2JISA

Human cysteine sulfinic acid decarboxylase (csad) in complex with plp.
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
487
structure length
478
Chain Sequence
LPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLPPLALFTSKECHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSKFYDVALDTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CYSTEINE SULFINIC ACID DECARBOXYLASE
publication title The Crystal Structure of Human Cysteine Sulfinic Acid Decarboxylase (Csad)
rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 173
structure length 478
sequence length 487
chains with identical sequence B
ec nomenclature ec 4.1.1.11: Aspartate 1-decarboxylase.
pdb deposition date 2007-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00282 Pyridoxal_deC Pyridoxal-dependent decarboxylase conserved domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2jisA02
3.90.1150.170 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2jisA01
1AMAA 2O1BA 4XK1A 3QN6A 2HUUA 3NU8A 5HXXA 1GC4A 1M0NA 4PIWA 3CQ6A 3I4JA 1W23A 1YIYA 3N0LA 5BJ3A 4JEYA 1J04A 4OTLA 3VP6A 5FT6A 1ASBA 3ASBA 3DZZA 3AEPA 1Y4IA 2BYJA 3DR4A 3ELEA 4W1XA 1TOJA 4F4EA 1AIAA 4P7YA 2AY5A 2O7CA 3BCBA 2FQ6A 2R0TA 1ARTA 2X5FA 1ASFA 1IX8A 5M4DA 1M0PA 3JTXA 3E9KA 3OP7A 3LVKA 4HF8A 4ADCA 2F8JA 3NX3A 1BQAA 3G8MA 1IX7A 1TPLA 3FRKA 3FZ7A 3FZ8A 4AZJA 1CJ0A 3WX9A 3RQ1A 3GR9A 1ORDA 2EO5A 3CBFA 2QMAA 3JWAA 2HUFA 1O4SA 1BQDA 1V2DA 2Z9VA 1ASNA 1GEXA 2YCNA 4AO9A 3GJUA 4LNMA 3KE3A 4A00A 1AY4A 3MAFB 4A6RA 3DRDA 3TCMA 2DR1A 1QGNA 3ECDA 3ZZKA 2OKJA 4RKCA 4A0FA 1SZSA 1XI9A 3N75A 2W7DA 1AMQA 2BIEA 1KL2A 5M4BA 2Z1ZA 3DU4A 1I29A 3EUCA 4M2JA 4Q6RA 5EQCA 3ATHA 2VIAA 1YAAA 1G7XA 4ZAHA 3FCRA 3MKJA 1AX4A 4JE5D 2JJHA 3FQ7A 4LNLA 4EU1A 4N0WA 1QJ5A 3UWCA 2XBNA 4UOYA 4ZM3A 2GMUA 1X2AA 2VMOA 3E6GA 4N0BA 1DJUA 2BIGA 1AKCA 2NMPA 1ASCA 1M32A 4XJPA 1WKGA 3W1HA 1PMMA 5EIGB 3RBFA 5EAAA 3GBXA 1C4KA 3ISLA 5F8VA 4J5UA 3WLXA 4LNJA 1WKHA 5M46A 3PDBA 3NNKA 2Z9WA 3PAAA 4CBSA 2C0RA 1S0AA 5EUNA 1LC7A 1V72A 3DR7A 2BHXA 2VIBA 1GC2A 4GEBA 4ZWMA 4UHOA 2CFBA 3NYTA 3II0A 3WCOA 2DKJA 5EUDA 2ZUKA 3FSLA 1FG3A 2VI8A 1AHYA 3QI6A 2BI5A 3BWNA 3OKSA 4GDYA 4WB0A 4Q75A 3FFHA 3B1CA 3NU7A 4QGRA 1JS3A 4AOAA 4ATQA 2EH6A 3BV0A 3AEOA 3JU7A 4CXRA 4WYAA 4KAMA 2JJGA 4ATPA 4ITXA 5TF5A 1ASGA 2V0YA 2FN6A 3H7FA 4MQQA 4IYOB 1E5FA 5FT8A 1IAXA 4H51A 2D61A 4BMKA 2FM1A 1BT4A 1DTYA 4W91A 4GE7A 4L0OA 4P3MA 2VGTA 1DFOA 1AICA 2HOZA 4MY5A 2YKXA 1JG8A 2BYLA 3BC8A 2AY3A 4ZDOA 1WYUA 3PPLA 1BJOA 5G4JA 4M2MA 1YOOA 4WXGA 3K28A 4IXSA 3NTJA 2BI9A 3WKSA 1CS1A 3PJ0A 1QISA 3B8XA 2EPJA 2VI9A 2G6WA 3F6TA 1ARHA 1AJSA 4RJ0A 4K2BA 4F5IA 1MGVA 4A0HA 1TOGA 4GE9A 2BWNA 2C7TA 3B1EA 4WYFA 3AEMA 5J8QA 3RI6A 2HP2A 1ASMA 1B9HA 1PMOA 2WK8A 3A8UX 2D7ZA 2BI1A 4JEXA 1CL1A 3BS8A 5BJ4A 1AY5A 1WYVA 3BWNC 2YKYA 2QLRA 4ZLVA 3UE8A 4RIZA 2JGTA 3TFUA 1UU2A 2VGZA 4AH3A 3NYSA 1OXPA 2VMRA 1IJIA 3LY1A 5I92A 2W7EA 3ASAA 3TATA 3DYDA 3RBLA 1IX6A 3MADA 4E77A 1GC3A 3PD6B 3E2ZB 1N8PA 2CANA 3CQ5A 3LWSA 5DJ1A 2AY6A 2CJHA 3NUIA 1LKCA 1AIBA 3FZ6A 3QHXA 3A9YA 2AY7A 4KXKA 3T32A 3PA9A 4OMAA 2YOBA 1AAWA 2EZ2A 2Z1YA 4LW2A 2VMZA 2Z9UA 2AEUA 2ZP7A 3KKIA 1WSTA 1H0CA 4JF0A 3TQXA 4BA5A 3QBOA 4JE5A 2W7IA 4F5MA 5G2PA 1AHXA 3AENA 2Z9XA 4TMRA 4XJOA 2YKVA 1Z3ZA 1QITA 2ZYJA 3BWOA 5G2QA 1IBJA 4PVFA 1IUGA 2D63A 4XQ2A 1N2TA 4UHNA 2C44A 3IF2A 4ADDA 1XEYA 2W8WA 4Y0IA 2ZSLA 4JEVA 1E5EA 3GZDA 4F5LA 1M0OA 1DGEA 2YHKA 3FD0A 1MAPA 1V2EA 2QB3A 3AEMC 1C9CA 3LV2A 2QA3A 4WBTA 4IX8A 2E7IA 2PB2A 1ARSA 3AV7A 1LW5A 3RCHB 1G7WA 4MQRA 3AEJA 3NRAA 2W8UA 1IAYA 3LVMA 3BN1A 4OC9A 4RAEA 2R5CA 2X5DA 1OXOA 1BS0A 2Z61A 2BI2A 1AAMA 4LC3A 4IW7A 3G0TA 3MBBA 4UQVA 1JS6A 4XJMA 3MAFA 3NUBA 4FFCA 2OQXA 4RLGA 1LC5A 3B1DA 4M2KA 4WLHA 3I5TA 2XH1A 5G4IA 4DQ6A 1M4NA 4PFFA 2GB3A 2VMPA 1MDZA 1SF2A 2D7YA 2JJEA 1CL2A 1CZCA 2HOXA 3AOVA 3FVSA 4BHDA 2DGMA 2BKWA 5LHAA 1CQ7A 3LG0A 1KKJA 2V1PA 1GCKA 2JISA 3I16A 3P1TA 3GETA 2D65A 2E54A 2W7JA 3GWPA 4MGRA 4ZWVA 1AMSA 2RFVA 4I8AA 2CSTA 4IXOA 8AATA 5G0AA 3F9TA 3Q8NA 3USFA 1CQ8A 5EAVA 4A0GA 5F9SA 1X28A 3ZRRA 2W7KA 1GDEA 2VYCA 4WYDA 1KKPA 2AY4A 3QGUA 5EIGA 4DBCA 5JAYA 2CJGA 5G09A 1Z7DA 4AZKA 2JG2A 4WYCA 1X29A 4HVKA 1AHFA 3P6KA 1O69A 1BJNA 4JEZA 4RITA 1TOIA 4U1TA 1WYTB 4ZSWA 4TV7A 2VLFA 3GZDC 3AOWA 1DJEA 2W7HA 4OBUA 3EI6A 4F5GA 1LC8A 3WGBA 4F5HA 9AATA 1FG7A 3R9AA 3E2FA 4EMYA 4MKKA 1SFFA 3ELPA 1M0QA 3AEJC 1BJOB 3FVXA 3A9XA 3N5MA 4W8IA 2VGSA 1TOEA 4J8LA 4F5FA 4K2IA 5FT5A 2GSAA 1OHYA 3DC1A 1GEYA 1J32A 3VK2A 2VMNA 1UKJA 3EI8A 5K8BA 4IYOA 1CQ6A 3HVYA 1GD9A 3FFRA 4O6ZA 5AX8A 2FNIA 2HZPA 2VLHA 4OBVA 3GSBA 3KGWA 2D5YA 3E2YA 4ADEA 1MLZA 1TASA 2CH2A 3FTBA 3K7YA 2OGAA 1C7GA 3KGXA 4A72A 1T3IA 4XAUA 3BB8A 1M6SA 4A6UA 3HQTA 1QZ9A 3R4TA 4MKJA 1GC0A 4XEWA 1RV3A 2QBTA 5IWQA 2DKBA 1RV4A 3BCAA 3EZ1A 3K40A 1I41A 5E5IA 4ISYA 1SVVA 3LVJA 4E3QA 3HL2A 1WYVB 1BJWA 1N31A 1RVUA 2HOYA 2PO3A 2VMQA 2W7LA 3ACZA 3WZFA 4BA4A 3COGA 1SZKA 2VMWA 2BI3A 3AELA 3DODA 2W8TA 1YJSA 2AY9A 3MEBA 3NDNA 1CZEA 4NOGA 2VGUA 2FYFA 3NYUA 1G4VA 2E7UA 4OYTA 2E7JA 4WYGA 3ZRQA 4F5KA 2HUIA 1S07A 1D7RA 4JF1A 2OKKA 3EI7A 1EQBA 3EZSA 1QIRA 1ELUA 1MAQA 2TPLA 1SZUA 2VMVA 3DXWA 1PG8A 3DXVA 4W1VA 4WD2A 2D66A 2HP1A 1FC4A 3VK3A 4OT8A 2GQNA 4A0RA 2AY2A 1YNUA 1UU1A 3LVLB 1O61A 2AATA 3FQAA 4ZSYA 2BWOA 3AENB 1ASAA 4MSOA 4E1OA 2VGVA 1H1CA 1X0MA 2CTZA 2Q7WA 4UHMA 4WLJA 1B4XA 5HDMA 2BIAA 1OHWA 2FNUA 3HT4A 1ZC9A 4Q76A 3EIAA 4PFNA 5E3KA 3IHJA 2CY8A 4ZDLA 3ZRPA 2CJDA 2R2NA 3PD6A 3E2ZA 5DJ9A 1ASLA 2Z67A 3WKRA 3BCXA 3F0HA 1AHGA 2W8VA 1TOKA 3MAUA 4A6TA 3CAIA 4F5JA 2W7MA 1B9IA 3UAKA 1ECXA 3PDXA 4R5ZA 4DGTA 3TFTA 1B8GA 1TARA 4R8DA 4CBRA 1BKGA 3JZLA 2R5CB 2VMXA 3HBXA 3EIBA 3RUYA 3W1IA 4CXQA 1VEFA 2VMSA 5EUEA 1AY8A 1KMJA 2ORDA 3ZZJA 3VAXA 4IY7A 4Y0HA 4RJYA 4GE4A 2EGYA 2JJFA 3WCNA 4ZM4A 5EFSA 4RKDA 3M5UA 3PIUA 2W8JA 2VMTA 3EI5A 5LH9A 1AJRA 1LS3A 2PB0A 3PDBB 5FT4A 3QM2A 1PFFA 5DB5A 3A2BA 4MQPA 1GEWA 3HMUA 4RM1A 