4LW4A

Structural changes during cysteine desulfurase csda and sulfur-acceptor csde interactions provide insight into the trans-persulfuration
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
398
structure length
392
Chain Sequence
VFNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATQQFYSLSAGFAEAQRLTARYEAAREKVAQLLNAPDDKTIVWTRGTTESINMVAQCYARPRLQPGDEIIVSVAEHHANLVPWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNVTGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQLDIDFYAFSGHKLYGPTGIGVLYGKSELLEAMSPWLGGGKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKRPGFRSFRCQDSSLLAFDFAGVHHSDMVTLLAEYGIALRAGQHCAQPLLAELGVTGTLRASFAPYNTKSDVDALVNAVDRALELLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural changes during cysteine desulfurase CsdA and sulfur-acceptor CsdE interactions provide insight into the trans-persulfuration.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Cysteine sulfinate desulfinase
total genus 137
structure length 392
sequence length 398
chains with identical sequence B
ec nomenclature ec 2.8.1.7: Cysteine desulfurase.
pdb deposition date 2013-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4lw4A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4lw4A01
1QIRA 3I5TA 1O61A 5HDMA 2W7KA 2ZY3A 3QPGA 4ATPA 4Q75A 4M2KA 3DZZA 2DKBA 3JWAA 4Y0DA 2CY8A 1V72A 3BB8A 3VAXA 3B46A 3JZLA 5G0AA 3ZZJA 1JF9A 3ACZA 1IX6A 1IVRA 1N2TA 1OATA 1AHXA 1SZUA 3EI5A 3FVXA 4NOGA 3USFA 3WGCA 5M4BA 1AY8A 1GBNA 2ZSLA 4ISYA 4XAUA 1SZSA 1RVUA 1FG3A 3FZ7A 4XK1A 3R9AA 1MDOA 1VEFA 2R5CB 4OTLA 1ASMA 4GE7A 5IWQA 2Z61A 1GD9A 5FT5A 1V2FA 3F0HA 1BKGA 1QJ3A 2W7DA 5FT4A 4FFCA 3K28A 4ZM4A 1WYTA 3AEJA 4CVQA 1AJSA 4IY7A 1ECXA 2FYFA 2AY6A 2VMRA 1H0CA 3WKRA 1LW5A 4F4EA 1LW4A 3P6KA 4O6ZA 3ZRPA 1ZODA 1ASCA 3CQ6A 3PGYA 5FT6A 1VP4A 2BI5A 2YCPA 4OCAA 1V2DA 2O1BA 3LWSA 2CINA 4XJLA 1LS3A 4ITGA 5FT8A 2BWOA 4F5MA 3ZRRA 2W7JA 4U1TA 2JISA 2ZC0A 3RCHA 4QGRA 1ZC9A 2HP1A 3E6GA 3WCOA 1S0AA 1T3IA 1W7LA 3DODA 4F5LA 2ZYJA 4XJOA 4JF1A 2CANA 2D7ZA 2E54A 4WXBA 4Y0IA 1LK9A 3K40A 3A8UX 4K2BA 5D5SA 1XI9A 2HP2A 2Z1YA 3ATHA 1YJZA 3GSBA 3QGUA 3BCBA 3D6KA 3WX9A 4DGTA 3E2FA 1M0NA 2Q7WA 2AY8A 4OMAA 4AOAA 4WLHA 1X28A 2ZSMA 4H51A 3L8AA 3LG0A 1V2EA 3G8MA 1BJWA 2VGUA 4GDYA 1M7YA 3WLXA 4ADBA 4F5HA 1ORDA 3NUIA 5EFSA 3FZ6A 2BYLA 4M2JA 1SF2A 3OKSA 1ARSA 1MAQA 2O7CA 5M49A 2R5CA 4HVKA 1DGDA 4LNLA 1OXOA 1DJ9A 1W7MA 2VI9A 4IXZA 3RQ1A 1X29A 1AJSB 3QBOA 2WKAA 1AMQA 1PG8A 3HT4A 3BN1A 1ASNA 4IW7A 2X5DA 5F8VA 3NYSA 2AY7A 2VYCA 2CFBA 3FQ7A 1O4SA 1LC5A 3BWNA 4WYDA 1CL2A 1I43A 2VGWA 2JJHA 3NUBA 2VMNA 4RLGA 1O69A 4UOYA 4WB0A 4KYOA 5I92A 5DB5A 2VMOA 1WKHA 1TOKA 2FNUA 4W1XA 5HHYA 3ZRQA 2VLFA 4BMKA 1ELQA 4UQVA 1M0OA 2GMUA 2YHKA 3B1EA 2Z1ZA 2D66A 2CJHA 4A6UA 2QB2A 1JS6A 1KMKA 3HLMA 1O62A 1WSTA 3NU8A 3R4TA 3FVSA 1AAWA 1B9IA 1C7NA 2CSTA 3EI8A 5M46A 3EUCA 1ASLA 4GE4A 4TV7A 4W1VA 4IXSA 3T32A 2BHXA 3PAAA 4B9BA 5EQCA 2X3LA 2HOZA 4GSAA 1QGNA 1YOOA 2FNIA 1TPLA 1JS3A 1LC8A 3EI7A 4E3RA 1IX8A 2YKXA 3DR7A 4P7YA 1Z3ZA 1N8PA 4DBCA 2OKJA 5E5IA 1BJOA 4AZJA 1RVYA 3ASAA 3P1TA 2DGMA 3FKDA 1OHVA 3CAIA 2DKJA 3LVJA 3N5MA 4W8IA 3WGBA 5D95A 2YOBA 4WYFA 2F8JA 4AO9A 4WXFA 3FQ8A 2VMQA 1ASEA 2CB1A 3H7FA 3HVYA 3FTBA 3KGXA 2AY9A 2ZUKA 4UHOA 3E2ZB 3PA9A 4XEWA 4L0OA 3WKSA 4AO4A 1G4XA 3HDOA 1AHGA 4MGRA 2VGVA 2VIBA 2FN6A 5DX5A 2GQNA 3EZ1A 1TOIA 3AEJC 1YJYA 3DYDA 2D7YA 1AHEA 3DXWA 3PD6B 1GCKA 3RUYA 4F5FA 4ZM3A 4RAEA 4JE5A 2BKWA 3GJUA 4DQ6A 2OQXA 1EJIA 1X2AA 3TFTA 3MKJA 1FC4A 4N0BA 1PMMA 2CTZA 1S07A 2HUFA 4E1OA 1ARHA 2VGZA 1C9CA 4WB0B 2EZ1A 5LH9A 1QISA 1D7SA 2D64A 2RFVA 3K7YA 3QN6A 4EU1A 5BJ4A 1OXPA 5G4JA 4A0HA 1KMJA 1QJ5A 4J8LA 5F9SA 3NRAA 3QM2A 4Q31A 1Z7DA 5G2QA 4ZLVA 1AX4A 1W3UA 3ELPA 3HL2A 4WXGA 3IHJA 3UWCA 4BHDA 4R8DA 1AIBA 4JEYA 1SZKA 2TPLA 1AKBA 3GZDC 1CQ8A 2W8TA 3LV2A 2AY4A 3AEPA 3AEMC 3HMUA 3PJ0A 4W91A 4ZDLA 1QITA 1C7GA 1KL2A 2OKKA 4IX8A 3A9YA 3EI9A 1M6SA 3FCRA 4BQ0A 3QI6A 1ARIA 2AY5A 2VMTA 3BC8A 3WY7A 1C7OA 3VK2A 2HUUA 4A0GA 2JJEA 4ADDA 3ELEA 2VI8A 3KE3A 4K2IA 3II0A 3TATA 1WYTB 3PDBA 4F5KA 2E7JA 1SVVA 4A6RA 1S08A 4FL0A 4AZKA 3EI6A 5AX8A 2AY1A 3AATA 2R0TA 1BJOB 3PDXA 2YCNA 3JTXA 1D7RA 4RJYA 4RITA 1AIAA 3NYUA 1DFOA 4UHNA 3MAFB 5EIGB 5C6UA 1M0QA 2DGKA 3LVKA 3I4JA 3TCMA 1B4XA 2ORDA 2ZP7A 4PVFA 2PB0A 4JE5D 5M4DA 3N0LA 2D65A 3CQ4A 3GZDA 1UU1A 3UE8A 1GEWA 3PD6A 1S06A 3EZSA 2D61A 5DJ9A 2XH1A 1ASBA 2BWPA 3AOWA 3FDBA 2OGAA 2X5FA 1G7WA 3GWPA 2EGYA 1FG7A 2GB3A 2JJGA 2W8JA 4U2HA 4JEXA 4WBTA 3HBXA 1KKPA 1YIYA 1U08A 3RI6A 2D63A 3AENA 2ZY2A 3DU4A 2WK7A 1YAAA 3NU7A 2R5EA 1W23A 4Q6RA 4OC9A 4CBRA 1KKJA 2AY2A 4R5ZA 3LVLB 3MADA 4ZASA 1AAMA 2EO5A 2GSAA 2ZY5A 2O0RA 1AKAA 1X0MA 1ARGA 1GC4A 2Z67A 2W7IA 1CZCA 1BT4A 1MGVA 1AKCA 2JG2A 4LW4A 3CBFA 2VMSA 1TOJA 2YKYA 2VMWA 5G4IA 2W8UA 5BJ3A 1CS1A 3FFHA 4KXKA 4WP0A 3BCXA 4CBSA 3GR9A 4EB5A 3A2BA 3BS8A 3PDBB 4Y0HA 3FDDA 2YRRA 4RKCA 1P3WA 2V1PA 2WK9A 2G6WA 4ZDOA 2YCTA 4JF0A 1I41A 2FM1A 4LC3A 1OHWA 1JG8A 3E2YA 4WYEA 3I16A 2BI3A 1WKGA 1ZOBA 2QBTA 1ASDA 1AY4A 3MC6A 5K8BA 3AENB 1ASAA 2R2NA 1GEXA 3B1CA 4ZSYA 1UU2A 3ISLA 1B5OA 4LNMA 4MSOA 2HOYA 4B98A 2AY3A 2QMAA 4ZWMA 1TASA 4UHMA 3VK3A 2HORA 1PMOA 4MKKA 1AICA 1ELUA 1RV3A 3NYTA 4TMRA 2DGLA 1CQ6A 1J04A 2CJDA 4W5KA 1D7UA 2Z20A 4K2MA 2W8WA 2HOXA 3NX3A 1TARA 5E3KA 4WYCA 5TF5A 3GBXA 4MQQA 3B1DA 5G2PA 4F5JA 2W7FA 3EIAA 3A9ZA 1Y4IA 3Q8NA 4N0WA 1AJRA 1QZ9A 3VP6A 1I48A 1YIZA 4MQRA 3TQXA 1W7NA 4GE9A 1BJNA 1MDXA 2BIGA 3F6TA 1AHYA 2DOUA 4RKDA 4AH3A 4OBUA 2BIEA 2AEUA 4M2MA 2W7MA 4JEWA 2HZPA 4PFNA 5HXXA 4MKJA 1MDZA 4IYOB 1CL1A 5EUNA 5EUDA 1ASGA 3TFUA 2VMXA 2BI1A 1CZEA 3LY1A 1EQBA 1D7VA 1BJ4A 4OBVA 1J32A 3MBBA 3BWOA 4JEVA 3VOMA 1DGEA 3QHXA 4E77A 7AATA 2NMPA 2PB2A 1BQAA 1GEYA 3AOVA 1AY5A 2QA3A 1ARTA 2YRIA 4BA5A 3VK4A 3E2ZA 2BWNA 4R5FA 2QLRA 1ASFA 1C4KA 3FSLA 4GRXA 4R2NA 2CH2A 1LKCA 3G0TA 1WYVA 1KL1A 4Q76A 3AEOA 2EZ2A 4RM1A 4ATQA 3DC1A 4E3QA 4WYGA 2AEVA 2D5YA 4PIWA 3GETA 4ZSWA 1YJSA 2ZY4A 3B8XA 1AMRA 3ECDA 4ZAHA 2W7LA 