1AJRA

Refinement and comparison of the crystal structures of pig cytosolic aspartate aminotransferase and its complex with 2-methylaspartate
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
412
structure length
411
Chain Sequence
APPSVFAEVPQAQPVLVFKLIADFREDPDPRKVNLGVGAYRTDDCQPWVLPVVRKVEQRIANNSSLNHEYLPILGLAEFRTCASRLALGDDSPALQEKRVGGVQSLGGTGALRIGAEFLARWYNGTNNKDTPVYVSSPTWENHNGVFTTAGFKDIRSYRYWDTEKRGLDLQGFLSDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGNLEKDAWAIRYFVSEGFELFCAQSFSNFGLYNERVGNLTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLINQKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refinement and comparisons of the crystal structures of pig cytosolic aspartate aminotransferase and its complex with 2-methylaspartate.
pubmed doi rcsb
molecule tags Aminotransferase
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 143
structure length 411
sequence length 412
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1997-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1ajrA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1ajrA01
2YKYA 2JJEA 4EU1A 3BC8A 4RIZA 4M2JA 1UU2A 2W8UA 1V72A 4GRXA 1O62A 1KKJA 1WYVA 1WKHA 4XK1A 1M0PA 4TV7A 4GE7A 2ZYJA 3AATA 2W7LA 4WD2A 1ELUA 1JG8A 1OHVA 5E4ZA 3BWOA 3TFTA 4UHNA 2BI9A 2EO5A 3NYUA 3NRAA 1VP4A 2QB2A 1TOIA 3LVJA 4W91A 4BMKA 4F5MA 3RI6A 4E3RA 2OQXA 4E77A 2ZY3A 3TATA 3FDBA 4WYCA 3COGA 1SPAA 2WK7A 3FD0A 4UOYA 1C9CA 4ZAHA 4WXFA 1M6SA 1ZOBA 5J8QA 2QLRA 3LG0A 3EI9A 1DJEA 3PD6A 4F5GA 1KL1A 4OMAA 4A0RA 5E5IA 3TCMA 1ARHA 1CS1A 3GSBA 4IXOA 1B5OA 4AH3A 5M46A 1BJOA 1KKPA 5K8BA 2C7TA 1I29A 3FZ6A 2VMZA 3GR9A 4IX8A 5BJ4A 4R5ZA 2E7JA 2D65A 2VMXA 1ASLA 1JS6A 1Y4IA 4ZWVA 1YJZA 3I4JA 1JS3A 3WZFA 4OCAA 3F0HA 4PVFA 4ZDPA 1H0CA 1SZSA 4P7YA 4XJOA 4EB5A 5M4BA 1GCKA 1C4KA 1MGVA 3GZCA 3MC6C 2DGKA 2WK8A 2ZJGA 1WSTA 1AAMA 1AMRA 3AOVA 1BS0A 3HBXA 1VJOA 1S08A 1ARTA 5G0AA 5JAYA 