1B5OA 5HHYA 1W7NA 2ZSMA 4ZASA 2EZ1A 1S08A 1YJZA 3RCHA 1SPAA 1AHEA 3B46A 1W3UA 1D2FA 2W7GA 1D7VA 1OATA 4EFFA 2CB1A 4W1WA 1G4XA 5C6UA 1DJ9A 2YKUA 3FQ8A 4WB0B 3JW9A 1KMKA 1MDOA 2VMYA 2X3LA 1VJOA 2ZC0A 3GZCA 4ZDPA 1LK9A 2WKAA 3MC6A 4TN4A 4B9BA 2QB2A 3FVUA 1D7SA 3E77A 1EG5A 1IVRA 4W5KA 3W1JA 5M49A 2VGWA 4GRXA 2HORA 4WYEA 1BW0A 3H14A 4EB7A 1MDXA 1UU0A 1ASEA 3AATA 1I48A 2C81A 4WP0A 4JEWA 1BJ4A 1ELQA 4ADBA 1ZOBA 2DGLA 3JWBA 1C7NA 3WY7A 1ARIA 1O62A 4BQ0A 1C7OA 4FL0A 4ITGA 4EB5A 1WYUB 2VMUA 4E3RA 1I43A 1S09A 3PGYA 1KL1A 2GMSA 4R5FA 1EJIA 1DGDA 1W7LA 2BWPA 3EI9A 3G7QA 1U08A 1C0NA 2R5EA 1YJYA 2WK9A 1V2FA 3HDOA 4IXZA 1AJSB 3VOMA 1GBNA 2DOUA 1AKBA 2DGKA 1B5PA 3FDBA 4U2HA 1WYTA 2YCTA 1LW4A 3VK4A 4OCAA 1D7UA 2D64A 4LW4A 1ARGA 2CH1A 1TATA 1ASDA 3HLMA 2Z20A 4K2MA 1MLYA 5D5SA 1P3WA 2WK7A 4WXBA 3A9ZA 2AEVA 1AMRA 4B98A 3L8AA 2X8UA 1OHVA 2CINA 1AKAA 1YIZA 5E4ZA 1ZODA 1QJ3A 2YCPA 1VP4A 4KYOA 2ZJGA 2YRIA 7AATA 4WXFA 3WGCA 4CVQA 1S06A 4Q31A 4XJLA 4Y0DA 3MC6C 2OATA 2YRRA 2OGEA 2W7FA 3QPGA 1RVYA 3L44A 2AY1A 2O0RA 5D95A 3CQ4A 4AO4A 4GSAA 1W7MA 3FKDA 1JF9A 5DX5A 4R2NA 2AY8A 1DKAA 1M7YA 3D6KA
chains in the Genus database with same CATH superfamily
1AMAA 2O1BA 4XK1A 3QN6A 2HUUA 3NU8A 5HXXA 1GC4A 1M0NA 4PIWA 3CQ6A 3I4JA 1W23A 1YIYA 3N0LA 5BJ3A 4JEYA 1J04A 4OTLA 3VP6A 5FT6A 1ASBA 3ASBA 3DZZA 3AEPA 1Y4IA 2BYJA 3DR4A 3ELEA 4W1XA 1TOJA 4F4EA 1AIAA 4P7YA 2AY5A 2O7CA 3BCBA 2FQ6A 2R0TA 1ARTA 2X5FA 1ASFA 1IX8A 5M4DA 1M0PA 3JTXA 3E9KA 3OP7A 3LVKA 4HF8A 4ADCA 2F8JA 3NX3A 1BQAA 3G8MA 1IX7A 1TPLA 3FRKA 3FZ7A 3FZ8A 4AZJA 1CJ0A 3WX9A 3RQ1A 3GR9A 1ORDA 2EO5A 3CBFA 2QMAA 3JWAA 2HUFA 1O4SA 1BQDA 1V2DA 2Z9VA 1ASNA 1GEXA 2YCNA 4AO9A 3GJUA 4LNMA 3KE3A 4A00A 1AY4A 3MAFB 4A6RA 3DRDA 3TCMA 2DR1A 1QGNA 3ECDA 3ZZKA 2OKJA 4RKCA 4A0FA 1SZSA 1XI9A 3N75A 2W7DA 1AMQA 2BIEA 1KL2A 5M4BA 2Z1ZA 3DU4A 1I29A 3EUCA 4M2JA 4Q6RA 5EQCA 3ATHA 2VIAA 1YAAA 1G7XA 4ZAHA 3FCRA 3MKJA 1AX4A 4JE5D 2JJHA 3FQ7A 4LNLA 4EU1A 2ZY4A 4N0WA 1QJ5A 3UWCA 2XBNA 4UOYA 4ZM3A 2GMUA 1X2AA 2VMOA 3E6GA 4N0BA 1DJUA 2BIGA 1AKCA 2NMPA 1ASCA 1M32A 4XJPA 1WKGA 3W1HA 1PMMA 5EIGB 3RBFA 5EAAA 3GBXA 1C4KA 3ISLA 5F8VA 4J5UA 3WLXA 4LNJA 1WKHA 5M46A 3PDBA 3NNKA 2Z9WA 3PAAA 4CBSA 2C0RA 1S0AA 5EUNA 1LC7A 1V72A 3DR7A 2BHXA 2VIBA 1GC2A 2A1VA 4GEBA 4ZWMA 2QSRA 4UHOA 2CFBA 3NYTA 3II0A 3WCOA 2DKJA 5EUDA 2ZUKA 3FSLA 1FG3A 2VI8A 1AHYA 3QI6A 2BI5A 3BWNA 3OKSA 4GDYA 4WB0A 4Q75A 3FFHA 3B1CA 3NU7A 4QGRA 1JS3A 4AOAA 4ATQA 2EH6A 3BV0A 3AEOA 3JU7A 4CXRA 4WYAA 4KAMA 2JJGA 4ATPA 4ITXA 5TF5A 1ASGA 2V0YA 2FN6A 3H7FA 4MQQA 4IYOB 1E5FA 5FT8A 1IAXA 4H51A 2D61A 4BMKA 2FM1A 1BT4A 1DTYA 4W91A 4GE7A 4L0OA 4P3MA 2VGTA 1DFOA 1AICA 2HOZA 4MY5A 2YKXA 1JG8A 2BYLA 3BC8A 2AY3A 4ZDOA 1WYUA 3PPLA 1BJOA 5G4JA 4M2MA 1YOOA 4WXGA 3K28A 4IXSA 3NTJA 2BI9A 3WKSA 1CS1A 3PJ0A 1QISA 3B8XA 2EPJA 2VI9A 2G6WA 3F6TA 2ZY3A 1ARHA 1AJSA 4RJ0A 4K2BA 4F5IA 1MGVA 4A0HA 1TOGA 4GE9A 2BWNA 2C7TA 3B1EA 4WYFA 3AEMA 5J8QA 3RI6A 2HP2A 1ASMA 1B9HA 1PMOA 2WK8A 3A8UX 2D7ZA 2BI1A 4JEXA 1CL1A 3BS8A 5BJ4A 1AY5A 1WYVA 3BWNC 2YKYA 2QLRA 4ZLVA 3UE8A 3H9XA 4RIZA 2JGTA 3TFUA 1UU2A 2VGZA 4AH3A 3NYSA 2ZY2A 1OXPA 2VMRA 1IJIA 3LY1A 5I92A 2W7EA 3ASAA 3TATA 3DYDA 3RBLA 1IX6A 3MADA 4E77A 1GC3A 3PD6B 3E2ZB 1N8PA 2CANA 3CQ5A 3LWSA 5DJ1A 2AY6A 2CJHA 3NUIA 1LKCA 1AIBA 3FZ6A 3QHXA 3A9YA 2AY7A 4KXKA 3T32A 3PA9A 4OMAA 2YOBA 1AAWA 2EZ2A 2Z1YA 4LW2A 2KFPA 2VMZA 2Z9UA 2AEUA 2ZP7A 3KKIA 1WSTA 1H0CA 4JF0A 3TQXA 4BA5A 3QBOA 4JE5A 2W7IA 4F5MA 5G2PA 1AHXA 3AENA 2Z9XA 4TMRA 4XJOA 2YKVA 1Z3ZA 1QITA 2ZYJA 3BWOA 5G2QA 1IBJA 4PVFA 1IUGA 2D63A 4XQ2A 1N2TA 4UHNA 2C44A 3IF2A 4ADDA 1XEYA 2W8WA 4Y0IA 2ZSLA 4JEVA 1E5EA 3GZDA 4F5LA 1M0OA 1DGEA 2YHKA 3FD0A 1MAPA 1V2EA 2QB3A 3AEMC 1C9CA 3LV2A 2QA3A 4WBTA 4IX8A 2E7IA 2PB2A 1ARSA 3AV7A 1LW5A 3RCHB 1G7WA 4MQRA 3AEJA 3NRAA 3FDDA 2W8UA 1IAYA 3LVMA 1KAFA 3BN1A 4OC9A 4RAEA 2R5CA 2X5DA 1OXOA 1BS0A 2Z61A 2BI2A 1AAMA 4LC3A 4IW7A 3G0TA 3MBBA 4UQVA 1JS6A 4XJMA 3MAFA 3NUBA 4FFCA 2OQXA 4RLGA 1LC5A 3B1DA 4M2KA 4WLHA 3I5TA 2XH1A 5G4IA 4DQ6A 1M4NA 4PFFA 2GB3A 2VMPA 1MDZA 1SF2A 2D7YA 2JJEA 1CL2A 1CZCA 2HOXA 3AOVA 3FVSA 4BHDA 2DGMA 2BKWA 5LHAA 1CQ7A 3LG0A 1KKJA 2V1PA 1GCKA 2JISA 3I16A 3P1TA 3GETA 2D65A 2E54A 2W7JA 3GWPA 4MGRA 4ZWVA 2G7JA 1AMSA 2RFVA 4I8AA 2CSTA 4IXOA 8AATA 5G0AA 2ZY5A 3F9TA 3Q8NA 3USFA 1CQ8A 5EAVA 4A0GA 5F9SA 1X28A 3ZRRA 2W7KA 1GDEA 2VYCA 4WYDA 1KKPA 2AY4A 3QGUA 5EIGA 4DBCA 5JAYA 2CJGA 4H63Q 5G09A 1Z7DA 4AZKA 2JG2A 4WYCA 1X29A 4HVKA 2EYQA 1AHFA 3P6KA 1O69A 1BJNA 4JEZA 4RITA 1TOIA 4U1TA 1WYTB 4ZSWA 4TV7A 2VLFA 3GZDC 3AOWA 1DJEA 2W7HA 4OBUA 3EI6A 4F5GA 1LC8A 3WGBA 4F5HA 9AATA 1FG7A 3R9AA 3E2FA 4EMYA 4MKKA 1SFFA 3ELPA 1M0QA 3AEJC 1BJOB 3FVXA 3A9XA 3N5MA 4W8IA 2VGSA 1TOEA 4J8LA 4F5FA 4K2IA 5FT5A 2GSAA 1OHYA 3DC1A 1GEYA 1J32A 3VK2A 2VMNA 1UKJA 3EI8A 5K8BA 4IYOA 1CQ6A 3HVYA 1GD9A 3FFRA 4O6ZA 5AX8A 2FNIA 2HZPA 2VLHA 4OBVA 3GSBA 3KGWA 2D5YA 3E2YA 4ADEA 1MLZA 1TASA 2CH2A 3FTBA 3K7YA 2OGAA 1C7GA 3KGXA 4A72A 1T3IA 4XAUA 3BB8A 1M6SA 4A6UA 3HQTA 1QZ9A 3R4TA 4MKJA 1GC0A 4XEWA 1RV3A 2QBTA 5IWQA 2DKBA 1RV4A 3BCAA 3EZ1A 3K40A 1I41A 5E5IA 4ISYA 1SVVA 3LVJA 4E3QA 3HL2A 1WYVB 1BJWA 4K05A 1N31A 1RVUA 2HOYA 2PO3A 2VMQA 2W7LA 3ACZA 3WZFA 4BA4A 3COGA 1SZKA 2VMWA 2BI3A 3AELA 3DODA 2W8TA 1YJSA 2AY9A 3MEBA 3NDNA 1CZEA 4NOGA 2VGUA 2FYFA 3NYUA 1G4VA 2E7UA 4OYTA 2E7JA 4WYGA 3ZRQA 4F5KA 2HUIA 1S07A 1D7RA 4JF1A 2OKKA 3EI7A 1EQBA 3EZSA 1QIRA 1ELUA 1MAQA 2TPLA 1SZUA 2VMVA 3DXWA 1PG8A 3DXVA 5KTBA 4W1VA 4WD2A 2D66A 2HP1A 1FC4A 3VK3A 4OT8A 2GQNA 4A0RA 2AY2A 1YNUA 1UU1A 3LVLB 1O61A 2AATA 3FQAA 4ZSYA 2BWOA 3AENB 1ASAA 4MSOA 4E1OA 2VGVA 1H1CA 1X0MA 2CTZA 2Q7WA 4UHMA 4WLJA 1B4XA 5HDMA 2BIAA 1OHWA 2FNUA 3HT4A 1ZC9A 4Q76A 3EIAA 4PFNA 5E3KA 3IHJA 2CY8A 4ZDLA 3ZRPA 2CJDA 2R2NA 3PD6A 3E2ZA 5DJ9A 1ASLA 2Z67A 3WKRA 3BCXA 3F0HA 1AHGA 2W8VA 1TOKA 3MAUA 4A6TA 3CAIA 4F5JA 2W7MA 1B9IA 3UAKA 1ECXA 3PDXA 4R5ZA 4DGTA 3TFTA 1B8GA 1TARA 4R8DA 4CBRA 1BKGA 