1B5PA 1G7XA 4XQ2A 4CXQA 3FZ8A 2OGEA 3L44A 3W1HA 2QB3A 4ITXA 9AATA 2Z9VA 3GZCA 1MLZA 3W1JA 3AV7A 1CQ7A 2VLHA 3FVUA 2C81A 2VGSA 1XEYA 2E7IA 1D2FA 1M32A 4BA4A 3HQTA 1MLYA 1H1CA 1IAXA 1M0PA 1PFFA 8AATA 1AMAA 3PIUA 3AEMA 2WK8A 3E9KA 2VMZA 3NNKA 2C0RA 5LHAA 2E7UA 2VMUA 1LC7A 3DXVA 3PPLA 1BW0A 3FRKA 4MQPA 3FD0A 1UU0A 3G7QA 4GEBA 3M5UA 4PFFA 3KGWA 1SPAA 2W8VA 1WYUB 3MAUA 1IBJA 2C44A 2FQ6A 1B9HA 2GMSA 2VIAA 4WLJA 3W1IA 1IJIA 1AMSA 2BI2A 2VMVA 4EB7A 1DJEA 4A0RA 2PO3A 3ASBA 5J8QA 4I8AA 1B8GA 4KAMA 2JGTA 4JEZA 4ZDPA 2BYJA 3IF2A 3COGA 1I29A 2CH1A 2ZJGA 1S09A 1C0NA 4IYOA 3JWBA 2EPJA 3KKIA 1RV4A 4MY5A 4HF8A 1N31A 5JAYA 2JJFA 3MAFA 2W7EA 5EIGA 2CJGA 3UAKA 4A00A 3H14A 4ZWVA 4WD2A 1G4VA 4F5IA 2XBNA 4ADEA 4OT8A 5EUEA 1SFFA 2HUIA 4EFFA 1GC0A 3AELA 2AATA 3FFRA 1DTYA 2VMYA 3A9XA 4LNJA 4P3MA 4XJMA 4TN4A 2V0YA 2Z9XA 1UKJA 2W7GA 2Z9UA 3DR4A 2EH6A 1BQDA 2BIAA 1WYVB 3MC6C 4OYTA 1AHFA 3MEBA 3BCAA 1EG5A 3F9TA 3WZFA 3BV0A 1VJOA 1GC2A 5E4ZA 4WYAA 2VGTA 3JU7A 4RJ0A 2C7TA 4RIZA 4A0FA 3BWNC 1TATA 1GDEA 4W1WA 2X8UA 3RCHB 3CQ5A 4CXRA 3FQAA 1M4NA 2W7HA 4F5GA 2YKUA 1IAYA 3EIBA 5EAVA 1DJUA 2OATA 3WCNA 3NTJA 3RBFA 1YNUA 4ADCA 5DJ1A 5G09A 2VMPA 3RBLA 2Z9WA 4A72A 1DKAA 1TOEA 1E5EA 4LW2A 4XJPA 3N75A 2DR1A 3E77A 3OP7A 1WYUA 1IUGA 1BS0A 4A6TA 3JW9A 1OHYA 3DRDA 3NDNA 5EAAA 3ZZKA 1MAPA 1IX7A 1TOGA 4IXOA 4J5UA 3LVMA 4EMYA 1CJ0A 2YKVA 1GC3A 1E5FA 2BI9A
chains in the Genus database with same CATH superfamily
1QIRA 3I5TA 1O61A 5HDMA 2W7KA 2ZY3A 3QPGA 4ATPA 4Q75A 4M2KA 3DZZA 2DKBA 3JWAA 4Y0DA 2CY8A 1V72A 3BB8A 3VAXA 3B46A 3JZLA 5G0AA 3ZZJA 1JF9A 3ACZA 1IX6A 1IVRA 1N2TA 1OATA 1AHXA 1SZUA 3EI5A 3FVXA 4NOGA 3USFA 3WGCA 5M4BA 1AY8A 1GBNA 2ZSLA 4ISYA 4XAUA 1SZSA 1RVUA 1FG3A 3FZ7A 4XK1A 3R9AA 1MDOA 1VEFA 2R5CB 4OTLA 1ASMA 4GE7A 5IWQA 2Z61A 1GD9A 5FT5A 1V2FA 3F0HA 1BKGA 1QJ3A 2W7DA 5FT4A 4FFCA 3K28A 4ZM4A 1WYTA 3AEJA 4CVQA 1AJSA 4IY7A 1ECXA 2FYFA 2AY6A 2EYQA 2VMRA 1H0CA 3WKRA 1LW5A 4F4EA 1LW4A 3P6KA 4O6ZA 3ZRPA 1ZODA 1ASCA 3CQ6A 3PGYA 5FT6A 1VP4A 2BI5A 2YCPA 4OCAA 1V2DA 2O1BA 3LWSA 2CINA 4XJLA 1LS3A 4ITGA 5FT8A 2BWOA 4F5MA 3ZRRA 2W7JA 4U1TA 2JISA 3N4XA 2ZC0A 3RCHA 4QGRA 1ZC9A 2HP1A 3E6GA 2FKIA 3WCOA 1S0AA 1T3IA 1W7LA 3DODA 4F5LA 2ZYJA 4XJOA 4JF1A 2CANA 2D7ZA 2E54A 4WXBA 4Y0IA 1LK9A 3K40A 3A8UX 4K2BA 5D5SA 1XI9A 2HP2A 2Z1YA 3ATHA 1YJZA 3GSBA 3QGUA 3BCBA 3D6KA 3WX9A 4DGTA 3E2FA 1M0NA 2Q7WA 3N4SA 3H9XA 2AY8A 4OMAA 4AOAA 4WLHA 1X28A 2ZSMA 4H51A 3L8AA 3LG0A 1V2EA 3G8MA 1BJWA 2VGUA 4GDYA 1M7YA 3WLXA 4ADBA 4F5HA 1ORDA 3NUIA 5EFSA 3FZ6A 2BYLA 4M2JA 1SF2A 3OKSA 1ARSA 1MAQA 2O7CA 5M49A 2R5CA 4H63Q 4HVKA 1DGDA 4LNLA 1OXOA 1DJ9A 1W7MA 2VI9A 4IXZA 3RQ1A 1X29A 1AJSB 3QBOA 2WKAA 1AMQA 1PG8A 3HT4A 3BN1A 1ASNA 4IW7A 2X5DA 5F8VA 3NYSA 2AY7A 2VYCA 2CFBA 3FQ7A 1O4SA 1LC5A 3BWNA 4WYDA 3N7NA 1CL2A 1I43A 2VGWA 2JJHA 3NUBA 2VMNA 4RLGA 1O69A 4UOYA 2G7JA 4WB0A 4KYOA 5I92A 5DB5A 2VMOA 1WKHA 1TOKA 2FNUA 4W1XA 5HHYA 3ZRQA 2VLFA 4BMKA 1ELQA 4UQVA 1M0OA 2GMUA 2YHKA 3B1EA 2Z1ZA 2D66A 2CJHA 4A6UA 2QB2A 1JS6A 1KMKA 3HLMA 1O62A 1WSTA 3NU8A 3R4TA 3FVSA 1AAWA 1B9IA 1C7NA 2CSTA 3EI8A 5M46A 3EUCA 1ASLA 4GE4A 4TV7A 4W1VA 4IXSA 3T32A 2BHXA 3PAAA 4B9BA 5EQCA 2X3LA 2HOZA 4GSAA 1QGNA 1YOOA 2FNIA 1TPLA 1JS3A 1LC8A 3EI7A 1KAFA 4E3RA 1IX8A 2YKXA 3DR7A 4P7YA 1Z3ZA 1N8PA 4DBCA 2OKJA 5E5IA 1BJOA 4AZJA 1RVYA 3ASAA 3P1TA 2DGMA 3FKDA 1OHVA 3CAIA 2DKJA 3LVJA 3N5MA 4W8IA 3WGBA 5D95A 2YOBA 4WYFA 2F8JA 4AO9A 4WXFA 3FQ8A 2VMQA 1ASEA 2CB1A 3H7FA 3HVYA 3FTBA 3KGXA 2AY9A 2ZUKA 4UHOA 3E2ZB 3PA9A 4XEWA 4L0OA 3WKSA 4AO4A 1G4XA 3HDOA 1AHGA 4MGRA 2VGVA 2VIBA 2FN6A 5DX5A 2GQNA 3EZ1A 1TOIA 3AEJC 1YJYA 3DYDA 2D7YA 1AHEA 3DXWA 3PD6B 1GCKA 3RUYA 4F5FA 4ZM3A 4RAEA 4JE5A 2BKWA 3GJUA 4DQ6A 2OQXA 1EJIA 1X2AA 3TFTA 3MKJA 1FC4A 4N0BA 1PMMA 2CTZA 1S07A 2HUFA 4E1OA 1ARHA 2VGZA 1C9CA 4WB0B 2EZ1A 5LH9A 1QISA 1D7SA 2D64A 2RFVA 3K7YA 3QN6A 4EU1A 5BJ4A 1OXPA 5G4JA 4A0HA 1KMJA 1QJ5A 4J8LA 5F9SA 3NRAA 3QM2A 4Q31A 1Z7DA 5G2QA 4ZLVA 1AX4A 1W3UA 3ELPA 3HL2A 4WXGA 3IHJA 3UWCA 4BHDA 4R8DA 1AIBA 4JEYA 1SZKA 2TPLA 1AKBA 3GZDC 1CQ8A 2W8TA 3LV2A 2AY4A 3AEPA 3AEMC 3HMUA 3PJ0A 4W91A 4ZDLA 1QITA 1C7GA 1KL2A 2OKKA 4IX8A 3A9YA 3EI9A 1M6SA 3FCRA 4BQ0A 3QI6A 1ARIA 2AY5A 2VMTA 3BC8A 3WY7A 1C7OA 3VK2A 2HUUA 4A0GA 2JJEA 4ADDA 3ELEA 2VI8A 3KE3A 4K2IA 3II0A 3TATA 1WYTB 3PDBA 4F5KA 3N4RA 2E7JA 1SVVA 4A6RA 1S08A 4FL0A 4K05A 4AZKA 3EI6A 5AX8A 2AY1A 3AATA 2R0TA 1BJOB 3PDXA 2YCNA 3JTXA 1D7RA 4RJYA 4RITA 1AIAA 3NYUA 1DFOA 4UHNA 3MAFB 5EIGB 5C6UA 1M0QA 2DGKA 3LVKA 3I4JA 3TCMA 1B4XA 2ORDA 2ZP7A 4PVFA 2PB0A 4JE5D 5M4DA 3N0LA 2D65A 3CQ4A 3GZDA 1UU1A 3UE8A 1GEWA 3PD6A 1S06A 3EZSA 2D61A 5DJ9A 2XH1A 1ASBA 2BWPA 3AOWA 3FDBA 2OGAA 2X5FA 1G7WA 3GWPA 2EGYA 1FG7A 2GB3A 2JJGA 2W8JA 4U2HA 4JEXA 4WBTA 3HBXA 1KKPA 1YIYA 1U08A 3RI6A 2D63A 3AENA 2ZY2A 3DU4A 2WK7A 1YAAA 3NU7A 2R5EA 2KFPA 1W23A 4Q6RA 4OC9A 4CBRA 2WB6A 1KKJA 2AY2A 4R5ZA 3LVLB 3MADA 4ZASA 1AAMA 2EO5A 2GSAA 2ZY5A 2O0RA 1AKAA 1X0MA 1ARGA 1GC4A 2Z67A 2W7IA 1CZCA 1BT4A 1MGVA 1AKCA 2JG2A 4LW4A 3CBFA 2VMSA 1TOJA 2YKYA 2VMWA 5G4IA 2W8UA 5BJ3A 1CS1A 3FFHA 4KXKA 4WP0A 3BCXA 4CBSA 3GR9A 4EB5A 3A2BA 3BS8A 3PDBB 4Y0HA 3FDDA 2YRRA 4RKCA 1P3WA 2V1PA 2WK9A 2G6WA 4ZDOA 2YCTA 4JF0A 1I41A 2FM1A 4LC3A 1OHWA 1JG8A 3E2YA 4WYEA 3I16A 2BI3A 1WKGA 1ZOBA 2QBTA 1ASDA 1AY4A 3MC6A 5K8BA 3AENB 1ASAA 2R2NA 1GEXA 3B1CA 4ZSYA 1UU2A 3ISLA 1B5OA 4LNMA 4MSOA 2HOYA 4B98A 2AY3A 2QMAA 4ZWMA 1TASA 4UHMA 3VK3A 2HORA 1PMOA 4MKKA 1AICA 1ELUA 1RV3A 3NYTA 4TMRA 2DGLA 1CQ6A 1J04A 2CJDA 4W5KA 1D7UA 2Z20A 4K2MA 2W8WA 2HOXA 3NX3A 1TARA 5E3KA 4WYCA 5TF5A 3GBXA 4MQQA 3B1DA 5G2PA 4F5JA 2W7FA 3EIAA 3A9ZA 1Y4IA 3Q8NA 4N0WA 1AJRA 1QZ9A 3VP6A 1I48A 1YIZA 4MQRA 3TQXA 1W7NA 4GE9A 1BJNA 1MDXA 2BIGA 3F6TA 1AHYA 2DOUA 4RKDA 4AH3A 4OBUA 2BIEA 2AEUA 4M2MA 2W7MA 4JEWA 2HZPA 4PFNA 5HXXA 4MKJA 1MDZA 4IYOB 1CL1A 5EUNA 5EUDA 1ASGA 3TFUA 2VMXA 2BI1A 1CZEA 3LY1A 1EQBA 1D7VA 1BJ4A 4OBVA 1J32A 3MBBA 3BWOA 4JEVA 3VOMA 1DGEA 3QHXA 4E77A 7AATA 2NMPA 2PB2A 1BQAA 1GEYA 