YKYA 3IF2A 1JF9A 3N0LA 3R9AA 1MDXA 4F5KA 1GDEA 1EJIA 1TPLA 3ECDA 4OMAA 1WKGA 3K7YA 4XJLA 1N2TA 4JE5D 2BI3A 2O1BA 1J04A 2AY4A 4W5KA 4R2NA 3RI6A 4AO9A 1CJ0A 4WD2A 3PD6B 1G4XA 1H0CA 3BWNA 3WKRA 1X28A 1W7LA 1LKCA 1OHYA 1TATA 1SZUA 1LC8A 3ASBA 3PPLA 3PD6A 4O6ZA 2BI9A 4PVFA 3G7QA 4CXQA 1TOGA 1B4XA 2R0TA 1UU2A 4Q75A 1ASEA 2W7LA 1I43A 3R4TA 2VIBA 1E5EA 3UWCA 2YKUA 1G4VA 5M4BA 3QI6A 4IXOA 1O62A 4ZM4A 2BI5A 2E54A 1RVYA 2DGLA 2GMUA 2BWPA 3H7FA 4L0OA 4A6TA 4WP0A 5TF5A 5D5SA 1AHGA 4K2BA 1C7GA 3FZ7A 1FC4A 2W8WA 3FRKA 2JGTA 4RM1A 5G2PA 1MLYA 3EUCA 1GEYA 2AEUA 3I16A 4WYGA 3FFRA 1P3WA 1YNUA 1CZEA 2GMSA 3A9XA 3AATA 2W7EA 4LNLA 3NTJA 5BJ4A 4GE7A 4ITXA 4WYEA 2ZY4A 4FL0A 1M7YA 3JZLA 1LC7A 2ZUKA 2W7DA 4WLJA 4E1OA 3K28A 1Y4IA 1ASBA 1AHEA 3NYUA 2QSRA 4P7YA 2EZ1A 3DRDA 1M4NA 5IWQA 3BN1A 2AY6A 3LVLB 3N4XA 4TV7A 3FZ6A 3EI9A 3QGUA 2FKIA 3P6KA 2Z1ZA 4R8DA 5AX8A 1O69A 1BT4A 2YHKA 3BWOA 3JU7A 4Y0IA 4B9BA 2Z1YA 4A0RA 1V2DA 3DYDA 3FZ8A 3GJUA 3A8UX 1ASGA 4H51A 4R5ZA 2OGEA 4W1XA 3BCXA 5JAYA 2HOYA 3BB8A 2W8JA 3DZZA 4OCAA 1W3UA 1TARA 2HZPA 4JEXA 1FG7A 4GRXA 4BA5A 1BJNA 4TN4A 1C0NA 1GC0A 2VGSA 3QN6A 2HUIA 7AATA 1I41A 3H9XA 4MGRA 4WXFA 5M46A 1AJRA 4B98A 3F6TA 2DKJA 3N75A 3P1TA 5LHAA 4A72A 1FG3A 2D63A 4F5FA 1OATA 5DX5A 2YKXA 1WYUB 3FVXA 1ELUA 2ZY5A 3HMUA 1AAWA 2OQXA 3B1CA 1YJSA 1C7NA 1O4SA 2ZJGA 1AAMA 2YRRA 3BC8A 3LV2A 4IY7A 4J8LA 2CTZA 4EB7A 3E2ZA 4JF1A 3WX9A 2O7CA 1GCKA 1WYUA 3ZZJA 4Y0HA 1AY4A 3TFTA 4RKCA 4IYOB 4F5JA 1MDZA 4MKKA 4BA4A 1M0QA 1ARHA 2D5YA 5I92A 2YCTA 2PB0A 1SPAA 3ELPA 1M0NA 4IYOA 2CSTA 4XJOA 3AEMC 4CXRA 1ASCA 1V72A 3HQTA 3LY1A 2BI1A 1BQDA 2VMSA 1M6SA 1ZODA 2DGKA 3K40A 1UKJA 4K05A 1B9HA 1KMJA 1YIZA 3AEOA 1PFFA 3JW9A 2ZYJA 4EB5A 3W1HA 4XK1A 4F5GA 1GD9A 1BQAA 2PO3A 4MSOA 5G4JA 3ELEA 2W7FA 3ZZKA 3LWSA 1B5PA 1YJYA 2CJDA 2D66A 3NUBA 4ZDPA 5DB5A 2FNIA 3ZRRA 1H1CA 1Z3ZA 1DTYA 2AY9A 2JJGA 2QBTA 2A1VA 4CBSA 3VAXA 2AY7A 4A00A 2VMVA 2W7GA 1ZC9A 2BIAA 5EIGB 1RVUA 1MLZA 2HOZA 3COGA 4EFFA 5EAVA 2W8TA 1ORDA 3DR7A 1C4KA 2QMAA 3MKJA 2GQNA 1D7SA 5DJ9A 5M49A 5EIGA 1EG5A 1XI9A 4WYAA 4BQ0A 3JWBA 2VLFA 3AEJA 4Q31A 2VGWA 4KXKA 3NRAA 1X0MA 1V2EA 4FFCA 2ZP7A 4OBVA 3FFHA 1Z7DA 1IX8A 2C44A 2D65A 3DXWA 4A6RA 3E2FA 3WGBA 9AATA 1W7NA 3FCRA 1AMAA 1AIAA 4BMKA 4GEBA 4LNMA 3MC6A 4QGRA 2BKWA 2D64A 3FQ8A 4PFFA 3N4RA 2V0YA 3II0A 4JE5A 1ECXA 2BHXA 1IUGA 3HBXA 3KGWA 1B9IA 5EUEA 4F5IA 2VGUA 1OHWA 1LK9A 3ASAA 3B46A 2C81A 3GZDC 4IXSA 4P3MA 1OHVA 3WLXA 1D7UA 3B1EA 3N5MA 3PDXA 4ITGA 2CJHA 4MQPA 5DJ1A 4WXBA 3A2BA 3D6KA 1DFOA 2CB1A 3CQ6A 3FDDA 1AKAA 1IX6A 3FD0A 1S07A 4W1WA 1BJWA 4DQ6A 2HP1A 1KL1A 3AELA 4M2MA 3VP6A 5F9SA 1SVVA 4ADBA 1ASDA 2BWNA 4XQ2A 1RV4A 3L8AA 4ZWVA 4GE9A 3AV7A 1M32A 2AY1A 1J32A 2EO5A 3OP7A 2AY3A 1QJ5A 3WKSA 2Z20A 3CQ5A 1D2FA 4I8AA 1O61A 2R5CB 4WLHA 2KFPA 2ORDA 2X3LA 3KGXA 3FDBA 3H14A 3PJ0A 4AZJA 1M0OA 1JS3A 1KKPA 1WKHA 2R5CA 2RFVA 3FVSA 4IW7A 3TFUA 3FKDA 2JG2A 1AKCA 1GC2A 4RIZA 1YIYA 2VMOA 1G7XA 5EUNA 2Z67A 2VMYA 1ELQA 1BJ4A 3DU4A 5E5IA 2FN6A 3ZRQA 5C6UA 2Z9VA 3Q8NA 4AO4A 1AMSA 2Z9XA 4F5LA 4UHMA 4AOAA 1M0PA 1MDOA 2DGMA 1WYTB 3B1DA 4CBRA 2ZSLA 3CAIA 2ZY2A 1IVRA 4UHNA 2AY2A 4HVKA 3I4JA 2CY8A 1C7OA 1AKBA 1GBNA 3BS8A 3E2YA 3JWAA 1UU0A 3GZCA 1WYTA 1MAQA 1IJIA 2CFBA 4A0HA 3TATA 1DGDA 4IX8A 1IBJA 1GC4A 1VEFA 3G0TA 3RBLA 3GBXA 1CL2A 4ISYA 4ZWMA 4N0BA 2HUFA 3NYTA 1DJ9A 1ASFA 3EI6A 3NUIA 2CANA 1TASA 5K8BA 4ZASA 1C9CA 3NDNA 3PIUA 4M2JA 4AH3A 2WKAA 4MQQA 4ATQA 4F5HA 1AHFA 2HOXA 3BWNC 1ARGA 4MKJA 2YKVA 4W8IA 2Z9UA 3OKSA 1QIRA 4LW4A 2X5FA 1G7WA 1SFFA 1QGNA 3M5UA 3ISLA 2AY5A 3GETA 2VMZA 1VP4A 1AMQA 4WB0B 4EMYA 1YJZA 1X29A 2D7YA 2ZC0A 3E6GA 1YAAA 1AX4A 4RITA 4OBUA 4MQRA 2YCNA 3VK2A 2O0RA 4WB0A 3WGCA 1AY5A 4W91A 1MGVA 4Q76A 4AZKA 5E4ZA 1AY8A 5G2QA 4ZDLA 3WCNA 5M4DA 3BCBA 1V2FA 1WSTA 1EQBA 3RQ1A 4XJMA 5FT8A 2HORA 2BWOA 1KKJA 5G4IA 1QJ3A 3QBOA 1CS1A 2TPLA 2BIGA 3BV0A 2YRIA 3RUYA 3FQAA 4CVQA 2XH1A 4WYFA 3PA9A 4KYOA 3MAUA 1OXOA 4K2IA 2D61A 3QHXA 2QLRA 2HP2A 4R5FA 2CINA 2DOUA 5EAAA 3NYSA 3HVYA 4OT8A 3RBFA 3UAKA 3F0HA 1W7MA 5G0AA 3MBBA 3QPGA 2BYLA 2FM1A 2JJEA 3EI8A 3B8XA 1S06A 3DR4A 4HF8A 4ZLVA 2BI2A 4WYDA 1ASMA 2G6WA 1D7RA 2CH2A 3WY7A 3PGYA 4RKDA 4M2KA 3MADA 4UHOA 5EQCA 1I48A 2VMRA 1BW0A 4UQVA 