3JZLA 2R5CB 2VMXA 3HBXA 3EIBA 3RUYA 3W1IA 4CXQA 1VEFA 2VMSA 5EUEA 1AY8A 1KMJA 2ORDA 3ZZJA 3VAXA 4IY7A 4Y0HA 4RJYA 4GE4A 2EGYA 2JJFA 3WCNA 4ZM4A 5EFSA 4RKDA 3M5UA 3PIUA 2W8JA 2VMTA 3EI5A 5LH9A 1AJRA 1LS3A 2PB0A 3N4XA 3PDBB 5FT4A 3QM2A 1PFFA 5DB5A 3A2BA 4MQPA 1GEWA 3HMUA 4RM1A 1B5OA 5HHYA 1W7NA 2ZSMA 4ZASA 2EZ1A 1S08A 2FKIA 1YJZA 3RCHA 1SPAA 1AHEA 3B46A 1W3UA 1D2FA 2W7GA 1D7VA 1OATA 4EFFA 2CB1A 4W1WA 1G4XA 5C6UA 1DJ9A 2YKUA 3FQ8A 4WB0B 3JW9A 1KMKA 1MDOA 2VMYA 2X3LA 1VJOA 2ZC0A 3GZCA 4ZDPA 1LK9A 2WKAA 3MC6A 4TN4A 4B9BA 2QB2A 3FVUA 1D7SA 3E77A 1EG5A 1IVRA 4W5KA 3W1JA 5M49A 2VGWA 4GRXA 2HORA 4WYEA 1BW0A 3H14A 4EB7A 1MDXA 1UU0A 1ASEA 3AATA 1I48A 2C81A 4WP0A 4JEWA 1BJ4A 1ELQA 4ADBA 1ZOBA 2DGLA 3JWBA 1C7NA 3WY7A 1ARIA 1O62A 4BQ0A 1C7OA 4FL0A 4ITGA 4EB5A 1WYUB 2VMUA 4E3RA 1I43A 1S09A 3PGYA 1KL1A 2GMSA 4R5FA 1EJIA 1DGDA 1W7LA 2BWPA 3EI9A 3G7QA 1U08A 1C0NA 2R5EA 1YJYA 2WK9A 1V2FA 3HDOA 4IXZA 1AJSB 3VOMA 1GBNA 2DOUA 1AKBA 2DGKA 1B5PA 3FDBA 4U2HA 1WYTA 2YCTA 1LW4A 3VK4A 4OCAA 3N4SA 1D7UA 2D64A 4LW4A 1ARGA 2CH1A 1TATA 1ASDA 3HLMA 3N7NA 2Z20A 4K2MA 1MLYA 5D5SA 1P3WA 2WK7A 4WXBA 3A9ZA 2AEVA 1AMRA 4B98A 3L8AA 2X8UA 1OHVA 2CINA 1AKAA 1YIZA 5E4ZA 1ZODA 1QJ3A 2YCPA 1VP4A 4KYOA 3N4RA 2ZJGA 2YRIA 7AATA 4WXFA 3WGCA 4CVQA 1S06A 4Q31A 4XJLA 4Y0DA 3MC6C 2OATA 2YRRA 2OGEA 2W7FA 3QPGA 1RVYA 3L44A 2AY1A 2O0RA 5D95A 2WB6A 3CQ4A 4AO4A 4GSAA 1W7MA 3FKDA 1JF9A 5DX5A 4R2NA 2AY8A 1DKAA 1M7YA 3D6KA
chains in the Genus database with same CATH topology
1AMAA 2O1BA 4XK1A 3QN6A 2HUUA 3NU8A 5HXXA 1GC4A 1M0NA 4PIWA 3CQ6A 3I4JA 1W23A 1YIYA 3N0LA 5BJ3A 4JEYA 1J04A 4OTLA 3VP6A 5FT6A 1ASBA 3ASBA 3DZZA 3AEPA 1Y4IA 2BYJA 3DR4A 3ELEA 4W1XA 1TOJA 4F4EA 1AIAA 4P7YA 2AY5A 2O7CA 3BCBA 2FQ6A 2R0TA 1ARTA 2X5FA 1ASFA 1IX8A 5M4DA 1M0PA 3JTXA 3E9KA 3OP7A 3LVKA 4HF8A 4ADCA 2F8JA 3NX3A 1BQAA 3G8MA 1IX7A 1TPLA 3FRKA 3FZ7A 3FZ8A 4AZJA 1CJ0A 3WX9A 3RQ1A 3GR9A 1ORDA 2EO5A 3CBFA 2QMAA 3JWAA 2HUFA 1O4SA 1BQDA 1V2DA 2Z9VA 1ASNA 1GEXA 2YCNA 4AO9A 3GJUA 4LNMA 3KE3A 4A00A 1AY4A 3MAFB 4A6RA 3DRDA 3TCMA 2DR1A 1QGNA 3ECDA 3ZZKA 2OKJA 4RKCA 4A0FA 1SZSA 1XI9A 3N75A 2W7DA 1AMQA 2BIEA 1KL2A 5M4BA 2Z1ZA 3DU4A 1I29A 3EUCA 4M2JA 4Q6RA 5EQCA 3ATHA 2VIAA 1YAAA 1G7XA 4ZAHA 3FCRA 3MKJA 1AX4A 4JE5D 2JJHA 3FQ7A 4LNLA 4EU1A 2ZY4A 4N0WA 1QJ5A 3UWCA 2XBNA 4UOYA 4ZM3A 2GMUA 1X2AA 2VMOA 3E6GA 4N0BA 1DJUA 2BIGA 1AKCA 2NMPA 1ASCA 1M32A 4XJPA 1WKGA 3W1HA 1PMMA 5EIGB 3RBFA 5EAAA 3GBXA 1C4KA 3ISLA 5F8VA 4J5UA 3WLXA 4LNJA 1WKHA 5M46A 3PDBA 3NNKA 2Z9WA 3PAAA 4CBSA 2C0RA 1S0AA 5EUNA 1LC7A 1V72A 3DR7A 2BHXA 2VIBA 1GC2A 2A1VA 4GEBA 4ZWMA 2QSRA 4UHOA 2CFBA 3NYTA 3II0A 3WCOA 2DKJA 5EUDA 2ZUKA 3FSLA 1FG3A 2VI8A 1AHYA 3QI6A 2BI5A 3BWNA 3OKSA 4GDYA 4WB0A 4Q75A 3FFHA 3B1CA 3NU7A 4QGRA 1JS3A 4AOAA 4ATQA 2EH6A 3BV0A 3AEOA 3JU7A 4CXRA 4WYAA 4KAMA 2JJGA 4ATPA 4ITXA 5TF5A 1ASGA 2V0YA 2FN6A 3H7FA 4MQQA 4IYOB 1E5FA 5FT8A 1IAXA 4H51A 2D61A 4BMKA 2FM1A 1BT4A 1DTYA 4W91A 4GE7A 4L0OA 4P3MA 2VGTA 1DFOA 1AICA 2HOZA 4MY5A 2YKXA 1JG8A 2BYLA 3BC8A 2AY3A 4ZDOA 1WYUA 3PPLA 1BJOA 5G4JA 4M2MA 1YOOA 4WXGA 3K28A 4IXSA 3NTJA 2BI9A 3WKSA 1CS1A 3PJ0A 1QISA 3B8XA 2EPJA 2VI9A 2G6WA 3F6TA 2ZY3A 1ARHA 1AJSA 4RJ0A 4K2BA 4F5IA 1MGVA 4A0HA 1TOGA 4GE9A 2BWNA 2C7TA 3B1EA 4WYFA 3AEMA 5J8QA 3RI6A 2HP2A 1ASMA 1B9HA 1PMOA 2WK8A 3A8UX 2D7ZA 2BI1A 4JEXA 1CL1A 3BS8A 5BJ4A 1AY5A 1WYVA 3BWNC 2YKYA 2QLRA 4ZLVA 3UE8A 3H9XA 4RIZA 2JGTA 3TFUA 1UU2A 2VGZA 4AH3A 3NYSA 2ZY2A 1OXPA 2VMRA 1IJIA 3LY1A 5I92A 2W7EA 3ASAA 3TATA 3DYDA 3RBLA 1IX6A 3MADA 4E77A 1GC3A 3PD6B 3E2ZB 1N8PA 2CANA 3CQ5A 3LWSA 5DJ1A 2AY6A 2CJHA 3NUIA 1LKCA 1AIBA 3FZ6A 3QHXA 3A9YA 2AY7A 4KXKA 3T32A 3PA9A 4OMAA 2YOBA 1AAWA 2EZ2A 2Z1YA 4LW2A 2KFPA 2VMZA 2Z9UA 2AEUA 2ZP7A 3KKIA 1WSTA 1H0CA 4JF0A 3TQXA 4BA5A 3QBOA 4JE5A 2W7IA 4F5MA 5G2PA 1AHXA 3AENA 2Z9XA 4TMRA 4XJOA 2YKVA 1Z3ZA 1QITA 2ZYJA 3BWOA 5G2QA 1IBJA 4PVFA 1IUGA 2D63A 4XQ2A 1N2TA 4UHNA 2C44A 3IF2A 4ADDA 1XEYA 2W8WA 4Y0IA 2ZSLA 4JEVA 1E5EA 3GZDA 4F5LA 1M0OA 1DGEA 2YHKA 3FD0A 1MAPA 1V2EA 2QB3A 3AEMC 1C9CA 3LV2A 2QA3A 4WBTA 4IX8A 2E7IA 2PB2A 1ARSA 3AV7A 1LW5A 3RCHB 1G7WA 4MQRA 3AEJA 3NRAA 3FDDA 2W8UA 1IAYA 3LVMA 3BN1A 4OC9A 4RAEA 2R5CA 2X5DA 1OXOA 1BS0A 2Z61A 2BI2A 1AAMA 4LC3A 4IW7A 3G0TA 3MBBA 4UQVA 1JS6A 4XJMA 3MAFA 3NUBA 4FFCA 2OQXA 4RLGA 1LC5A 3B1DA 4M2KA 4WLHA 3I5TA 2XH1A 5G4IA 4DQ6A 1M4NA 4PFFA 2GB3A 2VMPA 1MDZA 1SF2A 2D7YA 2JJEA 1CL2A 1CZCA 2HOXA 3AOVA 3FVSA 4BHDA 2DGMA 2BKWA 5LHAA 1CQ7A 3LG0A 1KKJA 2V1PA 1GCKA 2JISA 3I16A 3P1TA 3GETA 2D65A 2E54A 2W7JA 3GWPA 4MGRA 4ZWVA 2G7JA 1AMSA 2RFVA 4I8AA 2CSTA 4IXOA 8AATA 5G0AA 2ZY5A 3F9TA 3Q8NA 3USFA 1CQ8A 5EAVA 4A0GA 5F9SA 1X28A 3ZRRA 2W7KA 1GDEA 2VYCA 4WYDA 1KKPA 2AY4A 3QGUA 5EIGA 4DBCA 5JAYA 2CJGA 4H63Q 5G09A 1Z7DA 4AZKA 2JG2A 4WYCA 1X29A 4HVKA 2EYQA 1AHFA 3P6KA 1O69A 1BJNA 4JEZA 4RITA 1TOIA 4U1TA 1WYTB 4ZSWA 4TV7A 2VLFA 3GZDC 3AOWA 1DJEA 2W7HA 4OBUA 3EI6A 4F5GA 1LC8A 3WGBA 4F5HA 9AATA 1FG7A 3R9AA 3E2FA 4EMYA 4MKKA 1SFFA 3ELPA 1M0QA 3AEJC 1BJOB 3FVXA 3A9XA 3N5MA 4W8IA 2VGSA 1TOEA 4J8LA 4F5FA 4K2IA 5FT5A 2GSAA 1OHYA 3DC1A 1GEYA 1J32A 3VK2A 2VMNA 1UKJA 3EI8A 5K8BA 4IYOA 1CQ6A 3HVYA 1GD9A 3FFRA 4O6ZA 5AX8A 2FNIA 2HZPA 2VLHA 4OBVA 3GSBA 3KGWA 2D5YA 3E2YA 4ADEA 1MLZA 1TASA 2CH2A 3FTBA 3K7YA 2OGAA 1C7GA 3KGXA 4A72A 1T3IA 4XAUA 3BB8A 1M6SA 4A6UA 3HQTA 1QZ9A 3R4TA 4MKJA 1GC0A 4XEWA 1RV3A 2QBTA 5IWQA 2DKBA 1RV4A 3BCAA 3EZ1A 3K40A 1I41A 5E5IA 4ISYA 1SVVA 3LVJA 4E3QA 3HL2A 1WYVB 1BJWA 4K05A 1N31A 1RVUA 2HOYA 2PO3A 2VMQA 2W7LA 3ACZA 3WZFA 4BA4A 3COGA 1SZKA 2VMWA 2BI3A 3AELA 3DODA 2W8TA 1YJSA 2AY9A 3MEBA 3NDNA 1CZEA 4NOGA 2VGUA 2FYFA 3NYUA 1G4VA 2E7UA 4OYTA 2E7JA 4WYGA 3ZRQA 4F5KA 2HUIA 1S07A 1D7RA 4JF1A 2OKKA 3EI7A 1EQBA 3EZSA 1QIRA 1ELUA 1MAQA 2TPLA 1SZUA 2VMVA 3DXWA 1PG8A 3DXVA 5KTBA 4W1VA 4WD2A 2D66A 2HP1A 1FC4A 3VK3A 4OT8A 2GQNA 4A0RA 2AY2A 1YNUA 1UU1A 3LVLB 1O61A 2AATA 3FQAA 4ZSYA 2BWOA 3AENB 1ASAA 4MSOA 4E1OA 2VGVA 1H1CA 1X0MA 