3AOVA 1AY5A 2QA3A 1ARTA 2YRIA 4BA5A 3VK4A 3E2ZA 2BWNA 4R5FA 2QLRA 1ASFA 1C4KA 3FSLA 4GRXA 4R2NA 2CH2A 1LKCA 3G0TA 1WYVA 1KL1A 4Q76A 3AEOA 5KTBA 2EZ2A 4RM1A 4ATQA 3DC1A 4E3QA 4WYGA 2AEVA 2D5YA 4PIWA 3GETA 4ZSWA 2A1VA 1YJSA 2ZY4A 3B8XA 1AMRA 3ECDA 4ZAHA 2W7LA 1B5PA 1G7XA 4XQ2A 4CXQA 3FZ8A 2OGEA 3L44A 3W1HA 2QB3A 4ITXA 9AATA 2Z9VA 3GZCA 1MLZA 3W1JA 3AV7A 1CQ7A 2VLHA 3FVUA 2C81A 2VGSA 1XEYA 2E7IA 1D2FA 1M32A 4BA4A 3HQTA 1MLYA 1H1CA 1IAXA 1M0PA 1PFFA 8AATA 1AMAA 3PIUA 3AEMA 2WK8A 3E9KA 2VMZA 3NNKA 2C0RA 5LHAA 2QSRA 2E7UA 2VMUA 1LC7A 3DXVA 3PPLA 1BW0A 3FRKA 4MQPA 3FD0A 1UU0A 3G7QA 4GEBA 3M5UA 4PFFA 3KGWA 1SPAA 2W8VA 1WYUB 3MAUA 1IBJA 2C44A 2FQ6A 1B9HA 2GMSA 2VIAA 4WLJA 3W1IA 1IJIA 1AMSA 2BI2A 2VMVA 4EB7A 1DJEA 4A0RA 2PO3A 3ASBA 5J8QA 4I8AA 1B8GA 4KAMA 2JGTA 4JEZA 4ZDPA 2BYJA 3IF2A 3COGA 1I29A 2CH1A 2ZJGA 1S09A 1C0NA 4IYOA 3JWBA 2EPJA 3KKIA 1RV4A 4MY5A 4HF8A 1N31A 5JAYA 2JJFA 3MAFA 2W7EA 5EIGA 2CJGA 3UAKA 4A00A 3H14A 4ZWVA 4WD2A 1G4VA 4F5IA 2XBNA 4ADEA 4OT8A 5EUEA 1SFFA 2HUIA 4EFFA 1GC0A 3AELA 2AATA 3FFRA 1DTYA 2VMYA 3A9XA 4LNJA 4P3MA 4XJMA 4TN4A 2V0YA 2Z9XA 1UKJA 2W7GA 2Z9UA 3DR4A 2EH6A 1BQDA 2BIAA 1WYVB 3MC6C 4OYTA 1AHFA 3MEBA 3BCAA 1EG5A 3F9TA 3WZFA 3BV0A 1VJOA 1GC2A 5E4ZA 4WYAA 2VGTA 3JU7A 4RJ0A 2C7TA 4RIZA 4A0FA 3BWNC 1TATA 1GDEA 4W1WA 2X8UA 3RCHB 3CQ5A 4CXRA 3FQAA 1M4NA 2W7HA 4F5GA 2YKUA 1IAYA 3EIBA 5EAVA 1DJUA 2OATA 3WCNA 3NTJA 3RBFA 1YNUA 4ADCA 5DJ1A 5G09A 2VMPA 3RBLA 2Z9WA 4A72A 1DKAA 1TOEA 1E5EA 4LW2A 4XJPA 3N75A 2DR1A 3E77A 3OP7A 1WYUA 1IUGA 1BS0A 4A6TA 3JW9A 1OHYA 3DRDA 3NDNA 5EAAA 3ZZKA 1MAPA 1IX7A 1TOGA 4IXOA 4J5UA 3LVMA 4EMYA 1CJ0A 2YKVA 1GC3A 1E5FA 2BI9A
chains in the Genus database with same CATH topology
1QIRA 3I5TA 1O61A 5HDMA 2W7KA 2ZY3A 3QPGA 4ATPA 4Q75A 4M2KA 3DZZA 2DKBA 3JWAA 4Y0DA 2CY8A 1V72A 3BB8A 3VAXA 3B46A 3JZLA 5G0AA 3ZZJA 1JF9A 3ACZA 1IX6A 1IVRA 1N2TA 1OATA 1AHXA 1SZUA 3EI5A 3FVXA 4NOGA 3USFA 3WGCA 5M4BA 1AY8A 1GBNA 2ZSLA 4ISYA 4XAUA 1SZSA 1RVUA 1FG3A 3FZ7A 4XK1A 3R9AA 1MDOA 1VEFA 2R5CB 4OTLA 1ASMA 4GE7A 5IWQA 2Z61A 1GD9A 5FT5A 1V2FA 3F0HA 1BKGA 1QJ3A 2W7DA 5FT4A 4FFCA 3K28A 4ZM4A 1WYTA 3AEJA 4CVQA 1AJSA 4IY7A 1ECXA 2FYFA 2AY6A 2EYQA 2VMRA 1H0CA 3WKRA 1LW5A 4F4EA 1LW4A 3P6KA 4O6ZA 3ZRPA 1ZODA 1ASCA 3CQ6A 3PGYA 5FT6A 1VP4A 2BI5A 2YCPA 4OCAA 1V2DA 2O1BA 3LWSA 2CINA 4XJLA 1LS3A 4ITGA 5FT8A 2BWOA 4F5MA 3ZRRA 2W7JA 4U1TA 2JISA 3N4XA 2ZC0A 3RCHA 4QGRA 1ZC9A 2HP1A 3E6GA 2FKIA 3WCOA 1S0AA 1T3IA 1W7LA 3DODA 4F5LA 2ZYJA 4XJOA 4JF1A 2CANA 2D7ZA 2E54A 4WXBA 4Y0IA 1LK9A 3K40A 3A8UX 4K2BA 5D5SA 1XI9A 2HP2A 2Z1YA 3ATHA 1YJZA 3GSBA 3QGUA 3BCBA 3D6KA 3WX9A 4DGTA 3E2FA 1M0NA 2Q7WA 3N4SA 3H9XA 2AY8A 4OMAA 4AOAA 4WLHA 1X28A 2ZSMA 4H51A 3L8AA 3LG0A 1V2EA 3G8MA 1BJWA 2VGUA 4GDYA 1M7YA 3WLXA 4ADBA 4F5HA 1ORDA 3NUIA 5EFSA 3FZ6A 2BYLA 4M2JA 1SF2A 3OKSA 1ARSA 1MAQA 2O7CA 5M49A 2R5CA 4H63Q 4HVKA 1DGDA 4LNLA 1OXOA 1DJ9A 1W7MA 2VI9A 4IXZA 3RQ1A 1X29A 1AJSB 3QBOA 2WKAA 1AMQA 1PG8A 3HT4A 3BN1A 1ASNA 4IW7A 2X5DA 5F8VA 3NYSA 2AY7A 2VYCA 2CFBA 3FQ7A 1O4SA 1LC5A 3BWNA 4WYDA 3N7NA 1CL2A 1I43A 2VGWA 2JJHA 3NUBA 2VMNA 4RLGA 1O69A 4UOYA 2G7JA 4WB0A 4KYOA 5I92A 5DB5A 2VMOA 1WKHA 1TOKA 2FNUA 4W1XA 5HHYA 3ZRQA 2VLFA 4BMKA 1ELQA 4UQVA 1M0OA 2GMUA 2YHKA 3B1EA 2Z1ZA 2D66A 2CJHA 4A6UA 2QB2A 1JS6A 1KMKA 3HLMA 1O62A 1WSTA 3NU8A 3R4TA 3FVSA 1AAWA 1B9IA 1C7NA 2CSTA 3EI8A 5M46A 3EUCA 1ASLA 4GE4A 4TV7A 4W1VA 4IXSA 3T32A 2BHXA 3PAAA 4B9BA 5EQCA 2X3LA 2HOZA 4GSAA 1QGNA 1YOOA 2FNIA 1TPLA 1JS3A 1LC8A 3EI7A 4E3RA 1IX8A 2YKXA 3DR7A 4P7YA 1Z3ZA 1N8PA 4DBCA 2OKJA 5E5IA 1BJOA 4AZJA 1RVYA 3ASAA 3P1TA 2DGMA 3FKDA 1OHVA 3CAIA 2DKJA 3LVJA 3N5MA 4W8IA 3WGBA 5D95A 2YOBA 4WYFA 2F8JA 4AO9A 4WXFA 3FQ8A 2VMQA 1ASEA 2CB1A 3H7FA 3HVYA 3FTBA 3KGXA 2AY9A 2ZUKA 4UHOA 3E2ZB 3PA9A 4XEWA 4L0OA 3WKSA 4AO4A 1G4XA 3HDOA 1AHGA 4MGRA 2VGVA 2VIBA 2FN6A 5DX5A 2GQNA 3EZ1A 1TOIA 3AEJC 1YJYA 3DYDA 2D7YA 1AHEA 3DXWA 3PD6B 1GCKA 3RUYA 4F5FA 4ZM3A 4RAEA 4JE5A 2BKWA 3GJUA 4DQ6A 2OQXA 1EJIA 1X2AA 3TFTA 3MKJA 1FC4A 4N0BA 1PMMA 2CTZA 1S07A 2HUFA 4E1OA 1ARHA 2VGZA 1C9CA 4WB0B 2EZ1A 5LH9A 1QISA 1D7SA 2D64A 2RFVA 3K7YA 3QN6A 4EU1A 5BJ4A 1OXPA 5G4JA 4A0HA 1KMJA 1QJ5A 4J8LA 5F9SA 3NRAA 3QM2A 4Q31A 1Z7DA 5G2QA 4ZLVA 1AX4A 1W3UA 3ELPA 3HL2A 4WXGA 3IHJA 3UWCA 4BHDA 4R8DA 1AIBA 4JEYA 1SZKA 2TPLA 1AKBA 3GZDC 1CQ8A 2W8TA 3LV2A 2AY4A 3AEPA 3AEMC 3HMUA 3PJ0A 4W91A 4ZDLA 1QITA 1C7GA 1KL2A 2OKKA 4IX8A 3A9YA 3EI9A 1M6SA 3FCRA 4BQ0A 3QI6A 1ARIA 2AY5A 2VMTA 3BC8A 3WY7A 1C7OA 3VK2A 2HUUA 4A0GA 2JJEA 4ADDA 3ELEA 2VI8A 3KE3A 4K2IA 3II0A 3TATA 1WYTB 3PDBA 4F5KA 3N4RA 2E7JA 1SVVA 4A6RA 1S08A 4FL0A 4K05A 4AZKA 3EI6A 5AX8A 2AY1A 3AATA 2R0TA 1BJOB 3PDXA 2YCNA 3JTXA 1D7RA 4RJYA 4RITA 1AIAA 3NYUA 1DFOA 4UHNA 3MAFB 5EIGB 5C6UA 1M0QA 2DGKA 3LVKA 3I4JA 3TCMA 1B4XA 2ORDA 2ZP7A 4PVFA 2PB0A 4JE5D 5M4DA 3N0LA 2D65A 3CQ4A 3GZDA 1UU1A 3UE8A 1GEWA 3PD6A 1S06A 3EZSA 2D61A 5DJ9A 2XH1A 1ASBA 2BWPA 3AOWA 3FDBA 2OGAA 2X5FA 1G7WA 3GWPA 2EGYA 1FG7A 2GB3A 2JJGA 2W8JA 4U2HA 4JEXA 4WBTA 3HBXA 1KKPA 1YIYA 1U08A 3RI6A 2D63A 3AENA 2ZY2A 3DU4A 2WK7A 1YAAA 3NU7A 2R5EA 2KFPA 1W23A 4Q6RA 4OC9A 4CBRA 2WB6A 1KKJA 2AY2A 4R5ZA 3LVLB 3MADA 4ZASA 1AAMA 2EO5A 2GSAA 2ZY5A 2O0RA 1AKAA 1X0MA 1ARGA 1GC4A 2Z67A 2W7IA 1CZCA 1BT4A 1MGVA 1AKCA 2JG2A 4LW4A 3CBFA 2VMSA 1TOJA 2YKYA 2VMWA 5G4IA 2W8UA 5BJ3A 1CS1A 3FFHA 4KXKA 4WP0A 3BCXA 4CBSA 3GR9A 4EB5A 3A2BA 3BS8A 3PDBB 4Y0HA 3FDDA 2YRRA 4RKCA 1P3WA 2V1PA 2WK9A 2G6WA 4ZDOA 2YCTA 4JF0A 1I41A 2FM1A 4LC3A 1OHWA 1JG8A 3E2YA 4WYEA 3I16A 2BI3A 1WKGA 1ZOBA 2QBTA 1ASDA 1AY4A 3MC6A 5K8BA 3AENB 1ASAA 2R2NA 1GEXA 3B1CA 4ZSYA 1UU2A 3ISLA 1B5OA 4LNMA 4MSOA 2HOYA 4B98A 2AY3A 2QMAA 4ZWMA 1TASA 4UHMA 3VK3A 2HORA 1PMOA 4MKKA 1AICA 1ELUA 1RV3A 3NYTA 4TMRA 2DGLA 1CQ6A 1J04A 2CJDA 4W5KA 1D7UA 2Z20A 4K2MA 2W8WA 2HOXA 3NX3A 1TARA 5E3KA 4WYCA 5TF5A 3GBXA 4MQQA 3B1DA 5G2PA 4F5JA 2W7FA 3EIAA 3A9ZA 1Y4IA 3Q8NA 4N0WA 1AJRA 1QZ9A 3VP6A 1I48A 1YIZA 4MQRA 3TQXA 1W7NA 4GE9A 1BJNA 1MDXA 2BIGA 