4ZSYA 2ZY3A 1CQ6A 3E77A 3E9KA 3A9ZA 3EI5A 1ZOBA 1SF2A 1VJOA 1T3IA 2OGAA 2OKJA 3AOVA 1ASLA 4N0WA 1I29A 3BCAA 2F8JA 2FNUA 4K2MA 1BKGA 3NU8A 4DBCA 2Z9WA 2EPJA 1W23A 1RV3A 3PAAA 5KTBA 3EZ1A 1LW4A 1CZCA 2BIEA 2QA3A 1IAXA 1CQ8A 1PMOA 1PMMA 2E7JA 3FQ7A 4KAMA 1IX7A 4JEYA 2VMQA 4IXZA 2VMWA 3EI7A 2ZSMA 1BS0A 2VI8A 2W7JA 2X5DA 4GSAA 4E3RA 1B5OA 1GC3A 4E77A 3AENB 2DR1A 3CQ4A 2W8VA 3ATHA 3DC1A 4Y0DA 2EH6A 2GB3A 5HDMA 3N7NA 3AENA 3FSLA 2C0RA 3L44A 2G7JA 3RCHB 1DJUA 3KE3A 2VGTA 1GEXA 1S09A 3UE8A 1QZ9A 1ASNA 2QB2A 1ARTA 3G8MA 3NU7A 2WB6A 4ZM3A 3MEBA 3I5TA 1OXPA 2FYFA 3NNKA 3RCHA 1JG8A 1XEYA 2VGVA 4U1TA 3AEMA 1AHYA 1JS6A 5HXXA 5D95A 2VIAA 3ACZA 5FT5A 4Q6RA 2VMXA 3DODA 1LW5A 1LC5A 5E3KA 4ZSWA 3TQXA 3FVUA 1PG8A 3W1IA 4TMRA 1KL2A 3LVMA 1MAPA 2VLHA 5G09A 2NMPA 4JEWA 4F4EA 5F8VA 2AY8A 2AEVA 5HHYA 2CH1A 3HLMA 4JEZA 2E7UA 2QB3A 3AEJC 2JISA 3ZRPA 4PFNA 1SZKA 4F5MA 4ZDOA 2XBNA 4A6UA 1TOKA 2X8UA 3AOWA 4UOYA 2VYCA 3WZFA 1B8GA 1CL1A 1AJSB 4RAEA 3NX3A 2DKBA 3LG0A 3MC6C 2VMUA 3EIAA 5EUDA 1AJSA 3CBFA 3IHJA 3GWPA 4ATPA 4RLGA 3HT4A 4OC9A 3VK3A 3QM2A 1KMKA 3FTBA 1X2AA 2R5EA 3AEPA 2CJGA 2VMPA 1N8PA 1WYVB 1LS3A 1ARIA 2V1PA 1TOJA 1SZSA 4U2HA 2C7TA 2VMTA 4DGTA 1DJEA 2HUUA 3F9TA 1WYVA 2WK8A 3E2ZB 2GSAA 3GZDA 2JJFA 3W1JA 4J5UA 1QISA 3USFA 1AHXA 3KKIA 4XAUA 2D7ZA 2E7IA 1S08A 3EIBA 1U08A 2W7KA 2WK7A 3WCOA 2BYJA 3GSBA 2W7IA 5LH9A 4LW2A 2VMNA 2EGYA 1ASAA 2W8UA 1IAYA 4A0FA 4ADEA 3TCMA 2WK9A 3HL2A 4ADCA 2FQ6A 4OTLA 1E5FA 3MAFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EU1 A;  1S0A A;  3A9Y A;  4ZAH A;  1TOI A;  4LNJ A;  1YOO A;  2YCP A;  4PIW A;  2W7H A;  4OYT A;  1AIB A;  3MAF A;  1UU1 A;  4WBT A;  5EFS A;  4ADD A;  8AAT A;  3LVJ A;  4JF0 A;  4A0G A;  2Q7W A;  2VGZ A;  1N31 A;  2AAT A;  1TOE A;  4WYC A;  3VK4 A;  3VOM A;  2VI9 A;  4W1V A;  4GE4 A;  5J8Q A;  4XEW A;  4NOG A;  4JEV A;  3PDB B;  2OKK A;  2OAT A;  3T32 A;  2JJH A;  4MY5 A;  4RJY A;  1QIT A;  2EZ2 A;  1ARS A;  1BJO B;  3HDO A;  1CQ7 A;  1DKA A;  3PDB A;  4RJ0 A;  1AIC A;  3DXV A;  2R2N A;  4GDY A;  4LC3 A;  4E3Q A;  5FT6 A;  1GEW A;  1AMR A;  1BJO A;  2YOB A;  2Z61 A;  3EZS A;  3JTX A;  1DGE A;  4WXG A;  3LVK A;  5FT4 A;  4BHD A;  1D7V A;  2W7M A;  3GR9 A;  2PB2 A;  5BJ3 A;  4XJP A;  2YKY A;  3IF2 A;  1JF9 A;  3N0L A;  3R9A A;  1MDX A;  4F5K A;  1GDE A;  1EJI A;  1TPL A;  3ECD A;  4OMA A;  1WKG A;  3K7Y A;  4XJL A;  1N2T A;  4JE5 D;  2BI3 A;  2O1B A;  1J04 A;  2AY4 A;  4W5K A;  4R2N A;  3RI6 A;  4AO9 A;  1CJ0 A;  4WD2 A;  3PD6 B;  1G4X A;  1H0C A;  3BWN A;  3WKR A;  1X28 A;  1W7L A;  1LKC A;  1OHY A;  1TAT A;  1SZU A;  1LC8 A;  3ASB A;  3PPL A;  3PD6 A;  4O6Z A;  2BI9 A;  4PVF A;  3G7Q A;  4CXQ A;  1TOG A;  1B4X A;  2R0T A;  1UU2 A;  4Q75 A;  1ASE A;  2W7L A;  1I43 A;  3R4T A;  2VIB A;  1E5E A;  3UWC A;  2YKU A;  1G4V A;  5M4B A;  3QI6 A;  4IXO A;  1O62 A;  4ZM4 A;  2BI5 A;  2E54 A;  1RVY A;  2DGL A;  2GMU A;  2BWP A;  3H7F A;  4L0O A;  4A6T A;  4WP0 A;  5TF5 A;  5D5S A;  1AHG A;  4K2B A;  1C7G A;  3FZ7 A;  1FC4 A;  2W8W A;  3FRK A;  2JGT A;  4RM1 A;  5G2P A;  1MLY A;  3EUC A;  1GEY A;  2AEU A;  3I16 A;  4WYG A;  3FFR A;  1P3W A;  1YNU A;  1CZE A;  2GMS A;  3A9X A;  3AAT A;  2W7E A;  4LNL A;  3NTJ A;  5BJ4 A;  4GE7 A;  4ITX A;  4WYE A;  2ZY4 A;  4FL0 A;  1M7Y A;  3JZL A;  1LC7 A;  2ZUK A;  2W7D A;  4WLJ A;  4E1O A;  3K28 A;  1Y4I A;  1ASB A;  1AHE A;  3NYU A;  4P7Y A;  2EZ1 A;  3DRD A;  1M4N A;  5IWQ A;  3BN1 A;  2AY6 A;  3LVL B;  4TV7 A;  3FZ6 A;  3EI9 A;  3QGU A;  3P6K A;  2Z1Z A;  4R8D A;  5AX8 A;  1O69 A;  1BT4 A;  2YHK A;  3BWO A;  3JU7 A;  4Y0I A;  4B9B A;  2Z1Y A;  4A0R A;  1V2D A;  3DYD A;  3FZ8 A;  3GJU A;  3A8U X;  1ASG A;  4H51 A;  4R5Z A;  2OGE A;  4W1X A;  3BCX A;  5JAY A;  2HOY A;  3BB8 A;  2W8J A;  3DZZ A;  4OCA A;  1W3U A;  1TAR A;  2HZP A;  4JEX A;  1FG7 A;  4GRX A;  4BA5 A;  1BJN A;  4TN4 A;  1C0N A;  1GC0 A;  2VGS A;  3QN6 A;  2HUI A;  7AAT A;  1I41 A;  4MGR A;  4WXF A;  5M46 A;  1AJR A;  4B98 A;  3F6T A;  2DKJ A;  3N75 A;  3P1T A;  5LHA A;  4A72 A;  1FG3 A;  2D63 A;  4F5F A;  1OAT A;  5DX5 A;  2YKX A;  1WYU B;  3FVX A;  1ELU A;  2ZY5 A;  3HMU A;  1AAW A;  2OQX A;  3B1C A;  