2CTZA 2Q7WA 4UHMA 4WLJA 1B4XA 5HDMA 2BIAA 1OHWA 2FNUA 3HT4A 1ZC9A 4Q76A 3EIAA 4PFNA 5E3KA 3IHJA 2CY8A 4ZDLA 3ZRPA 2CJDA 2R2NA 3PD6A 3E2ZA 5DJ9A 1ASLA 2Z67A 3WKRA 3BCXA 3F0HA 1AHGA 2W8VA 1TOKA 3MAUA 4A6TA 3CAIA 4F5JA 2W7MA 1B9IA 3UAKA 1ECXA 3PDXA 4R5ZA 4DGTA 3TFTA 1B8GA 1TARA 4R8DA 4CBRA 1BKGA 3JZLA 2R5CB 2VMXA 3HBXA 3EIBA 3RUYA 3W1IA 4CXQA 1VEFA 2VMSA 5EUEA 1AY8A 1KMJA 2ORDA 3ZZJA 3VAXA 4IY7A 4Y0HA 4RJYA 4GE4A 2EGYA 2JJFA 3WCNA 4ZM4A 5EFSA 4RKDA 3M5UA 3PIUA 2W8JA 2VMTA 3EI5A 5LH9A 1AJRA 1LS3A 2PB0A 3N4XA 3PDBB 5FT4A 3QM2A 1PFFA 5DB5A 3A2BA 4MQPA 1GEWA 3HMUA 4RM1A 1B5OA 5HHYA 1W7NA 2ZSMA 4ZASA 2EZ1A 1S08A 2FKIA 1YJZA 3RCHA 1SPAA 1AHEA 3B46A 1W3UA 1D2FA 2W7GA 1D7VA 1OATA 4EFFA 2CB1A 4W1WA 1G4XA 5C6UA 1DJ9A 2YKUA 3FQ8A 4WB0B 3JW9A 1KMKA 1MDOA 2VMYA 2X3LA 1VJOA 2ZC0A 3GZCA 4ZDPA 1LK9A 2WKAA 3MC6A 4TN4A 4B9BA 2QB2A 3FVUA 1D7SA 3E77A 1EG5A 1IVRA 4W5KA 3W1JA 5M49A 2VGWA 4GRXA 2HORA 4WYEA 1BW0A 3H14A 4EB7A 1MDXA 1UU0A 1ASEA 3AATA 1I48A 2C81A 4WP0A 4JEWA 1BJ4A 1ELQA 4ADBA 1ZOBA 2DGLA 3JWBA 1C7NA 3WY7A 1ARIA 1O62A 4BQ0A 1C7OA 4FL0A 4ITGA 4EB5A 1WYUB 2VMUA 4E3RA 1I43A 1S09A 3PGYA 1KL1A 2GMSA 4R5FA 1EJIA 1DGDA 1W7LA 2BWPA 3EI9A 3G7QA 1U08A 1C0NA 2R5EA 1YJYA 2WK9A 1V2FA 3HDOA 4IXZA 1AJSB 3VOMA 1GBNA 2DOUA 1AKBA 2DGKA 1B5PA 3FDBA 4U2HA 1WYTA 2YCTA 1LW4A 3VK4A 4OCAA 3N4SA 1D7UA 2D64A 4LW4A 1ARGA 2CH1A 1TATA 1ASDA 3HLMA 3N7NA 2Z20A 4K2MA 1MLYA 5D5SA 1P3WA 2WK7A 4WXBA 3A9ZA 2AEVA 1AMRA 4B98A 3L8AA 2X8UA 1OHVA 2CINA 1AKAA 1YIZA 5E4ZA 1ZODA 1QJ3A 2YCPA 1VP4A 4KYOA 3N4RA 2ZJGA 2YRIA 7AATA 4WXFA 3WGCA 4CVQA 1S06A 4Q31A 4XJLA 4Y0DA 3MC6C 2OATA 2YRRA 2OGEA 2W7FA 3QPGA 1RVYA 3L44A 2AY1A 2O0RA 5D95A 2WB6A 3CQ4A 4AO4A 4GSAA 1W7MA 3FKDA 1JF9A 5DX5A 4R2NA 2AY8A 1DKAA 1M7YA 3D6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AMA A;  2O1B A;  4XK1 A;  3QN6 A;  2HUU A;  3NU8 A;  5HXX A;  1GC4 A;  1M0N A;  4PIW A;  3CQ6 A;  3I4J A;  1W23 A;  1YIY A;  3N0L A;  5BJ3 A;  4JEY A;  1J04 A;  4OTL A;  3VP6 A;  5FT6 A;  1ASB A;  3ASB A;  3DZZ A;  3AEP A;  1Y4I A;  2BYJ A;  3DR4 A;  3ELE A;  4W1X A;  1TOJ A;  4F4E A;  1AIA A;  4P7Y A;  2AY5 A;  2O7C A;  3BCB A;  2FQ6 A;  2R0T A;  1ART A;  2X5F A;  1ASF A;  1IX8 A;  5M4D A;  1M0P A;  3JTX A;  3E9K A;  3OP7 A;  3LVK A;  4HF8 A;  4ADC A;  2F8J A;  3NX3 A;  1BQA A;  3G8M A;  1IX7 A;  1TPL A;  3FRK A;  3FZ7 A;  3FZ8 A;  4AZJ A;  1CJ0 A;  3WX9 A;  3RQ1 A;  3GR9 A;  1ORD A;  2EO5 A;  3CBF A;  2QMA A;  3JWA A;  2HUF A;  1O4S A;  1BQD A;  1V2D A;  2Z9V A;  1ASN A;  1GEX A;  2YCN A;  4AO9 A;  3GJU A;  4LNM A;  3KE3 A;  4A00 A;  1AY4 A;  3MAF B;  4A6R A;  3DRD A;  3TCM A;  2DR1 A;  1QGN A;  3ECD A;  3ZZK A;  2OKJ A;  4RKC A;  4A0F A;  1SZS A;  1XI9 A;  3N75 A;  2W7D A;  1AMQ A;  2BIE A;  1KL2 A;  5M4B A;  2Z1Z A;  3DU4 A;  1I29 A;  3EUC A;  4M2J A;  4Q6R A;  5EQC A;  3ATH A;  2VIA A;  1YAA A;  1G7X A;  4ZAH A;  3FCR A;  3MKJ A;  1AX4 A;  4JE5 D;  2JJH A;  3FQ7 A;  4LNL A;  4EU1 A;  4N0W A;  1QJ5 A;  3UWC A;  2XBN A;  4UOY A;  4ZM3 A;  2GMU A;  1X2A A;  2VMO A;  3E6G A;  4N0B A;  1DJU A;  2BIG A;  1AKC A;  2NMP A;  1ASC A;  1M32 A;  4XJP A;  1WKG A;  3W1H A;  1PMM A;  5EIG B;  3RBF A;  5EAA A;  3GBX A;  1C4K A;  3ISL A;  5F8V A;  4J5U A;  3WLX A;  4LNJ A;  1WKH A;  5M46 A;  3PDB A;  3NNK A;  2Z9W A;  3PAA A;  4CBS A;  2C0R A;  1S0A A;  5EUN A;  1LC7 A;  1V72 A;  3DR7 A;  2BHX A;  2VIB A;  1GC2 A;  4GEB A;  4ZWM A;  4UHO A;  2CFB A;  3NYT A;  3II0 A;  3WCO A;  2DKJ A;  5EUD A;  2ZUK A;  3FSL A;  1FG3 A;  2VI8 A;  1AHY A;  3QI6 A;  2BI5 A;  3BWN A;  3OKS A;  4GDY A;  4WB0 A;  4Q75 A;  3FFH A;  3B1C A;  3NU7 A;  4QGR A;  1JS3 A;  4AOA A;  4ATQ A;  2EH6 A;  3BV0 A;  3AEO A;  3JU7 A;  4CXR A;  4WYA A;  4KAM A;  2JJG A;  4ATP A;  4ITX A;  5TF5 A;  1ASG A;  2V0Y A;  2FN6 A;  3H7F A;  4MQQ A;  4IYO B;  1E5F A;  5FT8 A;  1IAX A;  4H51 A;  2D61 A;  4BMK A;  2FM1 A;  1BT4 A;  1DTY A;  4W91 A;  4GE7 A;  4L0O A;  4P3M A;  2VGT A;  1DFO A;  1AIC A;  2HOZ A;  4MY5 A;  2YKX A;  1JG8 A;  2BYL A;  3BC8 A;  2AY3 A;  4ZDO A;  1WYU A;  3PPL A;  1BJO A;  5G4J A;  4M2M A;  1YOO A;  4WXG A;  3K28 A;  4IXS A;  3NTJ A;  2BI9 A;  3WKS A;  1CS1 A;  3PJ0 A;  1QIS A;  3B8X A;  2EPJ A;  2VI9 A;  2G6W A;  3F6T A;  1ARH A;  1AJS A;  4RJ0 A;  4K2B A;  4F5I A;  1MGV A;  4A0H A;  1TOG A;  4GE9 A;  2BWN A;  2C7T A;  3B1E A;  4WYF A;  3AEM A;  5J8Q A;  3RI6 A;  2HP2 A;  1ASM A;  1B9H A;  1PMO A;  2WK8 A;  3A8U X;  2D7Z A;  2BI1 A;  4JEX A;  1CL1 A;  3BS8 A;  5BJ4 A;  1AY5 A;  1WYV A;  3BWN C;  2YKY A;  2QLR A;  4ZLV A;  3UE8 A;  4RIZ A;  2JGT A;  3TFU A;  1UU2 A;  2VGZ A;  4AH3 A;  3NYS A;  1OXP A;  2VMR A;  1IJI A;  3LY1 A;  5I92 A;  2W7E A;  3ASA A;  3TAT A;  3DYD A;  3RBL A;  1IX6 A;  3MAD A;  4E77 A;  1GC3 A;  3PD6 B;  3E2Z B;  1N8P A;  2CAN A;  3CQ5 A;  3LWS A;  5DJ1 A;  2AY6 A;  2CJH A;  3NUI A;  1LKC A;  1AIB A;  3FZ6 A;  3QHX A;  3A9Y A;  2AY7 A;  4KXK A;  3T32 A;  3PA9 A;  4OMA A;  2YOB A;  1AAW A;  2EZ2 A;  2Z1Y A;  4LW2 A;  2VMZ A;  2Z9U A;  2AEU A;  2ZP7 A;  3KKI A;  1WST A;  1H0C A;  4JF0 A;  3TQX A;  4BA5 A;  3QBO A;  4JE5 A;  2W7I A;  4F5M A;  5G2P A;  1AHX A;  3AEN A;  2Z9X A;  4TMR A;  4XJO A;  2YKV A;  1Z3Z A;  1QIT A;  2ZYJ A;  3BWO A;  5G2Q A;  1IBJ A;  4PVF A;  1IUG A;  2D63 A;  4XQ2 A;  1N2T A;  4UHN A;  2C44 A;  3IF2 A;  4ADD A;  1XEY A;  2W8W A;  4Y0I A;  2ZSL A;  4JEV A;  1E5E A;  3GZD A;  4F5L A;  1M0O A;  1DGE A;  2YHK A;  3FD0 A;  1MAP A;  1V2E A;  2QB3 A;  3AEM C;  1C9C A;  3LV2 A;  2QA3 A;  4WBT A;  4IX8 A;  2E7I A;  2PB2 A;  1ARS A;  3AV7 A;  1LW5 A;  3RCH B;  1G7W A;  4MQR A;  3AEJ A;  3NRA A;  2W8U A;  1IAY A;  3LVM A;  3BN1 A;  4OC9 A;  4RAE A;  2R5C A;  2X5D A;  1OXO A;  1BS0 A;  2Z61 A;  2BI2 A;  1AAM A;  4LC3 A;  4IW7 A;  3G0T A;  3MBB A;  4UQV A;  1JS6 A;  4XJM A;  3MAF A;  3NUB A;  4FFC A;  2OQX A;  4RLG A;  1LC5 A;  3B1D A;  