3F6TA 1AHYA 2DOUA 4RKDA 4AH3A 4OBUA 2BIEA 2AEUA 4M2MA 2W7MA 4JEWA 2HZPA 4PFNA 5HXXA 4MKJA 1MDZA 4IYOB 1CL1A 5EUNA 5EUDA 1ASGA 3TFUA 2VMXA 2BI1A 1CZEA 3LY1A 1EQBA 1D7VA 1BJ4A 4OBVA 1J32A 3MBBA 3BWOA 4JEVA 3VOMA 1DGEA 3QHXA 4E77A 7AATA 2NMPA 2PB2A 1BQAA 1GEYA 3AOVA 1AY5A 2QA3A 1ARTA 2YRIA 4BA5A 3VK4A 3E2ZA 2BWNA 4R5FA 2QLRA 1ASFA 1C4KA 3FSLA 4GRXA 4R2NA 2CH2A 1LKCA 3G0TA 1WYVA 1KL1A 4Q76A 3AEOA 5KTBA 2EZ2A 4RM1A 4ATQA 3DC1A 4E3QA 4WYGA 2AEVA 2D5YA 4PIWA 3GETA 4ZSWA 2A1VA 1YJSA 2ZY4A 3B8XA 1AMRA 3ECDA 4ZAHA 2W7LA 1B5PA 1G7XA 4XQ2A 4CXQA 3FZ8A 2OGEA 3L44A 3W1HA 2QB3A 4ITXA 9AATA 2Z9VA 3GZCA 1MLZA 3W1JA 3AV7A 1CQ7A 2VLHA 3FVUA 2C81A 2VGSA 1XEYA 2E7IA 1D2FA 1M32A 4BA4A 3HQTA 1MLYA 1H1CA 1IAXA 1M0PA 1PFFA 8AATA 1AMAA 3PIUA 3AEMA 2WK8A 3E9KA 2VMZA 3NNKA 2C0RA 5LHAA 2QSRA 2E7UA 2VMUA 1LC7A 3DXVA 3PPLA 1BW0A 3FRKA 4MQPA 3FD0A 1UU0A 3G7QA 4GEBA 3M5UA 4PFFA 3KGWA 1SPAA 2W8VA 1WYUB 3MAUA 1IBJA 2C44A 2FQ6A 1B9HA 2GMSA 2VIAA 4WLJA 3W1IA 1IJIA 1AMSA 2BI2A 2VMVA 4EB7A 1DJEA 4A0RA 2PO3A 3ASBA 5J8QA 4I8AA 1B8GA 4KAMA 2JGTA 4JEZA 4ZDPA 2BYJA 3IF2A 3COGA 1I29A 2CH1A 2ZJGA 1S09A 1C0NA 4IYOA 3JWBA 2EPJA 3KKIA 1RV4A 4MY5A 4HF8A 1N31A 5JAYA 2JJFA 3MAFA 2W7EA 5EIGA 2CJGA 3UAKA 4A00A 3H14A 4ZWVA 4WD2A 1G4VA 4F5IA 2XBNA 4ADEA 4OT8A 5EUEA 1SFFA 2HUIA 4EFFA 1GC0A 3AELA 2AATA 3FFRA 1DTYA 2VMYA 3A9XA 4LNJA 4P3MA 4XJMA 4TN4A 2V0YA 2Z9XA 1UKJA 2W7GA 2Z9UA 3DR4A 2EH6A 1BQDA 2BIAA 1WYVB 3MC6C 4OYTA 1AHFA 3MEBA 3BCAA 1EG5A 3F9TA 3WZFA 3BV0A 1VJOA 1GC2A 5E4ZA 4WYAA 2VGTA 3JU7A 4RJ0A 2C7TA 4RIZA 4A0FA 3BWNC 1TATA 1GDEA 4W1WA 2X8UA 3RCHB 3CQ5A 4CXRA 3FQAA 1M4NA 2W7HA 4F5GA 2YKUA 1IAYA 3EIBA 5EAVA 1DJUA 2OATA 3WCNA 3NTJA 3RBFA 1YNUA 4ADCA 5DJ1A 5G09A 2VMPA 3RBLA 2Z9WA 4A72A 1DKAA 1TOEA 1E5EA 4LW2A 4XJPA 3N75A 2DR1A 3E77A 3OP7A 1WYUA 1IUGA 1BS0A 4A6TA 3JW9A 1OHYA 3DRDA 3NDNA 5EAAA 3ZZKA 1MAPA 1IX7A 1TOGA 4IXOA 4J5UA 3LVMA 4EMYA 1CJ0A 2YKVA 1GC3A 1E5FA 2BI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QIR A;  3I5T A;  1O61 A;  5HDM A;  2W7K A;  2ZY3 A;  3QPG A;  4ATP A;  4Q75 A;  4M2K A;  3DZZ A;  2DKB A;  3JWA A;  4Y0D A;  2CY8 A;  1V72 A;  3BB8 A;  3VAX A;  3B46 A;  3JZL A;  5G0A A;  3ZZJ A;  1JF9 A;  3ACZ A;  1IX6 A;  1IVR A;  1N2T A;  1OAT A;  1AHX A;  1SZU A;  3EI5 A;  3FVX A;  4NOG A;  3USF A;  3WGC A;  5M4B A;  1AY8 A;  1GBN A;  2ZSL A;  4ISY A;  4XAU A;  1SZS A;  1RVU A;  1FG3 A;  3FZ7 A;  4XK1 A;  3R9A A;  1MDO A;  1VEF A;  2R5C B;  4OTL A;  1ASM A;  4GE7 A;  5IWQ A;  2Z61 A;  1GD9 A;  5FT5 A;  1V2F A;  3F0H A;  1BKG A;  1QJ3 A;  2W7D A;  5FT4 A;  4FFC A;  3K28 A;  4ZM4 A;  1WYT A;  3AEJ A;  4CVQ A;  1AJS A;  4IY7 A;  1ECX A;  2FYF A;  2AY6 A;  2VMR A;  1H0C A;  3WKR A;  1LW5 A;  4F4E A;  1LW4 A;  3P6K A;  4O6Z A;  3ZRP A;  1ZOD A;  1ASC A;  3CQ6 A;  3PGY A;  5FT6 A;  1VP4 A;  2BI5 A;  2YCP A;  4OCA A;  1V2D A;  2O1B A;  3LWS A;  2CIN A;  4XJL A;  1LS3 A;  4ITG A;  5FT8 A;  2BWO A;  4F5M A;  3ZRR A;  2W7J A;  4U1T A;  2JIS A;  2ZC0 A;  3RCH A;  4QGR A;  1ZC9 A;  2HP1 A;  3E6G A;  3WCO A;  1S0A A;  1T3I A;  1W7L A;  3DOD A;  4F5L A;  2ZYJ A;  4XJO A;  4JF1 A;  2CAN A;  2D7Z A;  2E54 A;  4WXB A;  4Y0I A;  1LK9 A;  3K40 A;  3A8U X;  4K2B A;  5D5S A;  1XI9 A;  2HP2 A;  2Z1Y A;  3ATH A;  1YJZ A;  3GSB A;  3QGU A;  3BCB A;  3D6K A;  3WX9 A;  4DGT A;  3E2F A;  1M0N A;  2Q7W A;  2AY8 A;  4OMA A;  4AOA A;  4WLH A;  1X28 A;  2ZSM A;  4H51 A;  3L8A A;  3LG0 A;  1V2E A;  3G8M A;  1BJW A;  2VGU A;  4GDY A;  1M7Y A;  3WLX A;  4ADB A;  4F5H A;  1ORD A;  3NUI A;  5EFS A;  3FZ6 A;  2BYL A;  4M2J A;  1SF2 A;  3OKS A;  1ARS A;  1MAQ A;  2O7C A;  5M49 A;  2R5C A;  4HVK A;  1DGD A;  4LNL A;  1OXO A;  1DJ9 A;  1W7M A;  2VI9 A;  4IXZ A;  3RQ1 A;  1X29 A;  1AJS B;  3QBO A;  2WKA A;  1AMQ A;  1PG8 A;  3HT4 A;  3BN1 A;  1ASN A;  4IW7 A;  2X5D A;  5F8V A;  3NYS A;  2AY7 A;  2VYC A;  2CFB A;  3FQ7 A;  1O4S A;  1LC5 A;  3BWN A;  4WYD A;  1CL2 A;  1I43 A;  2VGW A;  2JJH A;  3NUB A;  2VMN A;  4RLG A;  1O69 A;  4UOY A;  4WB0 A;  4KYO A;  5I92 A;  5DB5 A;  2VMO A;  1WKH A;  1TOK A;  2FNU A;  4W1X A;  5HHY A;  3ZRQ A;  2VLF A;  4BMK A;  1ELQ A;  4UQV A;  1M0O A;  2GMU A;  2YHK A;  3B1E A;  2Z1Z A;  2D66 A;  2CJH A;  4A6U A;  2QB2 A;  1JS6 A;  1KMK A;  3HLM A;  1O62 A;  1WST A;  3NU8 A;  3R4T A;  3FVS A;  1AAW A;  1B9I A;  1C7N A;  2CST A;  3EI8 A;  5M46 A;  3EUC A;  1ASL A;  4GE4 A;  4TV7 A;  4W1V A;  4IXS A;  3T32 A;  2BHX A;  3PAA A;  4B9B A;  5EQC A;  2X3L A;  2HOZ A;  4GSA A;  1QGN A;  1YOO A;  2FNI A;  1TPL A;  1JS3 A;  1LC8 A;  3EI7 A;  4E3R A;  1IX8 A;  2YKX A;  3DR7 A;  4P7Y A;  1Z3Z A;  1N8P A;  4DBC A;  2OKJ A;  5E5I A;  1BJO A;  4AZJ A;  1RVY A;  3ASA A;  3P1T A;  2DGM A;  3FKD A;  1OHV A;  3CAI A;  2DKJ A;  3LVJ A;  3N5M A;  4W8I A;  3WGB A;  5D95 A;  2YOB A;  4WYF A;  2F8J A;  4AO9 A;  4WXF A;  3FQ8 A;  2VMQ A;  1ASE A;  2CB1 A;  3H7F A;  3HVY A;  3FTB A;  3KGX A;  2AY9 A;  2ZUK A;  4UHO A;  3E2Z B;  3PA9 A;  4XEW A;  4L0O A;  3WKS A;  4AO4 A;  1G4X A;  3HDO A;  1AHG A;  4MGR A;  2VGV A;  2VIB A;  2FN6 A;  5DX5 A;  2GQN A;  3EZ1 A;  1TOI A;  3AEJ C;  1YJY A;  3DYD A;  2D7Y A;  1AHE A;  3DXW A;  3PD6 B;  1GCK A;  3RUY A;  4F5F A;  4ZM3 A;  4RAE A;  4JE5 A;  2BKW A;  3GJU A;  4DQ6 A;  2OQX A;  1EJI A;  1X2A A;  3TFT A;  3MKJ A;  1FC4 A;  4N0B A;  1PMM A;  2CTZ A;  1S07 A;  2HUF A;  4E1O A;  1ARH A;  2VGZ A;  1C9C A;  4WB0 B;  2EZ1 A;  5LH9 A;  1QIS A;  1D7S A;  2D64 A;  2RFV A;  3K7Y A;  3QN6 A;  4EU1 A;  5BJ4 A;  1OXP A;  5G4J A;  4A0H A;  1KMJ A;  1QJ5 A;  4J8L A;  5F9S A;  3NRA A;  3QM2 A;  4Q31 A;  1Z7D A;  5G2Q A;  4ZLV A;  1AX4 A;  1W3U A;  3ELP A;  3HL2 A;  4WXG A;  3IHJ A;  3UWC A;  4BHD A;  4R8D A;  1AIB A;  4JEY A;  1SZK A;  2TPL A;  1AKB A;  3GZD C;  1CQ8 A;  2W8T A;  3LV2 A;  2AY4 A;  3AEP A;  3AEM C;  3HMU A;  3PJ0 A;  4W91 A;  4ZDL A;  1QIT A;  1C7G A;  1KL2 A;  2OKK A;  4IX8 A;  3A9Y A;  3EI9 A;  1M6S A;  