1YJS A;  1C7N A;  1O4S A;  2ZJG A;  1AAM A;  2YRR A;  3BC8 A;  3LV2 A;  4IY7 A;  4J8L A;  2CTZ A;  4EB7 A;  3E2Z A;  4JF1 A;  3WX9 A;  2O7C A;  1GCK A;  1WYU A;  3ZZJ A;  4Y0H A;  1AY4 A;  3TFT A;  4RKC A;  4IYO B;  4F5J A;  1MDZ A;  4MKK A;  4BA4 A;  1M0Q A;  1ARH A;  2D5Y A;  5I92 A;  2YCT A;  2PB0 A;  1SPA A;  3ELP A;  1M0N A;  4IYO A;  2CST A;  4XJO A;  3AEM C;  4CXR A;  1ASC A;  1V72 A;  3HQT A;  3LY1 A;  2BI1 A;  1BQD A;  2VMS A;  1M6S A;  1ZOD A;  2DGK A;  3K40 A;  1UKJ A;  1B9H A;  1KMJ A;  1YIZ A;  3AEO A;  1PFF A;  3JW9 A;  2ZYJ A;  4EB5 A;  3W1H A;  4XK1 A;  4F5G A;  1GD9 A;  1BQA A;  2PO3 A;  4MSO A;  5G4J A;  3ELE A;  2W7F A;  3ZZK A;  3LWS A;  1B5P A;  1YJY A;  2CJD A;  2D66 A;  3NUB A;  4ZDP A;  5DB5 A;  2FNI A;  3ZRR A;  1H1C A;  1Z3Z A;  1DTY A;  2AY9 A;  2JJG A;  2QBT A;  4CBS A;  3VAX A;  2AY7 A;  4A00 A;  2VMV A;  2W7G A;  1ZC9 A;  2BIA A;  5EIG B;  1RVU A;  1MLZ A;  2HOZ A;  3COG A;  4EFF A;  5EAV A;  2W8T A;  1ORD A;  3DR7 A;  1C4K A;  2QMA A;  3MKJ A;  2GQN A;  1D7S A;  5DJ9 A;  5M49 A;  5EIG A;  1EG5 A;  1XI9 A;  4WYA A;  4BQ0 A;  3JWB A;  2VLF A;  3AEJ A;  4Q31 A;  2VGW A;  4KXK A;  3NRA A;  1X0M A;  1V2E A;  4FFC A;  2ZP7 A;  4OBV A;  3FFH A;  1Z7D A;  1IX8 A;  2C44 A;  2D65 A;  3DXW A;  4A6R A;  3E2F A;  3WGB A;  9AAT A;  1W7N A;  3FCR A;  1AMA A;  1AIA A;  4BMK A;  4GEB A;  4LNM A;  3MC6 A;  4QGR A;  2BKW A;  2D64 A;  3FQ8 A;  4PFF A;  2V0Y A;  3II0 A;  4JE5 A;  1ECX A;  2BHX A;  1IUG A;  3HBX A;  3KGW A;  1B9I A;  5EUE A;  4F5I A;  2VGU A;  1OHW A;  1LK9 A;  3ASA A;  3B46 A;  2C81 A;  3GZD C;  4IXS A;  4P3M A;  1OHV A;  3WLX A;  1D7U A;  3B1E A;  3N5M A;  3PDX A;  4ITG A;  2CJH A;  4MQP A;  5DJ1 A;  4WXB A;  3A2B A;  3D6K A;  1DFO A;  2CB1 A;  3CQ6 A;  3FDD A;  1AKA A;  1IX6 A;  3FD0 A;  1S07 A;  4W1W A;  1BJW A;  4DQ6 A;  2HP1 A;  1KL1 A;  3AEL A;  4M2M A;  3VP6 A;  5F9S A;  1SVV A;  4ADB A;  1ASD A;  2BWN A;  4XQ2 A;  1RV4 A;  3L8A A;  4ZWV A;  4GE9 A;  3AV7 A;  1M32 A;  2AY1 A;  1J32 A;  2EO5 A;  3OP7 A;  2AY3 A;  1QJ5 A;  3WKS A;  2Z20 A;  3CQ5 A;  1D2F A;  4I8A A;  1O61 A;  2R5C B;  4WLH A;  2ORD A;  2X3L A;  3KGX A;  3FDB A;  3H14 A;  3PJ0 A;  4AZJ A;  1M0O A;  1JS3 A;  1KKP A;  1WKH A;  2R5C A;  2RFV A;  3FVS A;  4IW7 A;  3TFU A;  3FKD A;  2JG2 A;  1AKC A;  1GC2 A;  4RIZ A;  1YIY A;  2VMO A;  1G7X A;  5EUN A;  2Z67 A;  2VMY A;  1ELQ A;  1BJ4 A;  3DU4 A;  5E5I A;  2FN6 A;  3ZRQ A;  5C6U A;  2Z9V A;  3Q8N A;  4AO4 A;  1AMS A;  2Z9X A;  4F5L A;  4UHM A;  4AOA A;  1M0P A;  1MDO A;  2DGM A;  1WYT B;  3B1D A;  4CBR A;  2ZSL A;  3CAI A;  2ZY2 A;  1IVR A;  4UHN A;  2AY2 A;  4HVK A;  3I4J A;  2CY8 A;  1C7O A;  1AKB A;  1GBN A;  3BS8 A;  3E2Y A;  3JWA A;  1UU0 A;  3GZC A;  1WYT A;  1MAQ A;  1IJI A;  2CFB A;  4A0H A;  3TAT A;  1DGD A;  4IX8 A;  1IBJ A;  1GC4 A;  1VEF A;  3G0T A;  3RBL A;  3GBX A;  1CL2 A;  4ISY A;  4ZWM A;  4N0B A;  2HUF A;  3NYT A;  1DJ9 A;  1ASF A;  3EI6 A;  3NUI A;  2CAN A;  1TAS A;  5K8B A;  4ZAS A;  1C9C A;  3NDN A;  3PIU A;  4M2J A;  4AH3 A;  2WKA A;  4MQQ A;  4ATQ A;  4F5H A;  1AHF A;  2HOX A;  3BWN C;  1ARG A;  4MKJ A;  2YKV A;  4W8I A;  2Z9U A;  3OKS A;  1QIR A;  4LW4 A;  2X5F A;  1G7W A;  1SFF A;  1QGN A;  3M5U A;  3ISL A;  2AY5 A;  3GET A;  2VMZ A;  1VP4 A;  1AMQ A;  4WB0 B;  4EMY A;  1YJZ A;  1X29 A;  2D7Y A;  2ZC0 A;  3E6G A;  1YAA A;  1AX4 A;  4RIT A;  4OBU A;  4MQR A;  2YCN A;  3VK2 A;  2O0R A;  4WB0 A;  3WGC A;  1AY5 A;  4W91 A;  1MGV A;  4Q76 A;  4AZK A;  5E4Z A;  1AY8 A;  5G2Q A;  4ZDL A;  3WCN A;  5M4D A;  3BCB A;  1V2F A;  1WST A;  1EQB A;  3RQ1 A;  4XJM A;  5FT8 A;  2HOR A;  2BWO A;  1KKJ A;  5G4I A;  1QJ3 A;  3QBO A;  1CS1 A;  2TPL A;  2BIG A;  3BV0 A;  2YRI A;  3RUY A;  3FQA A;  4CVQ A;  2XH1 A;  4WYF A;  3PA9 A;  4KYO A;  3MAU A;  1OXO A;  4K2I A;  2D61 A;  3QHX A;  2QLR A;  2HP2 A;  4R5F A;  2CIN A;  2DOU A;  5EAA A;  3NYS A;  3HVY A;  4OT8 A;  3RBF A;  3UAK A;  3F0H A;  1W7M A;  5G0A A;  3MBB A;  3QPG A;  2BYL A;  2FM1 A;  2JJE A;  3EI8 A;  3B8X A;  1S06 A;  3DR4 A;  4HF8 A;  4ZLV A;  2BI2 A;  4WYD A;  1ASM A;  2G6W A;  1D7R A;  2CH2 A;  3WY7 A;  3PGY