4M2K A;  4WLH A;  3I5T A;  2XH1 A;  5G4I A;  4DQ6 A;  1M4N A;  4PFF A;  2GB3 A;  2VMP A;  1MDZ A;  1SF2 A;  2D7Y A;  2JJE A;  1CL2 A;  1CZC A;  2HOX A;  3AOV A;  3FVS A;  4BHD A;  2DGM A;  2BKW A;  5LHA A;  1CQ7 A;  3LG0 A;  1KKJ A;  2V1P A;  1GCK A;  2JIS A;  3I16 A;  3P1T A;  3GET A;  2D65 A;  2E54 A;  2W7J A;  3GWP A;  4MGR A;  4ZWV A;  1AMS A;  2RFV A;  4I8A A;  2CST A;  4IXO A;  8AAT A;  5G0A A;  3F9T A;  3Q8N A;  3USF A;  1CQ8 A;  5EAV A;  4A0G A;  5F9S A;  1X28 A;  3ZRR A;  2W7K A;  1GDE A;  2VYC A;  4WYD A;  1KKP A;  2AY4 A;  3QGU A;  5EIG A;  4DBC A;  5JAY A;  2CJG A;  5G09 A;  1Z7D A;  4AZK A;  2JG2 A;  4WYC A;  1X29 A;  4HVK A;  1AHF A;  3P6K A;  1O69 A;  1BJN A;  4JEZ A;  4RIT A;  1TOI A;  4U1T A;  1WYT B;  4ZSW A;  4TV7 A;  2VLF A;  3GZD C;  3AOW A;  1DJE A;  2W7H A;  4OBU A;  3EI6 A;  4F5G A;  1LC8 A;  3WGB A;  4F5H A;  9AAT A;  1FG7 A;  3R9A A;  3E2F A;  4EMY A;  4MKK A;  1SFF A;  3ELP A;  1M0Q A;  3AEJ C;  1BJO B;  3FVX A;  3A9X A;  3N5M A;  4W8I A;  2VGS A;  1TOE A;  4J8L A;  4F5F A;  4K2I A;  5FT5 A;  2GSA A;  1OHY A;  3DC1 A;  1GEY A;  1J32 A;  3VK2 A;  2VMN A;  1UKJ A;  3EI8 A;  5K8B A;  4IYO A;  1CQ6 A;  3HVY A;  1GD9 A;  3FFR A;  4O6Z A;  5AX8 A;  2FNI A;  2HZP A;  2VLH A;  4OBV A;  3GSB A;  3KGW A;  2D5Y A;  3E2Y A;  4ADE A;  1MLZ A;  1TAS A;  2CH2 A;  3FTB A;  3K7Y A;  2OGA A;  1C7G A;  3KGX A;  4A72 A;  1T3I A;  4XAU A;  3BB8 A;  1M6S A;  4A6U A;  3HQT A;  1QZ9 A;  3R4T A;  4MKJ A;  1GC0 A;  4XEW A;  1RV3 A;  2QBT A;  5IWQ A;  2DKB A;  1RV4 A;  3BCA A;  3EZ1 A;  3K40 A;  1I41 A;  5E5I A;  4ISY A;  1SVV A;  3LVJ A;  4E3Q A;  3HL2 A;  1WYV B;  1BJW A;  1N31 A;  1RVU A;  2HOY A;  2PO3 A;  2VMQ A;  2W7L A;  3ACZ A;  3WZF A;  4BA4 A;  3COG A;  1SZK A;  2VMW A;  2BI3 A;  3AEL A;  3DOD A;  2W8T A;  1YJS A;  2AY9 A;  3MEB A;  3NDN A;  1CZE A;  4NOG A;  2VGU A;  2FYF A;  3NYU A;  1G4V A;  2E7U A;  4OYT A;  2E7J A;  4WYG A;  3ZRQ A;  4F5K A;  2HUI A;  1S07 A;  1D7R A;  4JF1 A;  2OKK A;  3EI7 A;  1EQB A;  3EZS A;  1QIR A;  1ELU A;  1MAQ A;  2TPL A;  1SZU A;  2VMV A;  3DXW A;  1PG8 A;  3DXV A;  4W1V A;  4WD2 A;  2D66 A;  2HP1 A;  1FC4 A;  3VK3 A;  4OT8 A;  2GQN A;  4A0R A;  2AY2 A;  1YNU A;  1UU1 A;  3LVL B;  1O61 A;  2AAT A;  3FQA A;  4ZSY A;  2BWO A;  3AEN B;  1ASA A;  4MSO A;  4E1O A;  2VGV A;  1H1C A;  1X0M A;  2CTZ A;  2Q7W A;  4UHM A;  4WLJ A;  1B4X A;  5HDM A;  2BIA A;  1OHW A;  2FNU A;  3HT4 A;  1ZC9 A;  4Q76 A;  3EIA A;  4PFN A;  5E3K A;  3IHJ A;  2CY8 A;  4ZDL A;  3ZRP A;  2CJD A;  2R2N A;  3PD6 A;  3E2Z A;  5DJ9 A;  1ASL A;  2Z67 A;  3WKR A;  3BCX A;  3F0H A;  1AHG A;  2W8V A;  1TOK A;  3MAU A;  4A6T A;  3CAI A;  4F5J A;  2W7M A;  1B9I A;  3UAK A;  1ECX A;  3PDX A;  4R5Z A;  4DGT A;  3TFT A;  1B8G A;  1TAR A;  4R8D A;  4CBR A;  1BKG A;  3JZL A;  2R5C B;  2VMX A;  3HBX A;  3EIB A;  3RUY A;  3W1I A;  4CXQ A;  1VEF A;  2VMS A;  5EUE A;  1AY8 A;  1KMJ A;  2ORD A;  3ZZJ A;  3VAX A;  4IY7 A;  4Y0H A;  4RJY A;  4GE4 A;  2EGY A;  2JJF A;  3WCN A;  4ZM4 A;  5EFS A;  4RKD A;  3M5U A;  3PIU A;  2W8J A;  2VMT A;  3EI5 A;  5LH9 A;  1AJR A;  1LS3 A;  2PB0 A;  3PDB B;  5FT4 A;  3QM2 A;  1PFF A;  5DB5 A;  3A2B A;  4MQP A;  1GEW A;  3HMU A;  4RM1 A;  1B5O A;  5HHY A;  1W7N A;  2ZSM A;  4ZAS A;  2EZ1 A;  1S08 A;  1YJZ A;  3RCH A;  1SPA A;  1AHE A;  3B46 A;  1W3U A;  1D2F A;  2W7G A;  1D7V A;  1OAT A;  4EFF A;  2CB1 A;  4W1W A;  1G4X A;  5C6U A;  1DJ9 A;  2YKU A;  3FQ8 A;  4WB0 B;  3JW9 A;  1KMK A;  1MDO A;  2VMY A;  2X3L A;  1VJO A;  2ZC0 A;  3GZC A;  4ZDP A;  1LK9 A;  2WKA A;  3MC6 A;  4TN4 A;  4B9B A;  2QB2 A;  3FVU A;  1D7S A;  3E77 A;  1EG5 A;  1IVR A;  4W5K A;  3W1J A;  5M49 A;  2VGW A;  4GRX A;  2HOR A;  4WYE A;  1BW0 A;  3H14 A;  4EB7 A;  1MDX A;  1UU0 A;  1ASE A;  3AAT A;  1I48 A;  2C81 A;  4WP0 A;  4JEW A;  1BJ4 A;  1ELQ A;  4ADB A;  1ZOB A;  2DGL A;  3JWB A;  1C7N A;  3WY7 A;  1ARI A;  1O62 A;  4BQ0 A;  1C7O A;  4FL0 A;  4ITG A;  4EB5 A;  1WYU B;  2VMU A;  4E3R A;  1I43 A;  1S09 A;  3PGY A;  1KL1 A;  2GMS A;  4R5F A;  1EJI A;  1DGD A;  1W7L A;  2BWP A;  3EI9 A;  3G7Q A;  1U08 A;  1C0N A;  2R5E A;  1YJY A;  2WK9 A;  1V2F A;  3HDO A;  4IXZ A;  1AJS B;  3VOM A;  1GBN A;  2DOU A;  1AKB A;  2DGK A;  1B5P A;  3FDB A;  4U2H A;  1WYT A;  2YCT A;  1LW4 A;  3VK4 A;  4OCA A;  1D7U A;  2D64 A;  4LW4 A;  1ARG A;  2CH1 A;  1TAT A;  1ASD A;  3HLM A;  2Z20 A;  4K2M A;  1MLY A;  5D5S A;  1P3W A;  2WK7 A;  4WXB A;  3A9Z A;  2AEV A;  1AMR A;  4B98 A;  3L8A A;  2X8U A;  1OHV A;  2CIN A;  1AKA A;  1YIZ A;  5E4Z A;  1ZOD A;  1QJ3 A;  2YCP A;  1VP4 A;  4KYO A;  2ZJG A;  2YRI A;  7AAT A;  4WXF A;  3WGC A;  4CVQ A;  1S06 A;  4Q31 A;  4XJL A;  4Y0D A;  3MC6 C;  2OAT A;  2YRR A;  2OGE A;  2W7F A;  3QPG A;  1RVY A;  3L44 A;  2AY1 A;  2O0R A;  5D95 A;  3CQ4 A;  4AO4 A;  4GSA A;  1W7M A;  3FKD A;  1JF9 A;  5DX5 A;  4R2N A;  2AY8 A;  1DKA A;  1M7Y A;  3D6K A; 
#chains in the Genus database with same CATH topology
 1AMA A;  2O1B A;  4XK1 A;  3QN6 A;  2HUU A;  3NU8 A;  5HXX A;  1GC4 A;  1M0N A;  4PIW A;  3CQ6 A;  3I4J A;  1W23 A;  1YIY A;  3N0L A;  5BJ3 A;  4JEY A;  1J04 A;  4OTL A;  3VP6 A;  5FT6 A;  1ASB A;  3ASB A;  3DZZ A;  3AEP A;  1Y4I A;  2BYJ A;  3DR4 A;  3ELE A;  4W1X A;  1TOJ A;  4F4E A;  1AIA A;  4P7Y A;  2AY5 A;  2O7C A;  3BCB A;  2FQ6 A;  2R0T A;  1ART A;  2X5F A;  1ASF A;  1IX8 A;  5M4D A;  1M0P A;  3JTX A;  3E9K A;  3OP7 A;  3LVK A;  4HF8 A;  4ADC A;  2F8J A;  3NX3 A;  1BQA A;  3G8M A;  1IX7 A;  1TPL A;  3FRK A;  3FZ7 A;  3FZ8 A;  4AZJ A;  1CJ0 A;  3WX9 A;  3RQ1 A;  3GR9 A;  1ORD A;  2EO5 A;  3CBF A;  2QMA A;  3JWA A;  2HUF A;  1O4S A;  1BQD A;  1V2D A;  2Z9V A;  1ASN A;  1GEX A;  2YCN A;  4AO9 A;  3GJU A;  4LNM A;  3KE3 A;  4A00 A;  1AY4 A;  3MAF B;  4A6R A;  3DRD A;  3TCM A;  2DR1 A;  1QGN A;  3ECD A;  3ZZK A;  2OKJ A;  4RKC A;  