3WKRA 1CL1A 2YRRA 3DR4A 1QZ9A 3WCOA 4E3QA 4TN4A 2GSAA 1OHWA 1V2EA 4OTLA 2VMVA 1TOEA 4BQ0A 1X0MA 3TQXA 1LS3A 2O1BA 3UE8A 2QB3A 3GZDA 1WYTA 1E5FA 3CQ4A 4WYDA 2FQ6A 1BQAA 2Z9VA 1S0AA 2BYJA 2QA3A 2VMYA 5FT8A 2XBNA 2D64A 4R8DA 3ZRQA 1WKGA 3GETA 4EB7A 3WGCA 2EZ1A 3PDXA 4JE5D 3E2FA 1P3WA 1XEYA 2HZPA 4E1OA 4WBTA 3DU4A 1SFFA 3AEJA 3HT4A 3JW9A 3QPGA 3RCHA 4ADDA 3PAAA 2ZSMA 1AHEA 3JWBA 3WKSA 1GBNA 3F9TA 3FVXA 2Z1ZA 4Q75A 3ZZKA 1AY8A 1X28A 4U2HA 1AIBA 1B5PA 4IYOB 5G09A 2ZY4A 2O7CA 3QHXA 1IVRA 1AHYA 1CZCA 3L8AA 4A0FA 4XJPA 2X5FA 1W3UA 2OKKA 2R2NA 4W1WA 4DGTA 4DQ6A 3VP6A 1V2DA 1SZKA 2O0RA 2AY4A 1JF9A 3N5MA 2AY2A 1LK9A 3FFHA 2YKUA 5EIGA 4ADCA 2D5YA 3HVYA 2CH2A 1BJOB 2W8WA 2FNUA 3A8UX 1VEFA 2W7FA 3BN1A 3KGXA 1AX4A 4A0HA 4J5UA 3DC1A 4P3MA 4AO4A 1LKCA 2YOBA 5M49A 1O61A 1ARGA 4R2NA 4WLHA 1BW0A 5HDMA 5HHYA 1DGDA 1EQBA 1QJ5A 4BA4A 2VMRA 1RVUA 1MLYA 1V2FA 1DJUA 3EIAA 3KE3A 4ATQA 1B8GA 1X29A 2X5DA 2VGVA 2BWNA 4LW4A 1M0OA 3CQ5A 3FZ8A 3P1TA 1BJWA 3FVUA 4MQQA 2W8JA 4ZSWA 5G2PA 4ITXA 2OKJA 3BCBA 1ASCA 1QIRA 1TATA 3EZSA 2VMWA 4F5IA 3AOWA 2BIEA 3LV2A 3NYTA 4JF1A 4W1VA 4QGRA 5G2QA 4A6UA 1CQ7A 1M4NA 4EFFA 3MAFB 1AIAA 3HDOA 3E77A 4WXGA 3FFRA 4ZLVA 5EUEA 3EI6A 4XAUA 2ZP7A 3B46A 2GMSA 4JF0A 3IHJA 1BJ4A 4XQ2A 4K2MA 2ZY2A 4GDYA 4OBUA 3JTXA 1W23A 2VMSA 3LVKA 3N0LA 1Z7DA 3PDBB 2OGAA 4MSOA 4RLGA 2AY3A 3TFUA 5HXXA 2VMPA 4IXSA 5LHAA 2HOYA 1RV3A 4B9BA 3K7YA 2W7EA 1ASMA 1DTYA 3FRKA 2HOZA 4LC3A 3RCHB 3VK3A 1C7GA 3DRDA 2YHKA 4ITGA 3G0TA 5M4DA 4ADEA 2BI2A 3AENA 1YOOA 5DJ1A 3R4TA 1LW4A 2OATA 4ZDOA 4EMYA 1CQ6A 3QGUA 1IJIA 1PFFA 2CJGA 2HUIA 2R5EA 3VK2A 4K2IA 3VK4A 4MKJA 1LC7A 1D7UA 3NTJA 3USFA 4XJMA 2W7MA 1GD9A 3ACZA 1GC4A 2V0YA 1ARSA 4Q31A 4GE9A 4LNMA 4JE5A 4WYGA 2E54A 1O4SA 1ARIA 1BT4A 1EJIA 4CBSA 2BYLA 2VLFA 5FT4A 3IF2A 1W7NA 3FSLA 3WY7A 4OC9A 1TOKA 4LNLA 1QGNA 3LVMA 1FC4A 4A6RA 4JEWA 1CJ0A 4RKDA 2WK9A 1GEXA 1IBJA 3VOMA 1KMKA 2ZSLA 1LW5A 4GE4A 2HOXA 3FCRA 