A;  4RKD A;  4M2K A;  3MAD A;  4UHO A;  5EQC A;  1I48 A;  2VMR A;  1BW0 A;  4UQV A;  4ZSY A;  2ZY3 A;  1CQ6 A;  3E77 A;  3E9K A;  3A9Z A;  3EI5 A;  1ZOB A;  1SF2 A;  1VJO A;  1T3I A;  2OGA A;  2OKJ A;  3AOV A;  1ASL A;  4N0W A;  1I29 A;  3BCA A;  2F8J A;  2FNU A;  4K2M A;  1BKG A;  3NU8 A;  4DBC A;  2Z9W A;  2EPJ A;  1W23 A;  1RV3 A;  3PAA A;  3EZ1 A;  1LW4 A;  1CZC A;  2BIE A;  2QA3 A;  1IAX A;  1CQ8 A;  1PMO A;  1PMM A;  2E7J A;  3FQ7 A;  4KAM A;  1IX7 A;  4JEY A;  2VMQ A;  4IXZ A;  2VMW A;  3EI7 A;  2ZSM A;  1BS0 A;  2VI8 A;  2W7J A;  2X5D A;  4GSA A;  4E3R A;  1B5O A;  1GC3 A;  4E77 A;  3AEN B;  2DR1 A;  3CQ4 A;  2W8V A;  3ATH A;  3DC1 A;  4Y0D A;  2EH6 A;  2GB3 A;  5HDM A;  3AEN A;  3FSL A;  2C0R A;  3L44 A;  3RCH B;  1DJU A;  3KE3 A;  2VGT A;  1GEX A;  1S09 A;  3UE8 A;  1QZ9 A;  1ASN A;  2QB2 A;  1ART A;  3G8M A;  3NU7 A;  4ZM3 A;  3MEB A;  3I5T A;  1OXP A;  2FYF A;  3NNK A;  3RCH A;  1JG8 A;  1XEY A;  2VGV A;  4U1T A;  3AEM A;  1AHY A;  1JS6 A;  5HXX A;  5D95 A;  2VIA A;  3ACZ A;  5FT5 A;  4Q6R A;  2VMX A;  3DOD A;  1LW5 A;  1LC5 A;  5E3K A;  4ZSW A;  3TQX A;  3FVU A;  1PG8 A;  3W1I A;  4TMR A;  1KL2 A;  3LVM A;  1MAP A;  2VLH A;  5G09 A;  2NMP A;  4JEW A;  4F4E A;  5F8V A;  2AY8 A;  2AEV A;  5HHY A;  2CH1 A;  3HLM A;  4JEZ A;  2E7U A;  2QB3 A;  3AEJ C;  2JIS A;  3ZRP A;  4PFN A;  1SZK A;  4F5M A;  4ZDO A;  2XBN A;  4A6U A;  1TOK A;  2X8U A;  3AOW A;  4UOY A;  2VYC A;  3WZF A;  1B8G A;  1CL1 A;  1AJS B;  4RAE A;  3NX3 A;  2DKB A;  3LG0 A;  3MC6 C;  2VMU A;  3EIA A;  5EUD A;  1AJS A;  3CBF A;  3IHJ A;  3GWP A;  4ATP A;  4RLG A;  3HT4 A;  4OC9 A;  3VK3 A;  3QM2 A;  1KMK A;  3FTB A;  1X2A A;  2R5E A;  3AEP A;  2CJG A;  2VMP A;  1N8P A;  1WYV B;  1LS3 A;  1ARI A;  2V1P A;  1TOJ A;  1SZS A;  4U2H A;  2C7T A;  2VMT A;  4DGT A;  1DJE A;  2HUU A;  3F9T A;  1WYV A;  2WK8 A;  3E2Z B;  2GSA A;  3GZD A;  2JJF A;  3W1J A;  4J5U A;  1QIS A;  3USF A;  1AHX A;  3KKI A;  4XAU A;  2D7Z A;  2E7I A;  1S08 A;  3EIB A;  1U08 A;  2W7K A;  2WK7 A;  3WCO A;  2BYJ A;  3GSB A;  2W7I A;  5LH9 A;  4LW2 A;  2VMN A;  2EGY A;  1ASA A;  2W8U A;  1IAY A;  4A0F A;  4ADE A;  3TCM A;  2WK9 A;  3HL2 A;  4ADC A;  2FQ6 A;  4OTL A;  1E5F A;  3MAF B; 
#chains in the Genus database with same CATH topology
 4EU1 A;  1S0A A;  3A9Y A;  4ZAH A;  1TOI A;  4LNJ A;  1YOO A;  2YCP A;  4PIW A;  2W7H A;  4OYT A;  1AIB A;  3MAF A;  4H63 Q;  1UU1 A;  4WBT A;  5EFS A;  4ADD A;  8AAT A;  3LVJ A;  4JF0 A;  4A0G A;  2Q7W A;  2VGZ A;  1N31 A;  2AAT A;  1TOE A;  4WYC A;  3VK4 A;  3VOM A;  2VI9 A;  4W1V A;  4GE4 A;  5J8Q A;  4XEW A;  4NOG A;  4JEV A;  3PDB B;  2OKK A;  2OAT A;  3T32 A;  2JJH A;  4MY5 A;  4RJY A;  1QIT A;  2EZ2 A;  1ARS A;  1BJO B;  3HDO A;  1CQ7 A;  1DKA A;  3PDB A;  4RJ0 A;  1AIC A;  3DXV A;  2R2N A;  4GDY A;  4LC3 A;  4E3Q A;  5FT6 A;  1GEW A;  1AMR A;  1BJO A;  2YOB A;  3N4S A;  2Z61 A;  3EZS A;  3JTX A;  1DGE A;  4WXG A;  3LVK A;  5FT4 A;  4BHD A;  1D7V A;  2W7M A;  3GR9 A;  2PB2 A;  5BJ3 A;  2EYQ A;  4XJP A;  2YKY A;  3IF2 A;  1JF9 A;  3N0L A;  3R9A A;  1MDX A;  4F5K A;  1GDE A;  1EJI A;  1TPL A;  3ECD A;  4OMA A;  1WKG A;  3K7Y A;  4XJL A;  1N2T A;  4JE5 D;  2BI3 A;  2O1B A;  1J04 A;  2AY4 A;  4W5K A;  4R2N A;  3RI6 A;  4AO9 A;  1CJ0 A;  4WD2 A;  3PD6 B;  1G4X A;  1H0C A;  3BWN A;  3WKR A;  1X28 A;  1W7L A;  1LKC A;  1OHY A;  1TAT A;  1SZU A;  1LC8 A;  3ASB A;  3PPL A;  3PD6 A;  4O6Z A;  2BI9 A;  4PVF A;  3G7Q A;  4CXQ A;  1TOG A;  1B4X A;  2R0T A;  1UU2 A;  4Q75 A;  1ASE A;  2W7L A;  1I43 A;  3R4T A;  2VIB A;  1E5E A;  3UWC A;  2YKU A;  1G4V A;  5M4B A;  3QI6 A;  4IXO A;  1O62 A;  4ZM4 A;  2BI5 A;  2E54 A;  1RVY A;  2DGL A;  2GMU A;  2BWP A;  3H7F A;  4L0O A;  4A6T A;  4WP0 A;  5TF5 A;  5D5S A;  1AHG A;  4K2B A;  1C7G A;  3FZ7 A;  1FC4 A;  2W8W A;  3FRK A;  2JGT A;  4RM1 A;  5G2P A;  1MLY A;  3EUC A;  1GEY A;  2AEU A;  3I16 A;  4WYG A;  3FFR A;  1P3W A;  1YNU A;  1CZE A;  2GMS A;  3A9X A;  3AAT A;  2W7E A;  4LNL A;  3NTJ A;  5BJ4 A;  4GE7 A;  4ITX A;  4WYE A;  2ZY4 A;  4FL0 A;  1M7Y A;  3JZL A;  1LC7 A;  2ZUK A;  2W7D A;  4WLJ A;  4E1O A;  3K28 A;  