4A0F A;  1SZS A;  1XI9 A;  3N75 A;  2W7D A;  1AMQ A;  2BIE A;  1KL2 A;  5M4B A;  2Z1Z A;  3DU4 A;  1I29 A;  3EUC A;  4M2J A;  4Q6R A;  5EQC A;  3ATH A;  2VIA A;  1YAA A;  1G7X A;  4ZAH A;  3FCR A;  3MKJ A;  1AX4 A;  4JE5 D;  2JJH A;  3FQ7 A;  4LNL A;  4EU1 A;  2ZY4 A;  4N0W A;  1QJ5 A;  3UWC A;  2XBN A;  4UOY A;  4ZM3 A;  2GMU A;  1X2A A;  2VMO A;  3E6G A;  4N0B A;  1DJU A;  2BIG A;  1AKC A;  2NMP A;  1ASC A;  1M32 A;  4XJP A;  1WKG A;  3W1H A;  1PMM A;  5EIG B;  3RBF A;  5EAA A;  3GBX A;  1C4K A;  3ISL A;  5F8V A;  4J5U A;  3WLX A;  4LNJ A;  1WKH A;  5M46 A;  3PDB A;  3NNK A;  2Z9W A;  3PAA A;  4CBS A;  2C0R A;  1S0A A;  5EUN A;  1LC7 A;  1V72 A;  3DR7 A;  2BHX A;  2VIB A;  1GC2 A;  2A1V A;  4GEB A;  4ZWM A;  2QSR A;  4UHO A;  2CFB A;  3NYT A;  3II0 A;  3WCO A;  2DKJ A;  5EUD A;  2ZUK A;  3FSL A;  1FG3 A;  2VI8 A;  1AHY A;  3QI6 A;  2BI5 A;  3BWN A;  3OKS A;  4GDY A;  4WB0 A;  4Q75 A;  3FFH A;  3B1C A;  3NU7 A;  4QGR A;  1JS3 A;  4AOA A;  4ATQ A;  2EH6 A;  3BV0 A;  3AEO A;  3JU7 A;  4CXR A;  4WYA A;  4KAM A;  2JJG A;  4ATP A;  4ITX A;  5TF5 A;  1ASG A;  2V0Y A;  2FN6 A;  3H7F A;  4MQQ A;  4IYO B;  1E5F A;  5FT8 A;  1IAX A;  4H51 A;  2D61 A;  4BMK A;  2FM1 A;  1BT4 A;  1DTY A;  4W91 A;  4GE7 A;  4L0O A;  4P3M A;  2VGT A;  1DFO A;  1AIC A;  2HOZ A;  4MY5 A;  2YKX A;  1JG8 A;  2BYL A;  3BC8 A;  2AY3 A;  4ZDO A;  1WYU A;  3PPL A;  1BJO A;  5G4J A;  4M2M A;  1YOO A;  4WXG A;  3K28 A;  4IXS A;  3NTJ A;  2BI9 A;  3WKS A;  1CS1 A;  3PJ0 A;  1QIS A;  3B8X A;  2EPJ A;  2VI9 A;  2G6W A;  3F6T A;  2ZY3 A;  1ARH A;  1AJS A;  4RJ0 A;  4K2B A;  4F5I A;  1MGV A;  4A0H A;  1TOG A;  4GE9 A;  2BWN A;  2C7T A;  3B1E A;  4WYF A;  3AEM A;  5J8Q A;  3RI6 A;  2HP2 A;  1ASM A;  1B9H A;  1PMO A;  2WK8 A;  3A8U X;  2D7Z A;  2BI1 A;  4JEX A;  1CL1 A;  3BS8 A;  5BJ4 A;  1AY5 A;  1WYV A;  3BWN C;  2YKY A;  2QLR A;  4ZLV A;  3UE8 A;  3H9X A;  4RIZ A;  2JGT A;  3TFU A;  1UU2 A;  2VGZ A;  4AH3 A;  3NYS A;  2ZY2 A;  1OXP A;  2VMR A;  1IJI A;  3LY1 A;  5I92 A;  2W7E A;  3ASA A;  3TAT A;  3DYD A;  3RBL A;  1IX6 A;  3MAD A;  4E77 A;  1GC3 A;  3PD6 B;  3E2Z B;  1N8P A;  2CAN A;  3CQ5 A;  3LWS A;  5DJ1 A;  2AY6 A;  2CJH A;  3NUI A;  1LKC A;  1AIB A;  3FZ6 A;  3QHX A;  3A9Y A;  2AY7 A;  4KXK A;  3T32 A;  3PA9 A;  4OMA A;  2YOB A;  1AAW A;  2EZ2 A;  2Z1Y A;  4LW2 A;  2KFP A;  2VMZ A;  2Z9U A;  2AEU A;  2ZP7 A;  3KKI A;  1WST A;  1H0C A;  4JF0 A;  3TQX A;  4BA5 A;  3QBO A;  4JE5 A;  2W7I A;  4F5M A;  5G2P A;  1AHX A;  3AEN A;  2Z9X A;  4TMR A;  4XJO A;  2YKV A;  1Z3Z A;  1QIT A;  2ZYJ A;  3BWO A;  5G2Q A;  1IBJ A;  4PVF A;  1IUG A;  2D63 A;  4XQ2 A;  1N2T A;  4UHN A;  2C44 A;  3IF2 A;  4ADD A;  1XEY A;  2W8W A;  4Y0I A;  2ZSL A;  4JEV A;  1E5E A;  3GZD A;  4F5L A;  1M0O A;  1DGE A;  2YHK A;  3FD0 A;  1MAP A;  1V2E A;  2QB3 A;  3AEM C;  1C9C A;  3LV2 A;  2QA3 A;  4WBT A;  4IX8 A;  2E7I A;  2PB2 A;  1ARS A;  3AV7 A;  1LW5 A;  3RCH B;  1G7W A;  4MQR A;  3AEJ A;  3NRA A;  3FDD A;  2W8U A;  1IAY A;  3LVM A;  1KAF A;  3BN1 A;  4OC9 A;  4RAE A;  2R5C A;  2X5D A;  1OXO A;  1BS0 A;  2Z61 A;  2BI2 A;  1AAM A;  4LC3 A;  4IW7 A;  3G0T A;  3MBB A;  4UQV A;  1JS6 A;  4XJM A;  3MAF A;  3NUB A;  4FFC A;  2OQX A;  4RLG A;  1LC5 A;  3B1D A;  4M2K A;  4WLH A;  3I5T A;  2XH1 A;  5G4I A;  4DQ6 A;  1M4N A;  4PFF A;  2GB3 A;  2VMP A;  1MDZ A;  1SF2 A;  2D7Y A;  2JJE A;  1CL2 A;  1CZC A;  2HOX A;  3AOV A;  3FVS A;  4BHD A;  2DGM A;  2BKW A;  5LHA A;  1CQ7 A;  3LG0 A;  1KKJ A;  2V1P A;  1GCK A;  2JIS A;  3I16 A;  3P1T A;  3GET A;  2D65 A;  2E54 A;  2W7J A;  3GWP A;  4MGR A;  4ZWV A;  2G7J A;  1AMS A;  2RFV A;  4I8A A;  2CST A;  4IXO A;  8AAT A;  5G0A A;  2ZY5 A;  3F9T A;  3Q8N A;  3USF A;  1CQ8 A;  5EAV A;  4A0G A;  5F9S A;  1X28 A;  3ZRR A;  2W7K A;  1GDE A;  2VYC A;  4WYD A;  1KKP A;  2AY4 A;  3QGU A;  5EIG A;  4DBC A;  5JAY A;  2CJG A;  4H63 Q;  5G09 A;  1Z7D A;  4AZK A;  2JG2 A;  4WYC A;  1X29 A;  4HVK A;  2EYQ A;  1AHF A;  3P6K A;  1O69 A;  1BJN A;  4JEZ A;  4RIT A;  1TOI A;  4U1T A;  1WYT B;  4ZSW A;  4TV7 A;  2VLF A;  3GZD C;  3AOW A;  1DJE A;  2W7H A;  4OBU A;  3EI6 A;  4F5G A;  1LC8 A;  3WGB A;  4F5H A;  9AAT A;  1FG7 A;  3R9A A;  3E2F A;  4EMY A;  4MKK A;  1SFF A;  3ELP A;  1M0Q A;  3AEJ C;  1BJO B;  3FVX A;  3A9X A;  3N5M A;  4W8I A;  2VGS A;  1TOE A;  4J8L A;  4F5F A;  4K2I A;  5FT5 A;  2GSA A;  1OHY A;  3DC1 A;  1GEY A;  1J32 A;  3VK2 A;  2VMN A;  1UKJ A;  3EI8 A;  5K8B A;  4IYO A;  1CQ6 A;  3HVY A;  1GD9 A;  3FFR A;  4O6Z A;  5AX8 A;  2FNI A;  2HZP A;  2VLH A;  4OBV A;  3GSB A;  3KGW A;  2D5Y A;  3E2Y A;  4ADE A;  1MLZ A;  1TAS A;  2CH2 A;  3FTB A;  3K7Y A;  2OGA A;  1C7G A;  3KGX A;  4A72 A;  1T3I A;  4XAU A;  3BB8 A;  1M6S A;  4A6U A;  3HQT A;  1QZ9 A;  3R4T A;  4MKJ A;  1GC0 A;  4XEW A;  1RV3 A;  2QBT A;  5IWQ A;  2DKB A;  1RV4 A;  3BCA A;  3EZ1 A;  3K40 A;  1I41 A;  5E5I A;  4ISY A;  1SVV A;  3LVJ A;  4E3Q A;  3HL2 A;  1WYV B;  1BJW A;  4K05 A;  1N31 A;  1RVU A;  2HOY A;  2PO3 A;  2VMQ A;  2W7L A;  3ACZ A;  3WZF A;  4BA4 A;  3COG A;  1SZK A;  2VMW A;  2BI3 A;  3AEL A;  3DOD A;  2W8T A;  1YJS A;  2AY9 A;  3MEB A;  3NDN A;  1CZE A;  4NOG A;  2VGU A;  2FYF A;  3NYU A;  1G4V A;  2E7U A;  4OYT A;  2E7J A;  4WYG A;  3ZRQ A;  4F5K A;  2HUI A;  1S07 A;  1D7R A;  4JF1 A;  2OKK A;  3EI7 A;  1EQB A;  3EZS A;  1QIR A;  1ELU A;  1MAQ A;  2TPL A;  1SZU A;  2VMV A;  3DXW A;  1PG8 A;  3DXV A;  5KTB A;  4W1V A;  4WD2 A;  2D66 A;  2HP1 A;  1FC4 A;  3VK3 A;  4OT8 A;  2GQN A;  4A0R A;  2AY2 A;  1YNU A;  1UU1 A;  3LVL B;  1O61 A;  2AAT A;  3FQA A;  4ZSY A;  2BWO A;  3AEN B;  1ASA A;  4MSO A;  4E1O A;  2VGV A;  1H1C A;  1X0M A;  2CTZ A;  2Q7W A;  4UHM A;  4WLJ A;  1B4X A;  5HDM A;  2BIA A;  1OHW A;  2FNU A;  3HT4 A;  1ZC9 A;  4Q76 A;  3EIA A;  4PFN A;  5E3K A;  3IHJ A;  2CY8 A;  4ZDL A;  3ZRP A;  