3FCR A;  4BQ0 A;  3QI6 A;  1ARI A;  2AY5 A;  2VMT A;  3BC8 A;  3WY7 A;  1C7O A;  3VK2 A;  2HUU A;  4A0G A;  2JJE A;  4ADD A;  3ELE A;  2VI8 A;  3KE3 A;  4K2I A;  3II0 A;  3TAT A;  1WYT B;  3PDB A;  4F5K A;  2E7J A;  1SVV A;  4A6R A;  1S08 A;  4FL0 A;  4AZK A;  3EI6 A;  5AX8 A;  2AY1 A;  3AAT A;  2R0T A;  1BJO B;  3PDX A;  2YCN A;  3JTX A;  1D7R A;  4RJY A;  4RIT A;  1AIA A;  3NYU A;  1DFO A;  4UHN A;  3MAF B;  5EIG B;  5C6U A;  1M0Q A;  2DGK A;  3LVK A;  3I4J A;  3TCM A;  1B4X A;  2ORD A;  2ZP7 A;  4PVF A;  2PB0 A;  4JE5 D;  5M4D A;  3N0L A;  2D65 A;  3CQ4 A;  3GZD A;  1UU1 A;  3UE8 A;  1GEW A;  3PD6 A;  1S06 A;  3EZS A;  2D61 A;  5DJ9 A;  2XH1 A;  1ASB A;  2BWP A;  3AOW A;  3FDB A;  2OGA A;  2X5F A;  1G7W A;  3GWP A;  2EGY A;  1FG7 A;  2GB3 A;  2JJG A;  2W8J A;  4U2H A;  4JEX A;  4WBT A;  3HBX A;  1KKP A;  1YIY A;  1U08 A;  3RI6 A;  2D63 A;  3AEN A;  2ZY2 A;  3DU4 A;  2WK7 A;  1YAA A;  3NU7 A;  2R5E A;  1W23 A;  4Q6R A;  4OC9 A;  4CBR A;  1KKJ A;  2AY2 A;  4R5Z A;  3LVL B;  3MAD A;  4ZAS A;  1AAM A;  2EO5 A;  2GSA A;  2ZY5 A;  2O0R A;  1AKA A;  1X0M A;  1ARG A;  1GC4 A;  2Z67 A;  2W7I A;  1CZC A;  1BT4 A;  1MGV A;  1AKC A;  2JG2 A;  4LW4 A;  3CBF A;  2VMS A;  1TOJ A;  2YKY A;  2VMW A;  5G4I A;  2W8U A;  5BJ3 A;  1CS1 A;  3FFH A;  4KXK A;  4WP0 A;  3BCX A;  4CBS A;  3GR9 A;  4EB5 A;  3A2B A;  3BS8 A;  3PDB B;  4Y0H A;  3FDD A;  2YRR A;  4RKC A;  1P3W A;  2V1P A;  2WK9 A;  2G6W A;  4ZDO A;  2YCT A;  4JF0 A;  1I41 A;  2FM1 A;  4LC3 A;  1OHW A;  1JG8 A;  3E2Y A;  4WYE A;  3I16 A;  2BI3 A;  1WKG A;  1ZOB A;  2QBT A;  1ASD A;  1AY4 A;  3MC6 A;  5K8B A;  3AEN B;  1ASA A;  2R2N A;  1GEX A;  3B1C A;  4ZSY A;  1UU2 A;  3ISL A;  1B5O A;  4LNM A;  4MSO A;  2HOY A;  4B98 A;  2AY3 A;  2QMA A;  4ZWM A;  1TAS A;  4UHM A;  3VK3 A;  2HOR A;  1PMO A;  4MKK A;  1AIC A;  1ELU A;  1RV3 A;  3NYT A;  4TMR A;  2DGL A;  1CQ6 A;  1J04 A;  2CJD A;  4W5K A;  1D7U A;  2Z20 A;  4K2M A;  2W8W A;  2HOX A;  3NX3 A;  1TAR A;  5E3K A;  4WYC A;  5TF5 A;  3GBX A;  4MQQ A;  3B1D A;  5G2P A;  4F5J A;  2W7F A;  3EIA A;  3A9Z A;  1Y4I A;  3Q8N A;  4N0W A;  1AJR A;  1QZ9 A;  3VP6 A;  1I48 A;  1YIZ A;  4MQR A;  3TQX A;  1W7N A;  4GE9 A;  1BJN A;  1MDX A;  2BIG A;  3F6T A;  1AHY A;  2DOU A;  4RKD A;  4AH3 A;  4OBU A;  2BIE A;  2AEU A;  4M2M A;  2W7M A;  4JEW A;  2HZP A;  4PFN A;  5HXX A;  4MKJ A;  1MDZ A;  4IYO B;  1CL1 A;  5EUN A;  5EUD A;  1ASG A;  3TFU A;  2VMX A;  2BI1 A;  1CZE A;  3LY1 A;  1EQB A;  1D7V A;  1BJ4 A;  4OBV A;  1J32 A;  3MBB A;  3BWO A;  4JEV A;  3VOM A;  1DGE A;  3QHX A;  4E77 A;  7AAT A;  2NMP A;  2PB2 A;  1BQA A;  1GEY A;  3AOV A;  1AY5 A;  2QA3 A;  1ART A;  2YRI A;  4BA5 A;  3VK4 A;  3E2Z A;  2BWN A;  4R5F A;  2QLR A;  1ASF A;  1C4K A;  3FSL A;  4GRX A;  4R2N A;  2CH2 A;  1LKC A;  3G0T A;  1WYV A;  1KL1 A;  4Q76 A;  3AEO A;  2EZ2 A;  4RM1 A;  4ATQ A;  3DC1 A;  4E3Q A;  4WYG A;  2AEV A;  2D5Y A;  4PIW A;  3GET A;  4ZSW A;  1YJS A;  2ZY4 A;  3B8X A;  1AMR A;  3ECD A;  4ZAH A;  2W7L A;  1B5P A;  1G7X A;  4XQ2 A;  4CXQ A;  3FZ8 A;  2OGE A;  3L44 A;  3W1H A;  2QB3 A;  4ITX A;  9AAT A;  2Z9V A;  3GZC A;  1MLZ A;  3W1J A;  3AV7 A;  1CQ7 A;  2VLH A;  3FVU A;  2C81 A;  2VGS A;  1XEY A;  2E7I A;  1D2F A;  1M32 A;  4BA4 A;  3HQT A;  1MLY A;  1H1C A;  1IAX A;  1M0P A;  1PFF A;  8AAT A;  1AMA A;  3PIU A;  3AEM A;  2WK8 A;  3E9K A;  2VMZ A;  3NNK A;  2C0R A;  5LHA A;  2E7U A;  2VMU A;  1LC7 A;  3DXV A;  3PPL A;  1BW0 A;  3FRK A;  4MQP A;  3FD0 A;  1UU0 A;  3G7Q A;  4GEB A;  3M5U A;  4PFF A;  3KGW A;  1SPA A;  2W8V A;  1WYU B;  3MAU A;  1IBJ A;  2C44 A;  2FQ6 A;  1B9H A;  2GMS A;  2VIA A;  4WLJ A;  3W1I A;  1IJI A;  1AMS A;  2BI2 A;  2VMV A;  4EB7 A;  1DJE A;  4A0R A;  2PO3 A;  3ASB A;  5J8Q A;  4I8A A;  1B8G A;  4KAM A;  2JGT A;  4JEZ A;  4ZDP A;  2BYJ A;  3IF2 A;  3COG A;  1I29 A;  2CH1 A;  2ZJG A;  1S09 A;  1C0N A;  4IYO A;  3JWB A;  2EPJ A;  3KKI A;  1RV4 A;  4MY5 A;  4HF8 A;  1N31 A;  5JAY A;  2JJF A;  3MAF A;  2W7E A;  5EIG A;  2CJG A;  3UAK A;  4A00 A;  3H14 A;  4ZWV A;  4WD2 A;  1G4V A;  4F5I A;  2XBN A;  4ADE A;  4OT8 A;  5EUE A;  1SFF A;  2HUI A;  4EFF A;  1GC0 A;  3AEL A;  2AAT A;  3FFR A;  1DTY A;  2VMY A;  3A9X A;  4LNJ A;  4P3M A;  4XJM A;  4TN4 A;  2V0Y A;  2Z9X A;  1UKJ A;  2W7G A;  2Z9U A;  3DR4 A;  2EH6 A;  1BQD A;  2BIA A;  1WYV B;  3MC6 C;  4OYT A;  1AHF A;  3MEB A;  3BCA A;  1EG5 A;  3F9T A;  3WZF A;  3BV0 A;  1VJO A;  1GC2 A;  5E4Z A;  4WYA A;  2VGT A;  3JU7 A;  4RJ0 A;  2C7T A;  4RIZ A;  4A0F A;  3BWN C;  1TAT A;  1GDE A;  4W1W A;  2X8U A;  3RCH B;  3CQ5 A;  4CXR A;  3FQA A;  1M4N A;  2W7H A;  4F5G A;  2YKU A;  1IAY A;  3EIB A;  5EAV A;  1DJU A;  2OAT A;  3WCN A;  3NTJ A;  3RBF A;  1YNU A;  4ADC A;  5DJ1 A;  5G09 A;  2VMP A;  3RBL A;  2Z9W A;  4A72 A;  1DKA A;  1TOE A;  1E5E A;  4LW2 A;  4XJP A;  3N75 A;  2DR1 A;  3E77 A;  3OP7 A;  1WYU A;  1IUG A;  1BS0 A;  4A6T A;  3JW9 A;  1OHY A;  3DRD A;  3NDN A;  5EAA A;  3ZZK A;  1MAP A;  1IX7 A;  1TOG A;  4IXO A;  4J5U A;  3LVM A;  4EMY A;  1CJ0 A;  2YKV A;  1GC3 A;  1E5F A;  2BI9 A; 
#chains in the Genus database with same CATH topology