4RJ0A 2BIAA 1AMSA 3PA9A 3DZZA 1RVYA 1E5EA 1AJSA 1UU1A 2FN6A 1IUGA 2JGTA 2Z67A 3B1CA 2AATA 3AEMA 3MAUA 1AY5A 3P6KA 3CBFA 3GZDC 5EIGB 3HLMA 1MDZA 5E3KA 3FDDA 3FTBA 4LNJA 4JEZA 3BV0A 1D7SA 1X2AA 2DGLA 2D63A 3MEBA 2E7IA 3II0A 2XH1A 2VMOA 1AHFA 3DYDA 4XJLA 4UHMA 3BS8A 4O6ZA 1LC5A 4PFFA 3AENB 3AEJC 1GDEA 1M7YA 3EI8A 1W7MA 1DGEA 4W1XA 3G7QA 2Z9UA 1YIYA 2ZY5A 3PJ0A 3I16A 2BWOA 4Y0IA 1S09A 1M0QA 3KGWA 1BJNA 3E9KA 4AOAA 3AEOA 4WP0A 2HUUA 2JG2A 3HL2A 1AHGA 2CJDA 2EZ2A 2QMAA 3ELEA 1C7OA 1B4XA 3RBLA 3K40A 4PFNA 1KMJA 1AJSB 2AY7A 4OT8A 5DB5A 1GC2A 4F5LA 1I43A 2AY6A 3ATHA 4MQRA 4H51A 5G4IA 1PMMA 3A9ZA 3M5UA 4ZWMA 1SF2A 1TOGA 4F5FA 2OGEA 1SVVA 5FT6A 2BIGA 4R5FA 4JEVA 1YNUA 2JJHA 2CFBA 4N0WA 2ZUKA 4HF8A 4CVQA 4M2KA 3LY1A 3DXVA 3LVLB 1TARA 4IY7A 3N75A 5EAAA 2ORDA 4JEYA 1AICA 3UAKA 2RFVA 2GQNA 3AV7A 4IXZA 1ASFA 4HVKA 4A0GA 1WYTB 3AELA 4BA5A 4IYOA 4WB0A 2Z9XA 3FQ8A 1SZUA 1QISA 3B1EA 3WGBA 1PMOA 1M32A 1QITA 2BI5A 3H7FA 1CL2A 4ZSYA 2D7YA 4KYOA 2G6WA 2FM1A 3BCXA 1ASEA 2R5CA 4UHOA 3FVSA 5LH9A 3NU8A 1UKJA 3VAXA 1ASDA 1S07A 3BCAA 3H14A 1IAXA 2YKVA 1TOJA 4UQVA 4AZJA 3EUCA 4RITA 3NUBA 3OKSA 2GMUA 3A2BA 3A9YA 2Z20A 3KKIA 4ZDLA 3E2ZB 3GJUA 2W7KA 3E2ZA 3ZZJA 3DR7A 3MBBA 2VGTA 3PGYA 4WLJA 4ADBA 3G8MA 4ISYA 1YJYA 4FFCA 4KAMA 2VGSA 2CANA 3CQ6A 2C0RA 3D6KA 2DR1A 4A72A 1GC3A 1PG8A 2W7GA 3W1IA 4OYTA 3EI7A 2TPLA 4Q76A 3ASAA 1AHXA 3MAFA 1GEWA 3FZ7A 3NU7A 4WB0B 4F4EA 4I8AA 4NOGA 1IX7A 4RAEA 1B9IA 1AMAA 4JEXA 1ASNA 1WYVB 2W7IA 5DJ9A 3F6TA 1DFOA 3W1JA 2V1PA 1AJRA 2VLHA 4F5HA 9AATA 1KL2A 2X8UA 3E6GA 4A00A 1I41A 4W8IA 4Y0DA 4DBCA 3ZRPA 4BHDA 5TF5A 1YIZA 2WKAA 3LWSA 3Q8NA 1OATA 1J32A 1AKAA 1ASAA 3MKJA 3QI6A 2W7JA 1DJ9A 1UU0A 1AY4A 1D2FA 4IW7A 2AEVA 2DOUA 3JZLA 3NDNA 1D7VA 2PB0A 4KXKA 2HORA 4GSAA 3R9AA 5I92A 1AMQA 1CZEA 3EIBA 3K28A 3PD6B 3CAIA 5DX5A 2VMUA 4Y0HA 3PIUA 5FT5A 5C6UA 4LW2A 4MQPA 5AX8A 4WYAA 2C44A 1WYUA 2EPJA 1N2TA 1EG5A 1GEYA 3BB8A 3MC6A 1MLZA 