2CJD A;  2R2N A;  3PD6 A;  3E2Z A;  5DJ9 A;  1ASL A;  2Z67 A;  3WKR A;  3BCX A;  3F0H A;  1AHG A;  2W8V A;  1TOK A;  3MAU A;  4A6T A;  3CAI A;  4F5J A;  2W7M A;  1B9I A;  3UAK A;  1ECX A;  3PDX A;  4R5Z A;  4DGT A;  3TFT A;  1B8G A;  1TAR A;  4R8D A;  4CBR A;  1BKG A;  3JZL A;  2R5C B;  2VMX A;  3HBX A;  3EIB A;  3RUY A;  3W1I A;  4CXQ A;  1VEF A;  2VMS A;  5EUE A;  1AY8 A;  1KMJ A;  2ORD A;  3ZZJ A;  3VAX A;  4IY7 A;  4Y0H A;  4RJY A;  4GE4 A;  2EGY A;  2JJF A;  3WCN A;  4ZM4 A;  5EFS A;  4RKD A;  3M5U A;  3PIU A;  2W8J A;  2VMT A;  3EI5 A;  5LH9 A;  1AJR A;  1LS3 A;  2PB0 A;  3N4X A;  3PDB B;  5FT4 A;  3QM2 A;  1PFF A;  5DB5 A;  3A2B A;  4MQP A;  1GEW A;  3HMU A;  4RM1 A;  1B5O A;  5HHY A;  1W7N A;  2ZSM A;  4ZAS A;  2EZ1 A;  1S08 A;  2FKI A;  1YJZ A;  3RCH A;  1SPA A;  1AHE A;  3B46 A;  1W3U A;  1D2F A;  2W7G A;  1D7V A;  1OAT A;  4EFF A;  2CB1 A;  4W1W A;  1G4X A;  5C6U A;  1DJ9 A;  2YKU A;  3FQ8 A;  4WB0 B;  3JW9 A;  1KMK A;  1MDO A;  2VMY A;  2X3L A;  1VJO A;  2ZC0 A;  3GZC A;  4ZDP A;  1LK9 A;  2WKA A;  3MC6 A;  4TN4 A;  4B9B A;  2QB2 A;  3FVU A;  1D7S A;  3E77 A;  1EG5 A;  1IVR A;  4W5K A;  3W1J A;  5M49 A;  2VGW A;  4GRX A;  2HOR A;  4WYE A;  1BW0 A;  3H14 A;  4EB7 A;  1MDX A;  1UU0 A;  1ASE A;  3AAT A;  1I48 A;  2C81 A;  4WP0 A;  4JEW A;  1BJ4 A;  1ELQ A;  4ADB A;  1ZOB A;  2DGL A;  3JWB A;  1C7N A;  3WY7 A;  1ARI A;  1O62 A;  4BQ0 A;  1C7O A;  4FL0 A;  4ITG A;  4EB5 A;  1WYU B;  2VMU A;  4E3R A;  1I43 A;  1S09 A;  3PGY A;  1KL1 A;  2GMS A;  4R5F A;  1EJI A;  1DGD A;  1W7L A;  2BWP A;  3EI9 A;  3G7Q A;  1U08 A;  1C0N A;  2R5E A;  1YJY A;  2WK9 A;  1V2F A;  3HDO A;  4IXZ A;  1AJS B;  3VOM A;  1GBN A;  2DOU A;  1AKB A;  2DGK A;  1B5P A;  3FDB A;  4U2H A;  1WYT A;  2YCT A;  1LW4 A;  3VK4 A;  4OCA A;  3N4S A;  1D7U A;  2D64 A;  4LW4 A;  1ARG A;  2CH1 A;  1TAT A;  1ASD A;  3HLM A;  3N7N A;  2Z20 A;  4K2M A;  1MLY A;  5D5S A;  1P3W A;  2WK7 A;  4WXB A;  3A9Z A;  2AEV A;  1AMR A;  4B98 A;  3L8A A;  2X8U A;  1OHV A;  2CIN A;  1AKA A;  1YIZ A;  5E4Z A;  1ZOD A;  1QJ3 A;  2YCP A;  1VP4 A;  4KYO A;  3N4R A;  2ZJG A;  2YRI A;  7AAT A;  4WXF A;  3WGC A;  4CVQ A;  1S06 A;  4Q31 A;  4XJL A;  4Y0D A;  3MC6 C;  2OAT A;  2YRR A;  2OGE A;  2W7F A;  3QPG A;  1RVY A;  3L44 A;  2AY1 A;  2O0R A;  5D95 A;  2WB6 A;  3CQ4 A;  4AO4 A;  4GSA A;  1W7M A;  3FKD A;  1JF9 A;  5DX5 A;  4R2N A;  2AY8 A;  1DKA A;  1M7Y A;  3D6K A; 
#chains in the Genus database with same CATH homology
 1AMA A;  2O1B A;  4XK1 A;  3QN6 A;  2HUU A;  3NU8 A;  5HXX A;  1GC4 A;  1M0N A;  4PIW A;  3CQ6 A;  3I4J A;  1W23 A;  1YIY A;  3N0L A;  5BJ3 A;  4JEY A;  1J04 A;  4OTL A;  3VP6 A;  5FT6 A;  1ASB A;  3ASB A;  3DZZ A;  3AEP A;  1Y4I A;  2BYJ A;  3DR4 A;  3ELE A;  4W1X A;  1TOJ A;  4F4E A;  1AIA A;  4P7Y A;  2AY5 A;  2O7C A;  3BCB A;  2FQ6 A;  2R0T A;  1ART A;  2X5F A;  1ASF A;  1IX8 A;  5M4D A;  1M0P A;  3JTX A;  3E9K A;  3OP7 A;  3LVK A;  4HF8 A;  4ADC A;  2F8J A;  3NX3 A;  1BQA A;  3G8M A;  1IX7 A;  1TPL A;  3FRK A;  3FZ7 A;  3FZ8 A;  4AZJ A;  1CJ0 A;  3WX9 A;  3RQ1 A;  3GR9 A;  1ORD A;  2EO5 A;  3CBF A;  2QMA A;  3JWA A;  2HUF A;  1O4S A;  1BQD A;  1V2D A;  2Z9V A;  1ASN A;  1GEX A;  2YCN A;  4AO9 A;  3GJU A;  4LNM A;  3KE3 A;  4A00 A;  1AY4 A;  3MAF B;  4A6R A;  3DRD A;  3TCM A;  2DR1 A;  1QGN A;  3ECD A;  3ZZK A;  2OKJ A;  4RKC A;  4A0F A;  1SZS A;  1XI9 A;  3N75 A;  2W7D A;  1AMQ A;  2BIE A;  1KL2 A;  5M4B A;  2Z1Z A;  3DU4 A;  1I29 A;  3EUC A;  4M2J A;  4Q6R A;  5EQC A;  3ATH A;  2VIA A;  1YAA A;  1G7X A;  4ZAH A;  3FCR A;  3MKJ A;  1AX4 A;  4JE5 D;  2JJH A;  3FQ7 A;  4LNL A;  4EU1 A;  2ZY4 A;  4N0W A;  1QJ5 A;  3UWC A;  2XBN A;  4UOY A;  4ZM3 A;  2GMU A;  1X2A A;  2VMO A;  3E6G A;  4N0B A;  1DJU A;  2BIG A;  1AKC A;  2NMP A;  1ASC A;  1M32 A;  4XJP A;  1WKG A;  3W1H A;  1PMM A;  5EIG B;  3RBF A;  5EAA A;  3GBX A;  1C4K A;  3ISL A;  5F8V A;  4J5U A;  3WLX A;  4LNJ A;  1WKH A;  5M46 A;  3PDB A;  3NNK A;  2Z9W A;  3PAA A;  4CBS A;  2C0R A;  1S0A A;  5EUN A;  1LC7 A;  1V72 A;  3DR7 A;  2BHX A;  2VIB A;  1GC2 A;  2A1V A;  4GEB A;  4ZWM A;  2QSR A;  4UHO A;  2CFB A;  3NYT A;  3II0 A;  3WCO A;  2DKJ A;  5EUD A;  2ZUK A;  3FSL A;  1FG3 A;  2VI8 A;  1AHY A;  3QI6 A;  2BI5 A;  3BWN A;  3OKS A;  4GDY A;  4WB0 A;  4Q75 A;  3FFH A;  3B1C A;  3NU7 A;  4QGR A;  1JS3 A;  4AOA A;  4ATQ A;  2EH6 A;  3BV0 A;  3AEO A;  3JU7 A;  4CXR A;  4WYA A;  4KAM A;  2JJG A;  4ATP A;  4ITX A;  5TF5 A;  1ASG A;  2V0Y A;  2FN6 A;  3H7F A;  4MQQ A;  4IYO B;  1E5F A;  5FT8 A;  1IAX A;  4H51 A;  2D61 A;  4BMK A;  2FM1 A;  1BT4 A;  1DTY A;  4W91 A;  4GE7 A;  4L0O A;  4P3M A;  2VGT A;  1DFO A;  1AIC A;  2HOZ A;  4MY5 A;  2YKX A;  1JG8 A;  2BYL A;  3BC8 A;  2AY3 A;  4ZDO A;  1WYU A;  3PPL A;  1BJO A;  5G4J A;  4M2M A;  1YOO A;  4WXG A;  3K28 A;  4IXS A;  3NTJ A;  2BI9 A;  3WKS A;  1CS1 A;  3PJ0 A;  1QIS A;  3B8X A;  2EPJ A;  2VI9 A;  2G6W A;  3F6T A;  2ZY3 A;  1ARH A;  1AJS A;  4RJ0 A;  4K2B A;  4F5I A;  1MGV A;  4A0H A;  1TOG A;  4GE9 A;  2BWN A;  2C7T A;  3B1E A;  4WYF A;  3AEM A;  5J8Q A;  3RI6 A;  2HP2 A;  1ASM A;  1B9H A;  1PMO A;  2WK8 A;  3A8U X;  2D7Z A;  2BI1 A;  4JEX A;  1CL1 A;  3BS8 A;  5BJ4 A;  1AY5 A;  1WYV A;  3BWN C;  2YKY A;  2QLR A;  4ZLV A;  3UE8 A;  3H9X A;  4RIZ A;  2JGT A;  3TFU A;  1UU2 A;  2VGZ A;  4AH3 A;  3NYS A;  2ZY2 A;  1OXP A;  2VMR A;  1IJI A;  3LY1 A;  5I92 A;  2W7E A;  3ASA A;  3TAT A;  3DYD A;  3RBL A;  1IX6 A;  3MAD A;  4E77 A;  1GC3 A;  3PD6 B;  3E2Z B;  1N8P A;  2CAN A;  3CQ5 A;  3LWS A;  5DJ1 A;  2AY6 A;  2CJH A;  3NUI A;  1LKC A;  1AIB A;  3FZ6 A;  3QHX A;  3A9Y A;  2AY7 A;  4KXK A;  3T32 A;  3PA9 A;  4OMA A;  2YOB A;  1AAW A;  2EZ2 A;  2Z1Y A;  4LW2 A;  2KFP A;  2VMZ A;  2Z9U A;  2AEU A;  2ZP7 A;  3KKI A;  1WST A;  1H0C A;  4JF0 A;  3TQX A;  4BA5 A;  3QBO A;  4JE5 A;  2W7I