1Y4I A;  1ASB A;  1AHE A;  3NYU A;  2QSR A;  4P7Y A;  2EZ1 A;  3DRD A;  1M4N A;  5IWQ A;  3BN1 A;  2AY6 A;  3LVL B;  3N4X A;  4TV7 A;  3FZ6 A;  3EI9 A;  3QGU A;  2FKI A;  3P6K A;  2Z1Z A;  4R8D A;  5AX8 A;  1O69 A;  1BT4 A;  2YHK A;  3BWO A;  3JU7 A;  4Y0I A;  4B9B A;  2Z1Y A;  4A0R A;  1V2D A;  3DYD A;  3FZ8 A;  3GJU A;  3A8U X;  1ASG A;  4H51 A;  4R5Z A;  2OGE A;  4W1X A;  3BCX A;  5JAY A;  2HOY A;  3BB8 A;  2W8J A;  3DZZ A;  4OCA A;  1W3U A;  1TAR A;  2HZP A;  4JEX A;  1FG7 A;  4GRX A;  4BA5 A;  1BJN A;  4TN4 A;  1C0N A;  1GC0 A;  2VGS A;  3QN6 A;  2HUI A;  7AAT A;  1I41 A;  3H9X A;  4MGR A;  4WXF A;  5M46 A;  1AJR A;  4B98 A;  3F6T A;  2DKJ A;  3N75 A;  3P1T A;  5LHA A;  4A72 A;  1FG3 A;  2D63 A;  4F5F A;  1OAT A;  5DX5 A;  2YKX A;  1WYU B;  3FVX A;  1ELU A;  2ZY5 A;  3HMU A;  1AAW A;  2OQX A;  3B1C A;  1YJS A;  1C7N A;  1O4S A;  2ZJG A;  1AAM A;  2YRR A;  3BC8 A;  3LV2 A;  4IY7 A;  4J8L A;  2CTZ A;  4EB7 A;  3E2Z A;  4JF1 A;  3WX9 A;  2O7C A;  1GCK A;  1WYU A;  3ZZJ A;  4Y0H A;  1AY4 A;  3TFT A;  4RKC A;  4IYO B;  4F5J A;  1MDZ A;  4MKK A;  4BA4 A;  1M0Q A;  1ARH A;  2D5Y A;  5I92 A;  2YCT A;  2PB0 A;  1SPA A;  3ELP A;  1M0N A;  4IYO A;  2CST A;  4XJO A;  3AEM C;  4CXR A;  1ASC A;  1V72 A;  3HQT A;  3LY1 A;  2BI1 A;  1BQD A;  2VMS A;  1M6S A;  1ZOD A;  2DGK A;  3K40 A;  1UKJ A;  4K05 A;  1B9H A;  1KMJ A;  1YIZ A;  3AEO A;  1PFF A;  3JW9 A;  2ZYJ A;  4EB5 A;  3W1H A;  4XK1 A;  4F5G A;  1GD9 A;  1BQA A;  2PO3 A;  4MSO A;  5G4J A;  3ELE A;  2W7F A;  3ZZK A;  3LWS A;  1B5P A;  1YJY A;  2CJD A;  2D66 A;  3NUB A;  4ZDP A;  5DB5 A;  2FNI A;  3ZRR A;  1H1C A;  1Z3Z A;  1DTY A;  2AY9 A;  2JJG A;  2QBT A;  2A1V A;  4CBS A;  3VAX A;  2AY7 A;  4A00 A;  2VMV A;  2W7G A;  1ZC9 A;  2BIA A;  5EIG B;  1RVU A;  1MLZ A;  2HOZ A;  3COG A;  4EFF A;  5EAV A;  2W8T A;  1ORD A;  3DR7 A;  1C4K A;  2QMA A;  3MKJ A;  2GQN A;  1D7S A;  5DJ9 A;  5M49 A;  5EIG A;  1EG5 A;  1XI9 A;  4WYA A;  4BQ0 A;  3JWB A;  2VLF A;  3AEJ A;  4Q31 A;  2VGW A;  4KXK A;  3NRA A;  1X0M A;  1V2E A;  4FFC A;  2ZP7 A;  4OBV A;  3FFH A;  1Z7D A;  1IX8 A;  2C44 A;  2D65 A;  3DXW A;  4A6R A;  3E2F A;  3WGB A;  9AAT A;  1W7N A;  3FCR A;  1AMA A;  1AIA A;  4BMK A;  4GEB A;  4LNM A;  3MC6 A;  4QGR A;  2BKW A;  2D64 A;  3FQ8 A;  4PFF A;  3N4R A;  2V0Y A;  3II0 A;  4JE5 A;  1ECX A;  2BHX A;  1IUG A;  3HBX A;  3KGW A;  1B9I A;  5EUE A;  4F5I A;  2VGU A;  1OHW A;  1LK9 A;  3ASA A;  3B46 A;  2C81 A;  3GZD C;  4IXS A;  4P3M A;  1OHV A;  3WLX A;  1D7U A;  3B1E A;  3N5M A;  3PDX A;  4ITG A;  2CJH A;  4MQP A;  5DJ1 A;  4WXB A;  3A2B A;  3D6K A;  1DFO A;  2CB1 A;  3CQ6 A;  3FDD A;  1AKA A;  1IX6 A;  3FD0 A;  1S07 A;  4W1W A;  1BJW A;  4DQ6 A;  2HP1 A;  1KL1 A;  3AEL A;  4M2M A;  3VP6 A;  5F9S A;  1SVV A;  4ADB A;  1ASD A;  2BWN A;  4XQ2 A;  1RV4 A;  3L8A A;  4ZWV A;  4GE9 A;  3AV7 A;  1M32 A;  2AY1 A;  1J32 A;  2EO5 A;  3OP7 A;  2AY3 A;  1QJ5 A;  3WKS A;  2Z20 A;  3CQ5 A;  1D2F A;  4I8A A;  1O61 A;  2R5C B;  4WLH A;  2KFP A;  2ORD A;  2X3L A;  3KGX A;  3FDB A;  3H14 A;  3PJ0 A;  4AZJ A;  1KAF A;  1M0O A;  1JS3 A;  1KKP A;  1WKH A;  2R5C A;  2RFV A;  3FVS A;  4IW7 A;  3TFU A;  3FKD A;  2JG2 A;  1AKC A;  1GC2 A;  4RIZ A;  1YIY A;  2VMO A;  1G7X A;  5EUN A;  2Z67 A;  2VMY A;  1ELQ A;  1BJ4 A;  3DU4 A;  5E5I A;  2FN6 A;  3ZRQ A;  5C6U A;  2Z9V A;  3Q8N A;  4AO4 A;  1AMS A;  2Z9X A;  4F5L A;  4UHM A;  4AOA A;  1M0P A;  1MDO A;  2DGM A;  1WYT B;  3B1D A;  4CBR A;  2ZSL A;  3CAI A;  2ZY2 A;  1IVR A;  4UHN A;  2AY2 A;  4HVK A;  3I4J A;  2CY8 A;  1C7O A;  1AKB A;  1GBN A;  3BS8 A;  3E2Y A;  3JWA A;  1UU0 A;  3GZC A;  1WYT A;  1MAQ A;  1IJI A;  2CFB A;  4A0H A;  3TAT A;  1DGD A;  4IX8 A;  1IBJ A;  1GC4 A;  1VEF A;  3G0T A;  3RBL A;  3GBX A;  1CL2 A;  4ISY A;  4ZWM A;  4N0B A;  2HUF A;  3NYT A;  1DJ9 A;  1ASF A;  3EI6 A;  3NUI A;  2CAN A;  1TAS A;  5K8B A;  4ZAS A;  1C9C A;  3NDN A;  3PIU A;  4M2J A;  4AH3 A;  2WKA A;  4MQQ A;  4ATQ A;  4F5H A;  1AHF A;  2HOX A;  3BWN C;  1ARG A;  4MKJ A;  2YKV A;  4W8I A;  2Z9U A;  3OKS A;  1QIR A;  4LW4 A;  2X5F A;  1G7W A;  1SFF A;  1QGN A;  3M5U A;  3ISL