1ZC9A 2VMTA 1G4VA 1AKBA 2VIAA 1LC8A 1TASA 1ECXA 2CJHA 2DKJA 2FNIA 3BWNA 3GBXA 2VMQA 1T3IA 4GEBA 5IWQA 3UWCA 1CQ8A 1G7WA 3AEMC 1N8PA 3FQAA 4ZM3A 2Z9WA 2W7DA 4WYFA 3NUIA 1ORDA 4XEWA 2DGMA 8AATA 2AEUA 1FG7A 2VGUA 3T32A 2VGZA 1FG3A 1ZODA 2C81A 3NX3A 4AZKA 1QJ3A 2AY5A 3L44A 3GWPA 2AY8A 3A9XA 1AKCA 2QBTA 1MAPA 4RKCA 1H1CA 1YJSA 3QBOA 1I48A 4ATPA 3PPLA 4N0BA 3EI5A 4U1TA 3FKDA 4A6TA 2EGYA 2BI1A 1IX6A 2PO3A 2W7HA 4F5JA 1C0NA 3RBFA 3HQTA 2YCTA 1W7LA 3ELPA 3RQ1A 3FQ7A 2CINA 2YCNA 2F8JA 5EUNA 5EFSA 1BQDA 4CBRA 4FL0A 2CH1A 2AY9A 2VI8A 2W8VA 4CXQA 4CXRA 2BHXA 2R5CB 1AAWA 2YCPA 3JWAA 3W1HA 4F5KA 1M0NA 3HMUA 3MADA 1RV4A 3ASBA 2BKWA 2VMNA 4MY5A 2FYFA 2YRIA 2VI9A 1D7RA 2EH6A 4AO9A 4MGRA 4WXBA 4OBVA 1S06A 2W8TA 1TPLA 1DKAA 2Z61A 2HUFA 1J04A 4J8LA 2DKBA 1N31A 2AY1A 2CTZA 1U08A 2CB1A 4M2MA 3PDBA 1O69A 4MKKA 2BI3A 1MAQA 5BJ3A 3DXWA 2GB3A 5D95A 1G7XA 1Z3ZA 4L0OA 3ZRRA 3B1DA 4TMRA 5EQCA 2VYCA 1C7NA 2D66A 2JJFA 4W5KA 2D7ZA 2HP1A 3OP7A 2YKXA 5F9SA 3AEPA 3ECDA 1OXOA 5F8VA 1XI9A 2D61A 3I5TA 3NNKA 2X3LA 2ZC0A 2VIBA 3DODA 1G4XA 3QM2A 3NYSA 1ASGA 2PB2A 2R0TA 4RM1A 3RUYA 3EZ1A 1IAYA 3WCNA 2CSTA 4PIWA 1OHYA 2HP2A 4ZM4A 2JISA 1IX8A 1GC0A 3E2YA 2Z1YA 2VGWA 4K2BA 5EAVA 5G4JA 2CY8A 1OXPA 5EUDA 5D5SA 3B8XA 4WYEA 1MDXA 3ISLA 3BWNC 3WX9A 3JU7A 7AATA 1YAAA 4B98A 1MDOA 1ASBA 1ELQA 2Q7WA 4ZASA 2BWPA 1BKGA 2JJGA 2NMPA 2E7UA 3WLXA 1B9HA 4RJYA 4Q6RA 3QN6A 1WYUB
chains in the Genus database with same CATH superfamily
2YKYA 2JJEA 4EU1A 3BC8A 4RIZA 4M2JA 1UU2A 2W8UA 1V72A 4GRXA 1O62A 1KKJA 1WYVA 1WKHA 4XK1A 1M0PA 4TV7A 4GE7A 2ZYJA 3AATA 2W7LA 4WD2A 1ELUA 1JG8A 1OHVA 5E4ZA 3BWOA 3TFTA 4UHNA 2BI9A 2EO5A 3NYUA 3NRAA 1VP4A 2QB2A 1TOIA 3LVJA 4W91A 4BMKA 4F5MA 3RI6A 4E3RA 2OQXA 4E77A 2ZY3A 3TATA 3FDBA 4WYCA 3COGA 2WB6A 1SPAA 2WK7A 3FD0A 4UOYA 1C9CA 4ZAHA 4WXFA 1M6SA 1ZOBA 5J8QA 2QLRA 3LG0A 3EI9A 1DJEA 3PD6A 4F5GA 1KL1A 4OMAA 4A0RA 5E5IA 3TCMA 1ARHA 1CS1A 3GSBA 4IXOA 