 1QIR A;  3I5T A;  1O61 A;  5HDM A;  2W7K A;  2ZY3 A;  3QPG A;  4ATP A;  4Q75 A;  4M2K A;  3DZZ A;  2DKB A;  3JWA A;  4Y0D A;  2CY8 A;  1V72 A;  3BB8 A;  3VAX A;  3B46 A;  3JZL A;  5G0A A;  3ZZJ A;  1JF9 A;  3ACZ A;  1IX6 A;  1IVR A;  1N2T A;  1OAT A;  1AHX A;  1SZU A;  3EI5 A;  3FVX A;  4NOG A;  3USF A;  3WGC A;  5M4B A;  1AY8 A;  1GBN A;  2ZSL A;  4ISY A;  4XAU A;  1SZS A;  1RVU A;  1FG3 A;  3FZ7 A;  4XK1 A;  3R9A A;  1MDO A;  1VEF A;  2R5C B;  4OTL A;  1ASM A;  4GE7 A;  5IWQ A;  2Z61 A;  1GD9 A;  5FT5 A;  1V2F A;  3F0H A;  1BKG A;  1QJ3 A;  2W7D A;  5FT4 A;  4FFC A;  3K28 A;  4ZM4 A;  1WYT A;  3AEJ A;  4CVQ A;  1AJS A;  4IY7 A;  1ECX A;  2FYF A;  2AY6 A;  2EYQ A;  2VMR A;  1H0C A;  3WKR A;  1LW5 A;  4F4E A;  1LW4 A;  3P6K A;  4O6Z A;  3ZRP A;  1ZOD A;  1ASC A;  3CQ6 A;  3PGY A;  5FT6 A;  1VP4 A;  2BI5 A;  2YCP A;  4OCA A;  1V2D A;  2O1B A;  3LWS A;  2CIN A;  4XJL A;  1LS3 A;  4ITG A;  5FT8 A;  2BWO A;  4F5M A;  3ZRR A;  2W7J A;  4U1T A;  2JIS A;  3N4X A;  2ZC0 A;  3RCH A;  4QGR A;  1ZC9 A;  2HP1 A;  3E6G A;  2FKI A;  3WCO A;  1S0A A;  1T3I A;  1W7L A;  3DOD A;  4F5L A;  2ZYJ A;  4XJO A;  4JF1 A;  2CAN A;  2D7Z A;  2E54 A;  4WXB A;  4Y0I A;  1LK9 A;  3K40 A;  3A8U X;  4K2B A;  5D5S A;  1XI9 A;  2HP2 A;  2Z1Y A;  3ATH A;  1YJZ A;  3GSB A;  3QGU A;  3BCB A;  3D6K A;  3WX9 A;  4DGT A;  3E2F A;  1M0N A;  2Q7W A;  3N4S A;  3H9X A;  2AY8 A;  4OMA A;  4AOA A;  4WLH A;  1X28 A;  2ZSM A;  4H51 A;  3L8A A;  3LG0 A;  1V2E A;  3G8M A;  1BJW A;  2VGU A;  4GDY A;  1M7Y A;  3WLX A;  4ADB A;  4F5H A;  1ORD A;  3NUI A;  5EFS A;  3FZ6 A;  2BYL A;  4M2J A;  1SF2 A;  3OKS A;  1ARS A;  1MAQ A;  2O7C A;  5M49 A;  2R5C A;  4H63 Q;  4HVK A;  1DGD A;  4LNL A;  1OXO A;  1DJ9 A;  1W7M A;  2VI9 A;  4IXZ A;  3RQ1 A;  1X29 A;  1AJS B;  3QBO A;  2WKA A;  1AMQ A;  1PG8 A;  3HT4 A;  3BN1 A;  1ASN A;  4IW7 A;  2X5D A;  5F8V A;  3NYS A;  2AY7 A;  2VYC A;  2CFB A;  3FQ7 A;  1O4S A;  1LC5 A;  3BWN A;  4WYD A;  3N7N A;  1CL2 A;  1I43 A;  2VGW A;  2JJH A;  3NUB A;  2VMN A;  4RLG A;  1O69 A;  4UOY A;  2G7J A;  4WB0 A;  4KYO A;  5I92 A;  5DB5 A;  2VMO A;  1WKH A;  1TOK A;  2FNU A;  4W1X A;  5HHY A;  3ZRQ A;  2VLF A;  4BMK A;  1ELQ A;  4UQV A;  1M0O A;  2GMU A;  2YHK A;  3B1E A;  2Z1Z A;  2D66 A;  2CJH A;  4A6U A;  2QB2 A;  1JS6 A;  1KMK A;  3HLM A;  1O62 A;  1WST A;  3NU8 A;  3R4T A;  3FVS A;  1AAW A;  1B9I A;  1C7N A;  2CST A;  3EI8 A;  5M46 A;  3EUC A;  1ASL A;  4GE4 A;  4TV7 A;  4W1V A;  4IXS A;  3T32 A;  2BHX A;  3PAA A;  4B9B A;  5EQC A;  2X3L A;  2HOZ A;  4GSA A;  1QGN A;  1YOO A;  2FNI A;  1TPL A;  1JS3 A;  1LC8 A;  3EI7 A;  1KAF A;  4E3R A;  1IX8 A;  2YKX A;  3DR7 A;  4P7Y A;  1Z3Z A;  1N8P A;  4DBC A;  2OKJ A;  5E5I A;  1BJO A;  4AZJ A;  1RVY A;  3ASA A;  3P1T A;  2DGM A;  3FKD A;  1OHV A;  3CAI A;  2DKJ A;  3LVJ A;  3N5M A;  4W8I A;  3WGB A;  5D95 A;  2YOB A;  4WYF A;  2F8J A;  4AO9 A;  4WXF A;  3FQ8 A;  2VMQ A;  1ASE A;  2CB1 A;  3H7F A;  3HVY A;  3FTB A;  3KGX A;  2AY9 A;  2ZUK A;  4UHO A;  3E2Z B;  3PA9 A;  4XEW A;  4L0O A;  3WKS A;  4AO4 A;  1G4X A;  3HDO A;  1AHG A;  4MGR A;  2VGV A;  2VIB A;  2FN6 A;  5DX5 A;  2GQN A;  3EZ1 A;  1TOI A;  3AEJ C;  1YJY A;  3DYD A;  2D7Y A;  1AHE A;  3DXW A;  3PD6 B;  1GCK A;  3RUY A;  4F5F A;  4ZM3 A;  4RAE A;  4JE5 A;  2BKW A;  3GJU A;  4DQ6 A;  2OQX A;  1EJI A;  1X2A A;  3TFT A;  3MKJ A;  1FC4 A;  4N0B A;  1PMM A;  2CTZ A;  1S07 A;  2HUF A;  4E1O A;  1ARH A;  2VGZ A;  1C9C A;  4WB0 B;  2EZ1 A;  5LH9 A;  1QIS A;  1D7S A;  2D64 A;  2RFV A;  3K7Y A;  3QN6 A;  4EU1 A;  5BJ4 A;  1OXP A;  5G4J A;  4A0H A;  1KMJ A;  1QJ5 A;  4J8L A;  5F9S A;  3NRA A;  3QM2 A;  4Q31 A;  1Z7D A;  5G2Q A;  4ZLV A;  1AX4 A;  1W3U A;  3ELP A;  3HL2 A;  4WXG A;  3IHJ A;  3UWC A;  4BHD A;  4R8D A;  1AIB A;  4JEY A;  1SZK A;  2TPL A;  1AKB A;  3GZD C;  1CQ8 A;  2W8T A;  3LV2 A;  2AY4 A;  3AEP A;  3AEM C;  3HMU A;  3PJ0 A;  4W91 A;  4ZDL A;  1QIT A;  1C7G A;  1KL2 A;  2OKK A;  4IX8 A;  3A9Y A;  3EI9 A;  1M6S A;  3FCR A;  4BQ0 A;  3QI6 A;  1ARI A;  2AY5 A;  2VMT A;  3BC8 A;  3WY7 A;  1C7O A;  3VK2 A;  2HUU A;  4A0G A;  2JJE A;  4ADD A;  3ELE A;  2VI8 A;  3KE3 A;  4K2I A;  3II0 A;  3TAT A;  1WYT B;  3PDB A;  4F5K A;  3N4R A;  2E7J A;  1SVV A;  4A6R A;  1S08 A;  4FL0 A;  4K05 A;  4AZK A;  3EI6 A;  5AX8 A;  2AY1 A;  3AAT A;  2R0T A;  1BJO B;  3PDX A;  2YCN A;  3JTX A;  1D7R A;  4RJY A;  4RIT A;  1AIA A;  3NYU A;  1DFO A;  4UHN A;  3MAF B;  5EIG B;  5C6U A;  1M0Q A;  2DGK A;  3LVK A;  3I4J A;  3TCM A;  1B4X A;  2ORD A;  2ZP7 A;  4PVF A;  2PB0 A;  4JE5 D;  5M4D A;  3N0L A;  2D65 A;  3CQ4 A;  3GZD A;  1UU1 A;  3UE8 A;  1GEW A;  3PD6 A;  1S06 A;  3EZS A;  2D61 A;  5DJ9 A;  2XH1 A;  1ASB A;  2BWP A;  3AOW A;  3FDB A;  2OGA A;  2X5F A;  1G7W A;  3GWP A;  2EGY A;  1FG7 A;  2GB3 A;  2JJG A;  2W8J A;  4U2H A;  4JEX A;  4WBT A;  3HBX A;  1KKP A;  1YIY A;  1U08 A;  3RI6 A;  2D63 A;  3AEN A;  2ZY2 A;  3DU4 A;  2WK7 A;  1YAA A;  3NU7 A;  2R5E A;  2KFP A;  1W23 A;  4Q6R A;  4OC9 A;  4CBR A;  2WB6 A;  1KKJ A;  2AY2 A;  4R5Z A;  3LVL B;  3MAD A;  4ZAS A;  1AAM A;  2EO5 A;  2GSA A;  2ZY5 A;  2O0R A;  1AKA A;  1X0M A;  1ARG A;  1GC4 A;  2Z67 A;  2W7I A;  1CZC A;  1BT4 A;  1MGV A;  1AKC A;  2JG2 A;  4LW4 A;  3CBF A;  2VMS A;  1TOJ A;  2YKY A;  2VMW A;  5G4I A;  2W8U A;  5BJ3 A;  1CS1 A;  3FFH A;  4KXK A;  4WP0 A;  3BCX A;  4CBS A;  3GR9 A;  4EB5 A;  3A2B A;  3BS8 A;  3PDB B;  4Y0H A;  3FDD A;  2YRR A;  4RKC A;  1P3W A;  2V1P A;  2WK9 A;  2G6W A;  4ZDO A;  2YCT A;  4JF0 A;  1I41 A;  2FM1 A;  4LC3 A;  1OHW A;  1JG8 A;  3E2Y A;  4WYE A;  3I16 A;  2BI3 A;  1WKG A;  1ZOB A;  2QBT A;  1ASD A;  1AY4 A;  3MC6 A;  5K8B A;  3AEN B;  1ASA A;  2R2N A;  1GEX A;  3B1C A;  4ZSY A;  1UU2 A;  3ISL A;  1B5O A;  4LNM A;  4MSO A;  2HOY A;  4B98 A;  2AY3 A;  2QMA A;  4ZWM A;  1TAS A;  4UHM A;  3VK3 A;  2HOR A;  1PMO A;  4MKK A;  1AIC A;  1ELU A;  1RV3 A;  3NYT A;  4TMR A;  2DGL A;  1CQ6 A;  1J04 A;  2CJD A;  4W5K A;  1D7U A;  2Z20 A;  4K2M A;  2W8W A;  2HOX A;  3NX3 A;  1TAR A;  5E3K A;  4WYC A;  5TF5 A;  3GBX A;  4MQQ A;  3B1D A;  5G2P A;  4F5J A;  2W7F A;  3EIA A;  3A9Z A;  1Y4I A;  3Q8N A;  4N0W A;  1AJR A;  1QZ9 A;  3VP6 A;  1I48 A;  1YIZ A;  4MQR A;  3TQX A;  1W7N A;  4GE9 A;  1BJN A;  1MDX A;  2BIG A;  3F6T A;  1AHY A;  2DOU A;  4RKD A;  4AH3 A;  4OBU A;  2BIE A;  2AEU A;  4M2M A;  2W7M A;  4JEW A;  2HZP A;  4PFN A;  5HXX A;  4MKJ A;  1MDZ A;  4IYO B;  1CL1 A;  5EUN A;  5EUD A;  1ASG A;  3TFU A;  2VMX A;  2BI1 A;  1CZE A;  3LY1 A;  1EQB A;  1D7V A;  1BJ4 A;  4OBV A;  1J32 A;  3MBB A;  3BWO A;  4JEV A;  3VOM A;  1DGE A;  3QHX A;  4E77 A;  