A;  4F5M A;  5G2P A;  1AHX A;  3AEN A;  2Z9X A;  4TMR A;  4XJO A;  2YKV A;  1Z3Z A;  1QIT A;  2ZYJ A;  3BWO A;  5G2Q A;  1IBJ A;  4PVF A;  1IUG A;  2D63 A;  4XQ2 A;  1N2T A;  4UHN A;  2C44 A;  3IF2 A;  4ADD A;  1XEY A;  2W8W A;  4Y0I A;  2ZSL A;  4JEV A;  1E5E A;  3GZD A;  4F5L A;  1M0O A;  1DGE A;  2YHK A;  3FD0 A;  1MAP A;  1V2E A;  2QB3 A;  3AEM C;  1C9C A;  3LV2 A;  2QA3 A;  4WBT A;  4IX8 A;  2E7I A;  2PB2 A;  1ARS A;  3AV7 A;  1LW5 A;  3RCH B;  1G7W A;  4MQR A;  3AEJ A;  3NRA A;  3FDD A;  2W8U A;  1IAY A;  3LVM A;  3BN1 A;  4OC9 A;  4RAE A;  2R5C A;  2X5D A;  1OXO A;  1BS0 A;  2Z61 A;  2BI2 A;  1AAM A;  4LC3 A;  4IW7 A;  3G0T A;  3MBB A;  4UQV A;  1JS6 A;  4XJM A;  3MAF A;  3NUB A;  4FFC A;  2OQX A;  4RLG A;  1LC5 A;  3B1D A;  4M2K A;  4WLH A;  3I5T A;  2XH1 A;  5G4I A;  4DQ6 A;  1M4N A;  4PFF A;  2GB3 A;  2VMP A;  1MDZ A;  1SF2 A;  2D7Y A;  2JJE A;  1CL2 A;  1CZC A;  2HOX A;  3AOV A;  3FVS A;  4BHD A;  2DGM A;  2BKW A;  5LHA A;  1CQ7 A;  3LG0 A;  1KKJ A;  2V1P A;  1GCK A;  2JIS A;  3I16 A;  3P1T A;  3GET A;  2D65 A;  2E54 A;  2W7J A;  3GWP A;  4MGR A;  4ZWV A;  2G7J A;  1AMS A;  2RFV A;  4I8A A;  2CST A;  4IXO A;  8AAT A;  5G0A A;  2ZY5 A;  3F9T A;  3Q8N A;  3USF A;  1CQ8 A;  5EAV A;  4A0G A;  5F9S A;  1X28 A;  3ZRR A;  2W7K A;  1GDE A;  2VYC A;  4WYD A;  1KKP A;  2AY4 A;  3QGU A;  5EIG A;  4DBC A;  5JAY A;  2CJG A;  4H63 Q;  5G09 A;  1Z7D A;  4AZK A;  2JG2 A;  4WYC A;  1X29 A;  4HVK A;  2EYQ A;  1AHF A;  3P6K A;  1O69 A;  1BJN A;  4JEZ A;  4RIT A;  1TOI A;  4U1T A;  1WYT B;  4ZSW A;  4TV7 A;  2VLF A;  3GZD C;  3AOW A;  1DJE A;  2W7H A;  4OBU A;  3EI6 A;  4F5G A;  1LC8 A;  3WGB A;  4F5H A;  9AAT A;  1FG7 A;  3R9A A;  3E2F A;  4EMY A;  4MKK A;  1SFF A;  3ELP A;  1M0Q A;  3AEJ C;  1BJO B;  3FVX A;  3A9X A;  3N5M A;  4W8I A;  2VGS A;  1TOE A;  4J8L A;  4F5F A;  4K2I A;  5FT5 A;  2GSA A;  1OHY A;  3DC1 A;  1GEY A;  1J32 A;  3VK2 A;  2VMN A;  1UKJ A;  3EI8 A;  5K8B A;  4IYO A;  1CQ6 A;  3HVY A;  1GD9 A;  3FFR A;  4O6Z A;  5AX8 A;  2FNI A;  2HZP A;  2VLH A;  4OBV A;  3GSB A;  3KGW A;  2D5Y A;  3E2Y A;  4ADE A;  1MLZ A;  1TAS A;  2CH2 A;  3FTB A;  3K7Y A;  2OGA A;  1C7G A;  3KGX A;  4A72 A;  1T3I A;  4XAU A;  3BB8 A;  1M6S A;  4A6U A;  3HQT A;  1QZ9 A;  3R4T A;  4MKJ A;  1GC0 A;  4XEW A;  1RV3 A;  2QBT A;  5IWQ A;  2DKB A;  1RV4 A;  3BCA A;  3EZ1 A;  3K40 A;  1I41 A;  5E5I A;  4ISY A;  1SVV A;  3LVJ A;  4E3Q A;  3HL2 A;  1WYV B;  1BJW A;  4K05 A;  1N31 A;  1RVU A;  2HOY A;  2PO3 A;  2VMQ A;  2W7L A;  3ACZ A;  3WZF A;  4BA4 A;  3COG A;  1SZK A;  2VMW A;  2BI3 A;  3AEL A;  3DOD A;  2W8T A;  1YJS A;  2AY9 A;  3MEB A;  3NDN A;  1CZE A;  4NOG A;  2VGU A;  2FYF A;  3NYU A;  1G4V A;  2E7U A;  4OYT A;  2E7J A;  4WYG A;  3ZRQ A;  4F5K A;  2HUI A;  1S07 A;  1D7R A;  4JF1 A;  2OKK A;  3EI7 A;  1EQB A;  3EZS A;  1QIR A;  1ELU A;  1MAQ A;  2TPL A;  1SZU A;  2VMV A;  3DXW A;  1PG8 A;  3DXV A;  5KTB A;  4W1V A;  4WD2 A;  2D66 A;  2HP1 A;  1FC4 A;  3VK3 A;  4OT8 A;  2GQN A;  4A0R A;  2AY2 A;  1YNU A;  1UU1 A;  3LVL B;  1O61 A;  2AAT A;  3FQA A;  4ZSY A;  2BWO A;  3AEN B;  1ASA A;  4MSO A;  4E1O A;  2VGV A;  1H1C A;  1X0M A;  2CTZ A;  2Q7W A;  4UHM A;  4WLJ A;  1B4X A;  5HDM A;  2BIA A;  1OHW A;  2FNU A;  3HT4 A;  1ZC9 A;  4Q76 A;  3EIA A;  4PFN A;  5E3K A;  3IHJ A;  2CY8 A;  4ZDL A;  3ZRP A;  2CJD A;  2R2N A;  3PD6 A;  3E2Z A;  5DJ9 A;  1ASL A;  2Z67 A;  3WKR A;  3BCX A;  3F0H A;  1AHG A;  2W8V A;  1TOK A;  3MAU A;  4A6T A;  3CAI A;  4F5J A;  2W7M A;  1B9I A;  3UAK A;  1ECX A;  3PDX A;  4R5Z A;  4DGT A;  3TFT A;  1B8G A;  1TAR A;  4R8D A;  4CBR A;  1BKG A;  3JZL A;  2R5C B;  2VMX A;  3HBX A;  3EIB A;  3RUY A;  3W1I A;  4CXQ A;  1VEF A;  2VMS A;  5EUE A;  1AY8 A;  1KMJ A;  2ORD A;  3ZZJ A;  3VAX A;  4IY7 A;  4Y0H A;  4RJY A;  4GE4 A;  2EGY A;  2JJF A;  3WCN A;  4ZM4 A;  5EFS A;  4RKD A;  3M5U A;  3PIU A;  2W8J A;  2VMT A;  3EI5 A;  5LH9 A;  1AJR A;  1LS3 A;  2PB0 A;  3N4X A;  3PDB B;  5FT4 A;  3QM2 A;  1PFF A;  5DB5 A;  3A2B A;  4MQP A;  1GEW A;  3HMU A;  4RM1 A;  1B5O A;  5HHY A;  1W7N A;  2ZSM A;  4ZAS A;  2EZ1 A;  1S08 A;  2FKI A;  1YJZ A;  3RCH A;  1SPA A;  1AHE A;  3B46 A;  1W3U A;  1D2F A;  2W7G A;  1D7V A;  1OAT A;  4EFF A;  2CB1 A;  4W1W A;  1G4X A;  5C6U A;  1DJ9 A;  2YKU A;  3FQ8 A;  4WB0 B;  3JW9 A;  1KMK A;  1MDO A;  2VMY A;  2X3L A;  1VJO A;  2ZC0 A;  3GZC A;  4ZDP A;  1LK9 A;  2WKA A;  3MC6 A;  4TN4 A;  4B9B A;  2QB2 A;  3FVU A;  1D7S A;  3E77 A;  1EG5 A;  1IVR A;  4W5K A;  3W1J A;  5M49 A;  2VGW A;  4GRX A;  2HOR A;  4WYE A;  1BW0 A;  3H14 A;  4EB7 A;  1MDX A;  1UU0 A;  1ASE A;  3AAT A;  1I48 A;  2C81 A;  4WP0 A;  4JEW A;  1BJ4 A;  1ELQ A;  4ADB A;  1ZOB A;  2DGL A;  3JWB A;  1C7N A;  3WY7 A;  1ARI A;  1O62 A;  4BQ0 A;  1C7O A;  4FL0 A;  4ITG A;  4EB5 A;  1WYU B;  2VMU A;  4E3R A;  1I43 A;  1S09 A;  3PGY A;  1KL1 A;  2GMS A;  4R5F A;  1EJI A;  1DGD A;  1W7L A;  2BWP A;  3EI9 A;  3G7Q A;  1U08 A;  1C0N A;  2R5E A;  1YJY A;  2WK9 A;  1V2F A;  3HDO A;  4IXZ A;  1AJS B;  3VOM A;  1GBN A;  2DOU A;  1AKB A;  2DGK A;  1B5P A;  3FDB A;  4U2H A;  1WYT A;  2YCT A;  1LW4 A;  3VK4 A;  4OCA A;  3N4S A;  1D7U A;  2D64 A;  4LW4 A;  1ARG A;  2CH1 A;  1TAT A;  1ASD A;  3HLM A;  3N7N A;  2Z20 A;  4K2M A;  1MLY A;  5D5S A;  1P3W A;  2WK7 A;  4WXB A;  3A9Z A;  2AEV A;  1AMR A;  4B98 A;  3L8A A;  2X8U A;  1OHV A;  2CIN A;  1AKA A;  1YIZ A;  5E4Z A;  1ZOD A;  1QJ3 A;  2YCP A;  1VP4 A;  4KYO A;  3N4R A;  2ZJG A;  2YRI A;  7AAT A;  4WXF A;  3WGC A;  4CVQ A;  1S06 A;  4Q31 A;  4XJL A;  4Y0D A;  3MC6 C;  2OAT A;  2YRR A;  2OGE A;  2W7F A;  3QPG A;  1RVY A;  3L44 A;  2AY1 A;  2O0R A;  5D95 A;  2WB6 A;  3CQ4 A;  4AO4 A;  4GSA A;  1W7M A;  3FKD A;  1JF9 A;  5DX5 A;  4R2N A;  2AY8 A;  1DKA A;  1M7Y A;  3D6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...