1B5OA 4AH3A 5M46A 1BJOA 1KKPA 5K8BA 2C7TA 1I29A 3FZ6A 2VMZA 3GR9A 4IX8A 5BJ4A 4R5ZA 2E7JA 2D65A 2VMXA 1ASLA 1JS6A 1Y4IA 4ZWVA 1YJZA 3I4JA 1JS3A 3WZFA 4OCAA 3F0HA 4PVFA 4ZDPA 1H0CA 1SZSA 4P7YA 4XJOA 4EB5A 5M4BA 1GCKA 1C4KA 1MGVA 3GZCA 3MC6C 2DGKA 2WK8A 2ZJGA 1WSTA 1AAMA 1AMRA 3AOVA 2KFPA 3N4SA 1BS0A 3HBXA 1VJOA 1S08A 1ARTA 5G0AA 5JAYA 3WKRA 1CL1A 2YRRA 3DR4A 1QZ9A 3WCOA 4E3QA 4TN4A 2GSAA 1OHWA 1V2EA 4OTLA 2VMVA 1TOEA 4BQ0A 1X0MA 3TQXA 1LS3A 2O1BA 3UE8A 2QB3A 3GZDA 3N4RA 1WYTA 1E5FA 3CQ4A 4WYDA 2FQ6A 1BQAA 2Z9VA 1S0AA 2BYJA 2QA3A 2VMYA 5FT8A 2XBNA 2D64A 4R8DA 3ZRQA 1WKGA 3GETA 4EB7A 3WGCA 2EZ1A 3PDXA 4JE5D 3E2FA 1P3WA 1XEYA 2HZPA 4E1OA 4WBTA 3DU4A 1SFFA 3AEJA 3HT4A 3JW9A 3QPGA 3RCHA 4ADDA 3PAAA 2ZSMA 1AHEA 3JWBA 3WKSA 1GBNA 3F9TA 3FVXA 2Z1ZA 4Q75A 3ZZKA 1AY8A 1X28A 4U2HA 1AIBA 1B5PA 4IYOB 5G09A 2ZY4A 2O7CA 3QHXA 1IVRA 1AHYA 1CZCA 3L8AA 4A0FA 4XJPA 2X5FA 1W3UA 2OKKA 2R2NA 4W1WA 4DGTA 4DQ6A 3VP6A 1V2DA 1SZKA 2O0RA 2AY4A 1JF9A 3N5MA 2AY2A 1LK9A 3FFHA 2YKUA 5EIGA 4ADCA 2D5YA 3HVYA 2CH2A 1BJOB 2W8WA 2FNUA 3A8UX 1KAFA 1VEFA 2W7FA 3BN1A 3KGXA 1AX4A 4A0HA 4J5UA 3DC1A 4P3MA 4AO4A 1LKCA 2YOBA 5M49A 1O61A 1ARGA 4R2NA 4WLHA 1BW0A 5HDMA 5HHYA 1DGDA 1EQBA 1QJ5A 4BA4A 2VMRA 1RVUA 1MLYA 1V2FA 1DJUA 3EIAA 3KE3A 4ATQA 1B8GA 1X29A 2X5DA 2VGVA 2BWNA 4LW4A 1M0OA 3CQ5A 3FZ8A 3P1TA 1BJWA 3FVUA 4MQQA 2W8JA 4ZSWA 5G2PA 4ITXA 2OKJA 3BCBA 1ASCA 1QIRA 1TATA 3EZSA 2VMWA 4F5IA 3AOWA 2BIEA 3LV2A 3NYTA 4JF1A 4W1VA 4QGRA 5G2QA 4A6UA 1CQ7A 1M4NA 4EFFA 3MAFB 1AIAA 3HDOA 3E77A 4WXGA 3FFRA 4ZLVA 5EUEA 3EI6A 4XAUA 2ZP7A 3B46A 2GMSA 4JF0A 3IHJA 1BJ4A 4XQ2A 4K2MA 2ZY2A 4GDYA 4OBUA 3JTXA 1W23A 2VMSA 3LVKA 3N0LA 1Z7DA 3PDBB 2OGAA 4MSOA 4RLGA 2AY3A 3TFUA 5HXXA 2VMPA 4IXSA 5LHAA 2HOYA 1RV3A 4B9BA 3K7YA 2W7EA 1ASMA 1DTYA 3FRKA 2HOZA 4LC3A 3RCHB 3VK3A 1C7GA 3DRDA 2YHKA 4ITGA 3G0TA 5M4DA 4ADEA 2BI2A 3AENA 1YOOA 5DJ1A 3R4TA 1LW4A 2OATA 4ZDOA 4EMYA 1CQ6A 3QGUA 1IJIA 