7AAT A;  2NMP A;  2PB2 A;  1BQA A;  1GEY A;  3AOV A;  1AY5 A;  2QA3 A;  1ART A;  2YRI A;  4BA5 A;  3VK4 A;  3E2Z A;  2BWN A;  4R5F A;  2QLR A;  1ASF A;  1C4K A;  3FSL A;  4GRX A;  4R2N A;  2CH2 A;  1LKC A;  3G0T A;  1WYV A;  1KL1 A;  4Q76 A;  3AEO A;  5KTB A;  2EZ2 A;  4RM1 A;  4ATQ A;  3DC1 A;  4E3Q A;  4WYG A;  2AEV A;  2D5Y A;  4PIW A;  3GET A;  4ZSW A;  2A1V A;  1YJS A;  2ZY4 A;  3B8X A;  1AMR A;  3ECD A;  4ZAH A;  2W7L A;  1B5P A;  1G7X A;  4XQ2 A;  4CXQ A;  3FZ8 A;  2OGE A;  3L44 A;  3W1H A;  2QB3 A;  4ITX A;  9AAT A;  2Z9V A;  3GZC A;  1MLZ A;  3W1J A;  3AV7 A;  1CQ7 A;  2VLH A;  3FVU A;  2C81 A;  2VGS A;  1XEY A;  2E7I A;  1D2F A;  1M32 A;  4BA4 A;  3HQT A;  1MLY A;  1H1C A;  1IAX A;  1M0P A;  1PFF A;  8AAT A;  1AMA A;  3PIU A;  3AEM A;  2WK8 A;  3E9K A;  2VMZ A;  3NNK A;  2C0R A;  5LHA A;  2QSR A;  2E7U A;  2VMU A;  1LC7 A;  3DXV A;  3PPL A;  1BW0 A;  3FRK A;  4MQP A;  3FD0 A;  1UU0 A;  3G7Q A;  4GEB A;  3M5U A;  4PFF A;  3KGW A;  1SPA A;  2W8V A;  1WYU B;  3MAU A;  1IBJ A;  2C44 A;  2FQ6 A;  1B9H A;  2GMS A;  2VIA A;  4WLJ A;  3W1I A;  1IJI A;  1AMS A;  2BI2 A;  2VMV A;  4EB7 A;  1DJE A;  4A0R A;  2PO3 A;  3ASB A;  5J8Q A;  4I8A A;  1B8G A;  4KAM A;  2JGT A;  4JEZ A;  4ZDP A;  2BYJ A;  3IF2 A;  3COG A;  1I29 A;  2CH1 A;  2ZJG A;  1S09 A;  1C0N A;  4IYO A;  3JWB A;  2EPJ A;  3KKI A;  1RV4 A;  4MY5 A;  4HF8 A;  1N31 A;  5JAY A;  2JJF A;  3MAF A;  2W7E A;  5EIG A;  2CJG A;  3UAK A;  4A00 A;  3H14 A;  4ZWV A;  4WD2 A;  1G4V A;  4F5I A;  2XBN A;  4ADE A;  4OT8 A;  5EUE A;  1SFF A;  2HUI A;  4EFF A;  1GC0 A;  3AEL A;  2AAT A;  3FFR A;  1DTY A;  2VMY A;  3A9X A;  4LNJ A;  4P3M A;  4XJM A;  4TN4 A;  2V0Y A;  2Z9X A;  1UKJ A;  2W7G A;  2Z9U A;  3DR4 A;  2EH6 A;  1BQD A;  2BIA A;  1WYV B;  3MC6 C;  4OYT A;  1AHF A;  3MEB A;  3BCA A;  1EG5 A;  3F9T A;  3WZF A;  3BV0 A;  1VJO A;  1GC2 A;  5E4Z A;  4WYA A;  2VGT A;  3JU7 A;  4RJ0 A;  2C7T A;  4RIZ A;  4A0F A;  3BWN C;  1TAT A;  1GDE A;  4W1W A;  2X8U A;  3RCH B;  3CQ5 A;  4CXR A;  3FQA A;  1M4N A;  2W7H A;  4F5G A;  2YKU A;  1IAY A;  3EIB A;  5EAV A;  1DJU A;  2OAT A;  3WCN A;  3NTJ A;  3RBF A;  1YNU A;  4ADC A;  5DJ1 A;  5G09 A;  2VMP A;  3RBL A;  2Z9W A;  4A72 A;  1DKA A;  1TOE A;  1E5E A;  4LW2 A;  4XJP A;  3N75 A;  2DR1 A;  3E77 A;  3OP7 A;  1WYU A;  1IUG A;  1BS0 A;  4A6T A;  3JW9 A;  1OHY A;  3DRD A;  3NDN A;  5EAA A;  3ZZK A;  1MAP A;  1IX7 A;  1TOG A;  4IXO A;  4J5U A;  3LVM A;  4EMY A;  1CJ0 A;  2YKV A;  1GC3 A;  1E5F A;  2BI9 A; 
#chains in the Genus database with same CATH homology
 1QIR A;  3I5T A;  1O61 A;  5HDM A;  2W7K A;  2ZY3 A;  3QPG A;  4ATP A;  4Q75 A;  4M2K A;  3DZZ A;  2DKB A;  3JWA A;  4Y0D A;  2CY8 A;  1V72 A;  3BB8 A;  3VAX A;  3B46 A;  3JZL A;  5G0A A;  3ZZJ A;  1JF9 A;  3ACZ A;  1IX6 A;  1IVR A;  1N2T A;  1OAT A;  1AHX A;  1SZU A;  3EI5 A;  3FVX A;  4NOG A;  3USF A;  3WGC A;  5M4B A;  1AY8 A;  1GBN A;  2ZSL A;  4ISY A;  4XAU A;  1SZS A;  1RVU A;  1FG3 A;  3FZ7 A;  4XK1 A;  3R9A A;  1MDO A;  1VEF A;  2R5C B;  4OTL A;  1ASM A;  4GE7 A;  5IWQ A;  2Z61 A;  1GD9 A;  5FT5 A;  1V2F A;  3F0H A;  1BKG A;  1QJ3 A;  2W7D A;  5FT4 A;  4FFC A;  3K28 A;  4ZM4 A;  1WYT A;  3AEJ A;  4CVQ A;  1AJS A;  4IY7 A;  1ECX A;  2FYF A;  2AY6 A;  2EYQ A;  2VMR A;  1H0C A;  3WKR A;  1LW5 A;  4F4E A;  1LW4 A;  3P6K A;  4O6Z A;  3ZRP A;  1ZOD A;  1ASC A;  3CQ6 A;  3PGY A;  5FT6 A;  1VP4 A;  2BI5 A;  2YCP A;  4OCA A;  1V2D A;  2O1B A;  3LWS A;  2CIN A;  4XJL A;  1LS3 A;  4ITG A;  5FT8 A;  2BWO A;  4F5M A;  3ZRR A;  2W7J A;  4U1T A;  2JIS A;  3N4X A;  2ZC0 A;  3RCH A;  4QGR A;  1ZC9 A;  2HP1 A;  3E6G A;  2FKI A;  3WCO A;  1S0A A;  1T3I A;  1W7L A;  3DOD A;  4F5L A;  2ZYJ A;  4XJO A;  4JF1 A;  2CAN A;  2D7Z A;  2E54 A;  4WXB A;  4Y0I A;  1LK9 A;  3K40 A;  3A8U X;  4K2B A;  5D5S A;  1XI9 A;  2HP2 A;  2Z1Y A;  3ATH A;  1YJZ A;  3GSB A;  3QGU A;  3BCB A;  3D6K A;  3WX9 A;  4DGT A;  3E2F A;  1M0N A;  2Q7W A;  3N4S A;  3H9X A;  2AY8 A;  4OMA A;  4AOA A;  4WLH A;  1X28 A;  2ZSM A;  4H51 A;  3L8A A;  3LG0 A;  1V2E A;  3G8M A;  1BJW A;  2VGU A;  4GDY A;  1M7Y A;  3WLX A;  4ADB A;  4F5H A;  1ORD A;  3NUI A;  5EFS A;  3FZ6 A;  2BYL A;  4M2J A;  1SF2 A;  3OKS A;  1ARS A;  1MAQ A;  2O7C A;  5M49 A;  2R5C A;  4H63 Q;  4HVK A;  1DGD A;  4LNL A;  1OXO A;  1DJ9 A;  1W7M A;  2VI9 A;  4IXZ A;  3RQ1 A;  1X29 A;  1AJS B;  3QBO A;  2WKA A;  1AMQ A;  1PG8 A;  3HT4 A;  3BN1 A;  1ASN A;  4IW7 A;  2X5D A;  5F8V A;  3NYS A;  2AY7 A;  2VYC A;  2CFB A;  3FQ7 A;  1O4S A;  1LC5 A;  3BWN A;  4WYD A;  3N7N A;  1CL2 A;  1I43 A;  2VGW A;  2JJH A;  3NUB A;  2VMN A;  4RLG A;  1O69 A;  4UOY A;  2G7J A;  4WB0 A;  4KYO A;  5I92 A;  5DB5 A;  2VMO A;  1WKH A;  1TOK A;  2FNU A;  4W1X A;  5HHY A;  3ZRQ A;  2VLF A;  4BMK A;  1ELQ A;  4UQV A;  1M0O A;  2GMU A;  2YHK A;  3B1E A;  2Z1Z A;  2D66 A;  2CJH A;  4A6U A;  2QB2 A;  1JS6 A;  1KMK A;  3HLM A;  1O62 A;  1WST A;  3NU8 A;  3R4T A;  3FVS A;  1AAW A;  1B9I A;  1C7N A;  2CST A;  3EI8 A;  5M46 A;  3EUC A;  1ASL A;  4GE4 A;  4TV7 A;  4W1V A;  4IXS A;  3T32 A;  2BHX A;  3PAA A;  4B9B A;  5EQC A;  2X3L A;  2HOZ A;  4GSA A;  1QGN A;  1YOO A;  2FNI A;  1TPL A;  1JS3 A;  1LC8 A;  3EI7 A;  4E3R A;  1IX8 A;  2YKX A;  3DR7 A;  4P7Y A;  1Z3Z A;  1N8P A;  4DBC A;  2OKJ A;  5E5I A;  1BJO A;  4AZJ A;  1RVY A;  3ASA A;  3P1T A;  2DGM A;  3FKD A;  1OHV A;  3CAI A;  2DKJ A;  3LVJ A;  3N5M A;  4W8I A;  3WGB A;  5D95 A;  2YOB A;  4WYF A;  2F8J A;  4AO9 A;  4WXF A;  3FQ8 A;  2VMQ A;  1ASE A;  2CB1 A;  3H7F A;  3HVY A;  3FTB A;  3KGX A;  2AY9 A;  2ZUK A;  4UHO A;  3E2Z B;  3PA9 A;  4XEW A;  4L0O A;  3WKS A;  4AO4 A;  1G4X A;  3HDO A;  1AHG A;  4MGR A;  2VGV A;  2VIB A;  2FN6 A;  5DX5 A;  2GQN A;  3EZ1 A;  1TOI A;  3AEJ C;  1YJY A;  3DYD A;  2D7Y A;  1AHE A;  3DXW A;  3PD6 B;  1GCK A;  3RUY A;  4F5F A;  4ZM3 A;  4RAE A;  4JE5 A;  2BKW A;  3GJU