A;  2AY5 A;  3GET A;  2VMZ A;  1VP4 A;  1AMQ A;  4WB0 B;  4EMY A;  1YJZ A;  1X29 A;  2D7Y A;  2ZC0 A;  3E6G A;  1YAA A;  1AX4 A;  4RIT A;  4OBU A;  4MQR A;  2YCN A;  3VK2 A;  2O0R A;  4WB0 A;  3WGC A;  1AY5 A;  4W91 A;  1MGV A;  4Q76 A;  4AZK A;  5E4Z A;  1AY8 A;  5G2Q A;  4ZDL A;  3WCN A;  5M4D A;  3BCB A;  1V2F A;  1WST A;  1EQB A;  3RQ1 A;  4XJM A;  5FT8 A;  2HOR A;  2BWO A;  1KKJ A;  5G4I A;  1QJ3 A;  3QBO A;  1CS1 A;  2TPL A;  2BIG A;  3BV0 A;  2YRI A;  3RUY A;  3FQA A;  4CVQ A;  2XH1 A;  4WYF A;  3PA9 A;  4KYO A;  3MAU A;  1OXO A;  4K2I A;  2D61 A;  3QHX A;  2QLR A;  2HP2 A;  4R5F A;  2CIN A;  2DOU A;  5EAA A;  3NYS A;  3HVY A;  4OT8 A;  3RBF A;  3UAK A;  3F0H A;  1W7M A;  5G0A A;  3MBB A;  3QPG A;  2BYL A;  2FM1 A;  2JJE A;  3EI8 A;  3B8X A;  1S06 A;  3DR4 A;  4HF8 A;  4ZLV A;  2BI2 A;  4WYD A;  1ASM A;  2G6W A;  1D7R A;  2CH2 A;  3WY7 A;  3PGY A;  4RKD A;  4M2K A;  3MAD A;  4UHO A;  5EQC A;  1I48 A;  2VMR A;  1BW0 A;  4UQV A;  4ZSY A;  2ZY3 A;  1CQ6 A;  3E77 A;  3E9K A;  3A9Z A;  3EI5 A;  1ZOB A;  1SF2 A;  1VJO A;  1T3I A;  2OGA A;  2OKJ A;  3AOV A;  1ASL A;  4N0W A;  1I29 A;  3BCA A;  2F8J A;  2FNU A;  4K2M A;  1BKG A;  3NU8 A;  4DBC A;  2Z9W A;  2EPJ A;  1W23 A;  1RV3 A;  3PAA A;  5KTB A;  3EZ1 A;  1LW4 A;  1CZC A;  2BIE A;  2QA3 A;  1IAX A;  1CQ8 A;  1PMO A;  1PMM A;  2E7J A;  3FQ7 A;  4KAM A;  1IX7 A;  4JEY A;  2VMQ A;  4IXZ A;  2VMW A;  3EI7 A;  2ZSM A;  1BS0 A;  2VI8 A;  2W7J A;  2X5D A;  4GSA A;  4E3R A;  1B5O A;  1GC3 A;  4E77 A;  3AEN B;  2DR1 A;  3CQ4 A;  2W8V A;  3ATH A;  3DC1 A;  4Y0D A;  2EH6 A;  2GB3 A;  5HDM A;  3N7N A;  3AEN A;  3FSL A;  2C0R A;  3L44 A;  2G7J A;  3RCH B;  1DJU A;  3KE3 A;  2VGT A;  1GEX A;  1S09 A;  3UE8 A;  1QZ9 A;  1ASN A;  2QB2 A;  1ART A;  3G8M A;  3NU7 A;  2WB6 A;  4ZM3 A;  3MEB A;  3I5T A;  1OXP A;  2FYF A;  3NNK A;  3RCH A;  1JG8 A;  1XEY A;  2VGV A;  4U1T A;  3AEM A;  1AHY A;  1JS6 A;  5HXX A;  5D95 A;  2VIA A;  3ACZ A;  5FT5 A;  4Q6R A;  2VMX A;  3DOD A;  1LW5 A;  1LC5 A;  5E3K A;  4ZSW A;  3TQX A;  3FVU A;  1PG8 A;  3W1I A;  4TMR A;  1KL2 A;  3LVM A;  1MAP A;  2VLH A;  5G09 A;  2NMP A;  4JEW A;  4F4E A;  5F8V A;  2AY8 A;  2AEV A;  5HHY A;  2CH1 A;  3HLM A;  4JEZ A;  2E7U A;  2QB3 A;  3AEJ C;  2JIS A;  3ZRP A;  4PFN A;  1SZK A;  4F5M A;  4ZDO A;  2XBN A;  4A6U A;  1TOK A;  2X8U A;  3AOW A;  4UOY A;  2VYC A;  3WZF A;  1B8G A;  1CL1 A;  1AJS B;  4RAE A;  3NX3 A;  2DKB A;  3LG0 A;  3MC6 C;  2VMU A;  3EIA A;  5EUD A;  1AJS A;  3CBF A;  3IHJ A;  3GWP A;  4ATP A;  4RLG A;  3HT4 A;  4OC9 A;  3VK3 A;  3QM2 A;  1KMK A;  3FTB A;  1X2A A;  2R5E A;  3AEP A;  2CJG A;  2VMP A;  1N8P A;  1WYV B;  1LS3 A;  1ARI A;  2V1P A;  1TOJ A;  1SZS A;  4U2H A;  2C7T A;  2VMT A;  4DGT A;  1DJE A;  2HUU A;  3F9T A;  1WYV A;  2WK8 A;  3E2Z B;  2GSA A;  3GZD A;  2JJF A;  3W1J A;  4J5U A;  1QIS A;  3USF A;  1AHX A;  3KKI A;  4XAU A;  2D7Z A;  2E7I A;  1S08 A;  3EIB A;  1U08 A;  2W7K A;  2WK7 A;  3WCO A;  2BYJ A;  3GSB A;  2W7I A;  5LH9 A;  4LW2 A;  2VMN A;  2EGY A;  1ASA A;  2W8U A;  1IAY A;  4A0F A;  4ADE A;  3TCM A;  2WK9 A;  3HL2 A;  4ADC A;  2FQ6 A;  4OTL A;  1E5F A;  3MAF B; 
#chains in the Genus database with same CATH homology
 4EU1 A;  1S0A A;  3A9Y A;  4ZAH A;  1TOI A;  4LNJ A;  1YOO A;  2YCP A;  4PIW A;  2W7H A;  4OYT A;  1AIB A;  3MAF A;  4H63 Q;  1UU1 A;  4WBT A;  5EFS A;  4ADD A;  8AAT A;  3LVJ A;  4JF0 A;  4A0G A;  2Q7W A;  2VGZ A;  1N31 A;  2AAT A;  1TOE A;  4WYC A;  3VK4 A;  3VOM A;  2VI9 A;  4W1V A;  4GE4 A;  5J8Q A;  4XEW A;  4NOG A;  4JEV A;  3PDB B;  2OKK A;  2OAT A;  3T32 A;  2JJH A;  4MY5 A;  4RJY A;  1QIT A;  2EZ2 A;  1ARS A;  1BJO B;  3HDO A;  1CQ7 A;  1DKA A;  3PDB A;  4RJ0 A;  1AIC A;  3DXV A;  2R2N A;  4GDY A;  4LC3 A;  4E3Q A;  5FT6 A;  1GEW A;  1AMR A;  1BJO A;  2YOB A;  3N4S A;  2Z61 A;  3EZS A;  3JTX A;  1DGE A;  4WXG A;  3LVK A;  5FT4 A;  4BHD A;  1D7V A;  2W7M A;  3GR9 A;  2PB2 A;  5BJ3 A;  2EYQ A;  4XJP A;  2YKY A;  3IF2 A;  1JF9 A;  3N0L A;  3R9A A;  1MDX A;  4F5K A;  1GDE A;  1EJI A;  1TPL A;  3ECD A;  4OMA A;  1WKG A;  3K7Y A;  4XJL A;  1N2T A;  4JE5 D;  2BI3 A;  2O1B