1PFFA 2CJGA 2HUIA 2R5EA 3VK2A 4K2IA 3VK4A 4MKJA 1LC7A 1D7UA 3NTJA 3USFA 4XJMA 2W7MA 1GD9A 3ACZA 1GC4A 2V0YA 1ARSA 4Q31A 4GE9A 4LNMA 4JE5A 3N4XA 4WYGA 2E54A 1O4SA 1ARIA 1BT4A 1EJIA 4CBSA 2BYLA 2VLFA 5FT4A 3IF2A 1W7NA 3FSLA 3WY7A 4OC9A 1TOKA 4K05A 4LNLA 1QGNA 3LVMA 1FC4A 4A6RA 4JEWA 3N7NA 1CJ0A 4RKDA 2WK9A 1GEXA 1IBJA 3VOMA 1KMKA 2ZSLA 1LW5A 4GE4A 2HOXA 3FCRA 4RJ0A 2BIAA 1AMSA 3PA9A 3DZZA 1RVYA 1E5EA 1AJSA 1UU1A 2FN6A 1IUGA 2JGTA 2Z67A 3B1CA 2AATA 3AEMA 3MAUA 1AY5A 3P6KA 3CBFA 3GZDC 5EIGB 3HLMA 1MDZA 5E3KA 3FDDA 3FTBA 4LNJA 4JEZA 3BV0A 1D7SA 1X2AA 2DGLA 2D63A 3MEBA 2E7IA 3II0A 2XH1A 2VMOA 1AHFA 3DYDA 4XJLA 2EYQA 4UHMA 3BS8A 4O6ZA 1LC5A 4PFFA 3AENB 3AEJC 1GDEA 1M7YA 3EI8A 1W7MA 1DGEA 4W1XA 3G7QA 2Z9UA 1YIYA 2ZY5A 3PJ0A 3I16A 2BWOA 4Y0IA 1S09A 1M0QA 3KGWA 1BJNA 3E9KA 4AOAA 3AEOA 4WP0A 2HUUA 2JG2A 3HL2A 1AHGA 2CJDA 2EZ2A 2QMAA 3ELEA 1C7OA 1B4XA 3RBLA 3K40A 4PFNA 1KMJA 1AJSB 2AY7A 4OT8A 5DB5A 1GC2A 4F5LA 1I43A 2AY6A 3ATHA 4MQRA 2QSRA 4H51A 5G4IA 1PMMA 3A9ZA 3M5UA 4ZWMA 1SF2A 1TOGA 4F5FA 2OGEA 1SVVA 5FT6A 2BIGA 4R5FA 4JEVA 1YNUA 2JJHA 2CFBA 4N0WA 2ZUKA 4HF8A 4CVQA 4M2KA 3LY1A 3DXVA 3LVLB 1TARA 4IY7A 3N75A 5EAAA 2ORDA 4JEYA 1AICA 3UAKA 2RFVA 2GQNA 3AV7A 4IXZA 1ASFA 4HVKA 4A0GA 1WYTB 3AELA 4BA5A 4IYOA 4WB0A 2Z9XA 3FQ8A 1SZUA 1QISA 3B1EA 3WGBA 1PMOA 1M32A 1QITA 2BI5A 3H7FA 1CL2A 4ZSYA 2D7YA 4KYOA 2FKIA 2G6WA 2FM1A 3BCXA 1ASEA 2R5CA 4UHOA 3FVSA 5LH9A 3NU8A 1UKJA 3VAXA 1ASDA 1S07A 3BCAA 3H14A 1IAXA 2YKVA 1TOJA 4UQVA 4AZJA 3EUCA 4RITA 3NUBA 3OKSA 2GMUA 3A2BA 3A9YA 2Z20A 3KKIA 4ZDLA 3E2ZB 3GJUA 2W7KA 3E2ZA 3ZZJA 3DR7A 3MBBA 2VGTA 3PGYA 4WLJA 4ADBA 3G8MA 4ISYA 1YJYA 4FFCA 4KAMA 2VGSA 2CANA 3CQ6A 2C0RA 3D6KA 2DR1A 4A72A 1GC3A 1PG8A 2W7GA 3W1IA 4OYTA 3H9XA 3EI7A 2TPLA 4Q76A 3ASAA 1AHXA 3MAFA 1GEWA 3FZ7A 3NU7A 4WB0B 4F4EA 4I8AA 4NOGA 1IX7A 4RAEA 1B9IA 1AMAA 4JEXA 1ASNA 1WYVB 2W7IA 5DJ9A 3F6TA 1DFOA 3W1JA 2V1PA 1AJRA 2VLHA 4F5HA 