A;  4DQ6 A;  2OQX A;  1EJI A;  1X2A A;  3TFT A;  3MKJ A;  1FC4 A;  4N0B A;  1PMM A;  2CTZ A;  1S07 A;  2HUF A;  4E1O A;  1ARH A;  2VGZ A;  1C9C A;  4WB0 B;  2EZ1 A;  5LH9 A;  1QIS A;  1D7S A;  2D64 A;  2RFV A;  3K7Y A;  3QN6 A;  4EU1 A;  5BJ4 A;  1OXP A;  5G4J A;  4A0H A;  1KMJ A;  1QJ5 A;  4J8L A;  5F9S A;  3NRA A;  3QM2 A;  4Q31 A;  1Z7D A;  5G2Q A;  4ZLV A;  1AX4 A;  1W3U A;  3ELP A;  3HL2 A;  4WXG A;  3IHJ A;  3UWC A;  4BHD A;  4R8D A;  1AIB A;  4JEY A;  1SZK A;  2TPL A;  1AKB A;  3GZD C;  1CQ8 A;  2W8T A;  3LV2 A;  2AY4 A;  3AEP A;  3AEM C;  3HMU A;  3PJ0 A;  4W91 A;  4ZDL A;  1QIT A;  1C7G A;  1KL2 A;  2OKK A;  4IX8 A;  3A9Y A;  3EI9 A;  1M6S A;  3FCR A;  4BQ0 A;  3QI6 A;  1ARI A;  2AY5 A;  2VMT A;  3BC8 A;  3WY7 A;  1C7O A;  3VK2 A;  2HUU A;  4A0G A;  2JJE A;  4ADD A;  3ELE A;  2VI8 A;  3KE3 A;  4K2I A;  3II0 A;  3TAT A;  1WYT B;  3PDB A;  4F5K A;  3N4R A;  2E7J A;  1SVV A;  4A6R A;  1S08 A;  4FL0 A;  4K05 A;  4AZK A;  3EI6 A;  5AX8 A;  2AY1 A;  3AAT A;  2R0T A;  1BJO B;  3PDX A;  2YCN A;  3JTX A;  1D7R A;  4RJY A;  4RIT A;  1AIA A;  3NYU A;  1DFO A;  4UHN A;  3MAF B;  5EIG B;  5C6U A;  1M0Q A;  2DGK A;  3LVK A;  3I4J A;  3TCM A;  1B4X A;  2ORD A;  2ZP7 A;  4PVF A;  2PB0 A;  4JE5 D;  5M4D A;  3N0L A;  2D65 A;  3CQ4 A;  3GZD A;  1UU1 A;  3UE8 A;  1GEW A;  3PD6 A;  1S06 A;  3EZS A;  2D61 A;  5DJ9 A;  2XH1 A;  1ASB A;  2BWP A;  3AOW A;  3FDB A;  2OGA A;  2X5F A;  1G7W A;  3GWP A;  2EGY A;  1FG7 A;  2GB3 A;  2JJG A;  2W8J A;  4U2H A;  4JEX A;  4WBT A;  3HBX A;  1KKP A;  1YIY A;  1U08 A;  3RI6 A;  2D63 A;  3AEN A;  2ZY2 A;  3DU4 A;  2WK7 A;  1YAA A;  3NU7 A;  2R5E A;  2KFP A;  1W23 A;  4Q6R A;  4OC9 A;  4CBR A;  2WB6 A;  1KKJ A;  2AY2 A;  4R5Z A;  3LVL B;  3MAD A;  4ZAS A;  1AAM A;  2EO5 A;  2GSA A;  2ZY5 A;  2O0R A;  1AKA A;  1X0M A;  1ARG A;  1GC4 A;  2Z67 A;  2W7I A;  1CZC A;  1BT4 A;  1MGV A;  1AKC A;  2JG2 A;  4LW4 A;  3CBF A;  2VMS A;  1TOJ A;  2YKY A;  2VMW A;  5G4I A;  2W8U A;  5BJ3 A;  1CS1 A;  3FFH A;  4KXK A;  4WP0 A;  3BCX A;  4CBS A;  3GR9 A;  4EB5 A;  3A2B A;  3BS8 A;  3PDB B;  4Y0H A;  3FDD A;  2YRR A;  4RKC A;  1P3W A;  2V1P A;  2WK9 A;  2G6W A;  4ZDO A;  2YCT A;  4JF0 A;  1I41 A;  2FM1 A;  4LC3 A;  1OHW A;  1JG8 A;  3E2Y A;  4WYE A;  3I16 A;  2BI3 A;  1WKG A;  1ZOB A;  2QBT A;  1ASD A;  1AY4 A;  3MC6 A;  5K8B A;  3AEN B;  1ASA A;  2R2N A;  1GEX A;  3B1C A;  4ZSY A;  1UU2 A;  3ISL A;  1B5O A;  4LNM A;  4MSO A;  2HOY A;  4B98 A;  2AY3 A;  2QMA A;  4ZWM A;  1TAS A;  4UHM A;  3VK3 A;  2HOR A;  1PMO A;  4MKK A;  1AIC A;  1ELU A;  1RV3 A;  3NYT A;  4TMR A;  2DGL A;  1CQ6 A;  1J04 A;  2CJD A;  4W5K A;  1D7U A;  2Z20 A;  4K2M A;  2W8W A;  2HOX A;  3NX3 A;  1TAR A;  5E3K A;  4WYC A;  5TF5 A;  3GBX A;  4MQQ A;  3B1D A;  5G2P A;  4F5J A;  2W7F A;  3EIA A;  3A9Z A;  1Y4I A;  3Q8N A;  4N0W A;  1AJR A;  1QZ9 A;  3VP6 A;  1I48 A;  1YIZ A;  4MQR A;  3TQX A;  1W7N A;  4GE9 A;  1BJN A;  1MDX A;  2BIG A;  3F6T A;  1AHY A;  2DOU A;  4RKD A;  4AH3 A;  4OBU A;  2BIE A;  2AEU A;  4M2M A;  2W7M A;  4JEW A;  2HZP A;  4PFN A;  5HXX A;  4MKJ A;  1MDZ A;  4IYO B;  1CL1 A;  5EUN A;  5EUD A;  1ASG A;  3TFU A;  2VMX A;  2BI1 A;  1CZE A;  3LY1 A;  1EQB A;  1D7V A;  1BJ4 A;  4OBV A;  1J32 A;  3MBB A;  3BWO A;  4JEV A;  3VOM A;  1DGE A;  3QHX A;  4E77 A;  7AAT A;  2NMP A;  2PB2 A;  1BQA A;  1GEY A;  3AOV A;  1AY5 A;  2QA3 A;  1ART A;  2YRI A;  4BA5 A;  3VK4 A;  3E2Z A;  2BWN A;  4R5F A;  2QLR A;  1ASF A;  1C4K A;  3FSL A;  4GRX A;  4R2N A;  2CH2 A;  1LKC A;  3G0T A;  1WYV A;  1KL1 A;  4Q76 A;  3AEO A;  5KTB A;  2EZ2 A;  4RM1 A;  4ATQ A;  3DC1 A;  4E3Q A;  4WYG A;  2AEV A;  2D5Y A;  4PIW A;  3GET A;  4ZSW A;  2A1V A;  1YJS A;  2ZY4 A;  3B8X A;  1AMR A;  3ECD A;  4ZAH A;  2W7L A;  1B5P A;  1G7X A;  4XQ2 A;  4CXQ A;  3FZ8 A;  2OGE A;  3L44 A;  3W1H A;  2QB3 A;  4ITX A;  9AAT A;  2Z9V A;  3GZC A;  1MLZ A;  3W1J A;  3AV7 A;  1CQ7 A;  2VLH A;  3FVU A;  2C81 A;  2VGS A;  1XEY A;  2E7I A;  1D2F A;  1M32 A;  4BA4 A;  3HQT A;  1MLY A;  1H1C A;  1IAX A;  1M0P A;  1PFF A;  8AAT A;  1AMA A;  3PIU A;  3AEM A;  2WK8 A;  3E9K A;  2VMZ A;  3NNK A;  2C0R A;  5LHA A;  2QSR A;  2E7U A;  2VMU A;  1LC7 A;  3DXV A;  3PPL A;  1BW0 A;  3FRK A;  4MQP A;  3FD0 A;  1UU0 A;  3G7Q A;  4GEB A;  3M5U A;  4PFF A;  3KGW A;  1SPA A;  2W8V A;  1WYU B;  3MAU A;  1IBJ A;  2C44 A;  2FQ6 A;  1B9H A;  2GMS A;  2VIA A;  4WLJ A;  3W1I A;  1IJI A;  1AMS A;  2BI2 A;  2VMV A;  4EB7 A;  1DJE A;  4A0R A;  2PO3 A;  3ASB A;  5J8Q A;  4I8A A;  1B8G A;  4KAM A;  2JGT A;  4JEZ A;  4ZDP A;  2BYJ A;  3IF2 A;  3COG A;  1I29 A;  2CH1 A;  2ZJG A;  1S09 A;  1C0N A;  4IYO A;  3JWB A;  2EPJ A;  3KKI A;  1RV4 A;  4MY5 A;  4HF8 A;  1N31 A;  5JAY A;  2JJF A;  3MAF A;  2W7E A;  5EIG A;  2CJG A;  3UAK A;  4A00 A;  3H14 A;  4ZWV A;  4WD2 A;  1G4V A;  4F5I A;  2XBN A;  4ADE A;  4OT8 A;  5EUE A;  1SFF A;  2HUI A;  4EFF A;  1GC0 A;  3AEL A;  2AAT A;  3FFR A;  1DTY A;  2VMY A;  3A9X A;  4LNJ A;  4P3M A;  4XJM A;  4TN4 A;  2V0Y A;  2Z9X A;  1UKJ A;  2W7G A;  2Z9U A;  3DR4 A;  2EH6 A;  1BQD A;  2BIA A;  1WYV B;  3MC6 C;  4OYT A;  1AHF A;  3MEB A;  3BCA A;  1EG5 A;  3F9T A;  3WZF A;  3BV0 A;  1VJO A;  1GC2 A;  5E4Z A;  4WYA A;  2VGT A;  3JU7 A;  4RJ0 A;  2C7T A;  4RIZ A;  4A0F A;  3BWN C;  1TAT A;  1GDE A;  4W1W A;  2X8U A;  3RCH B;  3CQ5 A;  4CXR A;  3FQA A;  1M4N A;  2W7H A;  4F5G A;  2YKU A;  1IAY A;  3EIB A;  5EAV A;  1DJU A;  2OAT A;  3WCN A;  3NTJ A;  3RBF A;  1YNU A;  4ADC A;  5DJ1 A;  5G09 A;  2VMP A;  3RBL A;  2Z9W A;  4A72 A;  1DKA A;  1TOE A;  1E5E A;  4LW2 A;  4XJP A;  3N75 A;  2DR1 A;  3E77 A;  3OP7 A;  1WYU A;  1IUG A;  1BS0 A;  4A6T A;  3JW9 A;  1OHY A;  3DRD A;  3NDN A;  5EAA A;  3ZZK A;  1MAP A;  1IX7 A;  1TOG A;  4IXO A;  4J5U A;  3LVM A;  4EMY A;  1CJ0 A;  2YKV A;  1GC3 A;  1E5F A;  2BI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...