A;  1J04 A;  2AY4 A;  4W5K A;  4R2N A;  3RI6 A;  4AO9 A;  1CJ0 A;  4WD2 A;  3PD6 B;  1G4X A;  1H0C A;  3BWN A;  3WKR A;  1X28 A;  1W7L A;  1LKC A;  1OHY A;  1TAT A;  1SZU A;  1LC8 A;  3ASB A;  3PPL A;  3PD6 A;  4O6Z A;  2BI9 A;  4PVF A;  3G7Q A;  4CXQ A;  1TOG A;  1B4X A;  2R0T A;  1UU2 A;  4Q75 A;  1ASE A;  2W7L A;  1I43 A;  3R4T A;  2VIB A;  1E5E A;  3UWC A;  2YKU A;  1G4V A;  5M4B A;  3QI6 A;  4IXO A;  1O62 A;  4ZM4 A;  2BI5 A;  2E54 A;  1RVY A;  2DGL A;  2GMU A;  2BWP A;  3H7F A;  4L0O A;  4A6T A;  4WP0 A;  5TF5 A;  5D5S A;  1AHG A;  4K2B A;  1C7G A;  3FZ7 A;  1FC4 A;  2W8W A;  3FRK A;  2JGT A;  4RM1 A;  5G2P A;  1MLY A;  3EUC A;  1GEY A;  2AEU A;  3I16 A;  4WYG A;  3FFR A;  1P3W A;  1YNU A;  1CZE A;  2GMS A;  3A9X A;  3AAT A;  2W7E A;  4LNL A;  3NTJ A;  5BJ4 A;  4GE7 A;  4ITX A;  4WYE A;  2ZY4 A;  4FL0 A;  1M7Y A;  3JZL A;  1LC7 A;  2ZUK A;  2W7D A;  4WLJ A;  4E1O A;  3K28 A;  1Y4I A;  1ASB A;  1AHE A;  3NYU A;  2QSR A;  4P7Y A;  2EZ1 A;  3DRD A;  1M4N A;  5IWQ A;  3BN1 A;  2AY6 A;  3LVL B;  3N4X A;  4TV7 A;  3FZ6 A;  3EI9 A;  3QGU A;  2FKI A;  3P6K A;  2Z1Z A;  4R8D A;  5AX8 A;  1O69 A;  1BT4 A;  2YHK A;  3BWO A;  3JU7 A;  4Y0I A;  4B9B A;  2Z1Y A;  4A0R A;  1V2D A;  3DYD A;  3FZ8 A;  3GJU A;  3A8U X;  1ASG A;  4H51 A;  4R5Z A;  2OGE A;  4W1X A;  3BCX A;  5JAY A;  2HOY A;  3BB8 A;  2W8J A;  3DZZ A;  4OCA A;  1W3U A;  1TAR A;  2HZP A;  4JEX A;  1FG7 A;  4GRX A;  4BA5 A;  1BJN A;  4TN4 A;  1C0N A;  1GC0 A;  2VGS A;  3QN6 A;  2HUI A;  7AAT A;  1I41 A;  3H9X A;  4MGR A;  4WXF A;  5M46 A;  1AJR A;  4B98 A;  3F6T A;  2DKJ A;  3N75 A;  3P1T A;  5LHA A;  4A72 A;  1FG3 A;  2D63 A;  4F5F A;  1OAT A;  5DX5 A;  2YKX A;  1WYU B;  3FVX A;  1ELU A;  2ZY5 A;  3HMU A;  1AAW A;  2OQX A;  3B1C A;  1YJS A;  1C7N A;  1O4S A;  2ZJG A;  1AAM A;  2YRR A;  3BC8 A;  3LV2 A;  4IY7 A;  4J8L A;  2CTZ A;  4EB7 A;  3E2Z A;  4JF1 A;  3WX9 A;  2O7C A;  1GCK A;  1WYU A;  3ZZJ A;  4Y0H A;  1AY4 A;  3TFT A;  4RKC A;  4IYO B;  4F5J A;  1MDZ A;  4MKK A;  4BA4 A;  1M0Q A;  1ARH A;  2D5Y A;  5I92 A;  2YCT A;  2PB0 A;  1SPA A;  3ELP A;  1M0N A;  4IYO A;  2CST A;  4XJO A;  3AEM C;  4CXR A;  1ASC A;  1V72 A;  3HQT A;  3LY1 A;  2BI1 A;  1BQD A;  2VMS A;  1M6S A;  1ZOD A;  2DGK A;  3K40 A;  1UKJ A;  4K05 A;  1B9H A;  1KMJ A;  1YIZ A;  3AEO A;  1PFF A;  3JW9 A;  2ZYJ A;  4EB5 A;  3W1H A;  4XK1 A;  4F5G A;  1GD9 A;  1BQA A;  2PO3 A;  4MSO A;  5G4J A;  3ELE A;  2W7F A;  3ZZK A;  3LWS A;  1B5P A;  1YJY A;  2CJD A;  2D66 A;  3NUB A;  4ZDP A;  5DB5 A;  2FNI A;  3ZRR A;  1H1C A;  1Z3Z A;  1DTY A;  2AY9 A;  2JJG A;  2QBT A;  2A1V A;  4CBS A;  3VAX A;  2AY7 A;  4A00 A;  2VMV A;  2W7G A;  1ZC9 A;  2BIA A;  5EIG B;  1RVU A;  1MLZ A;  2HOZ A;  3COG A;  4EFF A;  5EAV A;  2W8T A;  1ORD A;  3DR7 A;  1C4K A;  2QMA A;  3MKJ A;  2GQN A;  1D7S A;  5DJ9 A;  5M49 A;  5EIG A;  1EG5 A;  1XI9 A;  4WYA A;  4BQ0 A;  3JWB A;  2VLF A;  3AEJ A;  4Q31 A;  2VGW A;  4KXK A;  3NRA A;  1X0M A;  1V2E A;  4FFC A;  2ZP7 A;  4OBV A;  3FFH A;  1Z7D A;  1IX8 A;  2C44 A;  2D65 A;  3DXW A;  4A6R A;  3E2F A;  3WGB A;  9AAT A;  1W7N A;  3FCR A;  1AMA A;  1AIA A;  4BMK A;  4GEB A;  4LNM A;  3MC6 A;  4QGR A;  2BKW A;  2D64 A;  3FQ8 A;  4PFF A;  3N4R A;  2V0Y A;  3II0 A;  4JE5 A;  1ECX A;  2BHX A;  1IUG A;  3HBX A;  3KGW A;  1B9I A;  5EUE A;  4F5I A;  2VGU A;  1OHW A;  1LK9 A;  3ASA A;  3B46 A;  2C81 A;  3GZD C;  4IXS A;  4P3M A;  1OHV A;  3WLX A;  1D7U A;  3B1E A;  3N5M A;  3PDX A;  4ITG A;  2CJH A;  4MQP A;  5DJ1 A;  4WXB A;  3A2B A;  3D6K A;  1DFO A;  2CB1 A;  3CQ6 A;  3FDD A;  1AKA A;  1IX6 A;  3FD0 A;  1S07 A;  4W1W A;  1BJW A;  4DQ6 A;  2HP1 A;  1KL1 A;  3AEL A;  4M2M A;  3VP6 A;  5F9S A;  1SVV A;  4ADB A;  1ASD A;  2BWN A;  4XQ2 A;  1RV4 A;  3L8A A;  4ZWV A;  4GE9 A;  3AV7 A;  1M32 A;  2AY1 A;  1J32 A;  2EO5 A;  3OP7 A;  2AY3 A;  1QJ5 A;  3WKS A;  2Z20 A;  3CQ5 A;  1D2F A;  4I8A A;  1O61 A;  2R5C B;  4WLH A;  2KFP A;  2ORD A;  2X3L A;  3KGX A;  3FDB A;  3H14 A;  3PJ0 A;  4AZJ A;  1M0O A;  1JS3 A;  1KKP A;  1WKH A;  2R5C A;  2RFV A;  3FVS A;  4IW7 A;  3TFU A;  3FKD A;  2JG2 A;  1AKC A;  1GC2 A;  4RIZ A;  1YIY A;  2VMO A;  1G7X A;  5EUN A;  2Z67 A;  2VMY A;  1ELQ A;  1BJ4 A;  3DU4 A;  5E5I A;  2FN6 A;  3ZRQ A;  5C6U A;  2Z9V A;  3Q8N A;  4AO4 A;  1AMS A;  2Z9X A;  4F5L A;  4UHM A;  4AOA A;  1M0P A;  1MDO A;  2DGM A;  1WYT B;  3B1D A;  4CBR A;  2ZSL A;  3CAI A;  2ZY2 A;  1IVR A;  4UHN A;  2AY2 A;  4HVK A;  3I4J A;  2CY8 A;  1C7O A;  1AKB A;  1GBN A;  3BS8 A;  3E2Y A;  3JWA A;  1UU0 A;  3GZC A;  1WYT A;  1MAQ A;  1IJI A;  2CFB A;  4A0H A;  3TAT A;  1DGD A;  4IX8 A;  1IBJ A;  1GC4 A;  1VEF A;  3G0T A;  3RBL A;  3GBX A;  1CL2 A;  4ISY A;  4ZWM A;  4N0B A;  2HUF A;  3NYT A;  1DJ9 A;  1ASF A;  3EI6 A;  3NUI A;  2CAN A;  1TAS A;  5K8B A;  4ZAS A;  1C9C A;  3NDN A;  3PIU A;  4M2J A;  4AH3 A;  2WKA A;  4MQQ A;  4ATQ A;  4F5H A;  1AHF A;  2HOX A;  3BWN C;  1ARG A;  4MKJ A;  2YKV A;  4W8I A;  2Z9U A;  3OKS A;  1QIR A;  4LW4 A;  2X5F A;  1G7W A;  1SFF A;  1QGN A;  3M5U A;  3ISL A;  2AY5 A;  3GET A;  2VMZ A;  1VP4 A;  1AMQ A;  4WB0 B;  4EMY A;  1YJZ A;  1X29 A;  2D7Y A;  2ZC0 A;  3E6G A;  1YAA A;  1AX4 A;  4RIT A;  4OBU A;  4MQR A;  2YCN A;  3VK2 A;  2O0R A;  4WB0 A;  3WGC A;  1AY5 A;  4W91 A;  1MGV A;  4Q76 A;  4AZK A;  5E4Z A;  1AY8 A;  5G2Q A;  4ZDL A;  3WCN A;  5M4D A;  3BCB A;  1V2F A;  1WST A;  1EQB A;  3RQ1 A;  4XJM A;  5FT8 A;  2HOR A;  2BWO A;  1KKJ A;  5G4I A;  1QJ3 A;  3QBO A;  1CS1 A;  2TPL A;  2BIG A;  3BV0 A;  2YRI A;  3RUY A;  3FQA A;  4CVQ A;  2XH1 A;  4WYF A;  3PA9 A;  4KYO A;  3MAU A;  1OXO A;  4K2I A;  2D61 A;  3QHX A;  2QLR A;  2HP2 A;  4R5F A;  2CIN A;  2DOU A;  5EAA A;  3NYS A;  3HVY A;  4OT8 A;  3RBF A;  3UAK A;  3F0H A;  1W7M A;  5G0A A;  3MBB A;  3QPG A;  2BYL A;  2FM1 A;  2JJE A;  3EI8 A;  3B8X A;  1S06 A;  3DR4 A;  4HF8 A;  4ZLV A;  2BI2 A;  4WYD A;  1ASM A;  2G6W A;  1D7R A;  2CH2 A;  3WY7 A;  3PGY A;  4RKD A;  4M2K A;  3MAD A;  4UHO A;  5EQC A;  1I48 A;  2VMR A;  1BW0 A;  4UQV A;  4ZSY A;  2ZY3 A;  1CQ6 A;  3E77 A;  3E9K A;  3A9Z A;  3EI5 A;  1ZOB A;  1SF2 A;  1VJO A;  1T3I A;  2OGA A;  2OKJ A;  3AOV A;  1ASL A;  4N0W A;  1I29 A;  3BCA A;  2F8J A;  2FNU A;  4K2M A;  1BKG A;  3NU8 A;  4DBC A;  2Z9W A;  2EPJ A;  1W23 A;  1RV3 A;  3PAA A;  5KTB A;  3EZ1 A;  1LW4 A;  1CZC A;  2BIE A;  2QA3 A;  1IAX A;  1CQ8 A;  1PMO A;  1PMM A;  2E7J A;  3FQ7 A;  4KAM A;  1IX7 A;  4JEY A;  2VMQ A;  4IXZ A;  2VMW A;  3EI7 A;  2ZSM A;  1BS0 A;  2VI8 A;  2W7J A;  2X5D A;  4GSA A;  4E3R A;  1B5O A;  1GC3 A;  4E77 A;  3AEN B;  2DR1 A;  3CQ4 A;  2W8V A;  3ATH A;  3DC1 A;  4Y0D A;  2EH6 A;  2GB3 A;  5HDM A;  3N7N A;  3AEN A;  3FSL A;  2C0R A;  3L44 A;  2G7J A;  3RCH B;  1DJU A;  3KE3 A;  2VGT A;  1GEX A;  1S09 A;  3UE8 A;  1QZ9 A;  1ASN A;  2QB2 A;  1ART A;  3G8M A;  3NU7 A;  2WB6 A;  4ZM3 A;  3MEB A;  3I5T A;  1OXP A;  2FYF A;  3NNK A;  3RCH A;  1JG8 A;  1XEY A;  2VGV A;  4U1T A;  3AEM A;  1AHY A;  1JS6 A;  5HXX A;  5D95 A;  2VIA A;  3ACZ A;  5FT5 A;  4Q6R A;  2VMX A;  3DOD A;  1LW5 A;  1LC5 A;  5E3K A;  4ZSW A;  3TQX A;  3FVU A;  1PG8 A;  3W1I A;  4TMR A;  1KL2 A;  3LVM A;  1MAP A;  2VLH A;  5G09 A;  2NMP A;  4JEW A;  4F4E A;  5F8V A;  2AY8 A;  2AEV A;  5HHY A;  2CH1 A;  3HLM A;  4JEZ A;  2E7U A;  2QB3 A;  3AEJ C;  2JIS A;  3ZRP A;  4PFN A;  1SZK A;  4F5M A;  4ZDO A;  2XBN A;  4A6U A;  1TOK A;  2X8U A;  3AOW A;  4UOY A;  2VYC A;  3WZF A;  1B8G A;  1CL1 A;  1AJS B;  4RAE A;  3NX3 A;  2DKB A;  3LG0 A;  3MC6 C;  2VMU A;  3EIA A;  5EUD A;  1AJS A;  3CBF A;  3IHJ A;  3GWP A;  4ATP A;  4RLG A;  3HT4 A;  4OC9 A;  3VK3 A;  3QM2 A;  1KMK A;  3FTB A;  1X2A A;  2R5E A;  3AEP A;  2CJG A;  2VMP A;  1N8P A;  1WYV B;  1LS3 A;  1ARI A;  2V1P A;  1TOJ A;  1SZS A;  4U2H A;  2C7T A;  2VMT A;  4DGT A;  1DJE A;  2HUU A;  3F9T A;  1WYV A;  2WK8 A;  3E2Z B;  2GSA A;  3GZD A;  2JJF A;  3W1J A;  4J5U A;  1QIS A;  3USF A;  1AHX A;  3KKI A;  4XAU A;  2D7Z A;  2E7I A;  1S08 A;  3EIB A;  1U08 A;  2W7K A;  2WK7 A;  3WCO A;  2BYJ A;  3GSB A;  2W7I A;  5LH9 A;  4LW2 A;  2VMN A;  2EGY A;  1ASA A;  2W8U A;  1IAY A;  4A0F A;  4ADE A;  3TCM A;  2WK9 A;  3HL2 A;  4ADC A;  2FQ6 A;  4OTL A;  1E5F A;  3MAF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...