9AATA 1KL2A 2X8UA 3E6GA 4A00A 1I41A 4W8IA 4Y0DA 4DBCA 3ZRPA 4BHDA 5TF5A 1YIZA 2WKAA 3LWSA 3Q8NA 1OATA 1J32A 1AKAA 1ASAA 3MKJA 3QI6A 2W7JA 1DJ9A 1UU0A 1AY4A 1D2FA 4IW7A 2AEVA 2DOUA 2G7JA 3JZLA 3NDNA 1D7VA 2PB0A 4KXKA 2HORA 4GSAA 3R9AA 5I92A 1AMQA 1CZEA 3EIBA 3K28A 3PD6B 3CAIA 5DX5A 2VMUA 4Y0HA 3PIUA 5FT5A 5C6UA 4LW2A 4MQPA 5AX8A 4WYAA 2C44A 1WYUA 2EPJA 1N2TA 1EG5A 1GEYA 3BB8A 3MC6A 1MLZA 1ZC9A 2VMTA 1G4VA 2A1VA 1AKBA 2VIAA 1LC8A 1TASA 1ECXA 2CJHA 2DKJA 2FNIA 3BWNA 3GBXA 2VMQA 1T3IA 4GEBA 5IWQA 3UWCA 1CQ8A 1G7WA 3AEMC 1N8PA 3FQAA 4ZM3A 2Z9WA 2W7DA 4WYFA 3NUIA 1ORDA 4XEWA 2DGMA 8AATA 2AEUA 1FG7A 2VGUA 3T32A 2VGZA 1FG3A 1ZODA 2C81A 3NX3A 4AZKA 1QJ3A 2AY5A 3L44A 3GWPA 2AY8A 3A9XA 1AKCA 2QBTA 1MAPA 4RKCA 1H1CA 1YJSA 3QBOA 1I48A 4ATPA 3PPLA 4N0BA 3EI5A 4U1TA 3FKDA 4A6TA 2EGYA 2BI1A 1IX6A 2PO3A 2W7HA 4F5JA 1C0NA 3RBFA 3HQTA 2YCTA 1W7LA 3ELPA 3RQ1A 3FQ7A 2CINA 2YCNA 2F8JA 5EUNA 5EFSA 1BQDA 4CBRA 4FL0A 2CH1A 2AY9A 2VI8A 2W8VA 4CXQA 4H63Q 4CXRA 2BHXA 2R5CB 1AAWA 2YCPA 3JWAA 3W1HA 4F5KA 1M0NA 3HMUA 3MADA 1RV4A 3ASBA 2BKWA 2VMNA 4MY5A 2FYFA 2YRIA 2VI9A 1D7RA 2EH6A 4AO9A 4MGRA 4WXBA 4OBVA 1S06A 2W8TA 1TPLA 1DKAA 2Z61A 2HUFA 1J04A 4J8LA 2DKBA 1N31A 2AY1A 2CTZA 1U08A 2CB1A 4M2MA 3PDBA 1O69A 4MKKA 2BI3A 1MAQA 5BJ3A 3DXWA 2GB3A 5D95A 1G7XA 1Z3ZA 4L0OA 3ZRRA 3B1DA 4TMRA 5EQCA 2VYCA 1C7NA 2D66A 2JJFA 4W5KA 2D7ZA 2HP1A 3OP7A 2YKXA 5F9SA 3AEPA 3ECDA 1OXOA 5F8VA 1XI9A 5KTBA 2D61A 3I5TA 3NNKA 2X3LA 2ZC0A 2VIBA 3DODA 1G4XA 3QM2A 3NYSA 1ASGA 2PB2A 2R0TA 4RM1A 3RUYA 3EZ1A 1IAYA 3WCNA 2CSTA 4PIWA 1OHYA 2HP2A 4ZM4A 2JISA 1IX8A 1GC0A 3E2YA 2Z1YA 2VGWA 4K2BA 5EAVA 5G4JA 2CY8A 1OXPA 5EUDA 5D5SA 3B8XA 4WYEA 1MDXA 3ISLA 3BWNC 3WX9A 3JU7A 7AATA 1YAAA 4B98A 1MDOA 1ASBA 1ELQA 2Q7WA 4ZASA 2BWPA 1BKGA 2JJGA 2NMPA 2E7UA 3WLXA 1B9HA 4RJYA 4Q6RA 3QN6A 1WYUB
chains in the Genus database with same CATH topology
2YKYA 2JJEA 4EU1A 3BC8A 4RIZA 4M2JA 1UU2A 2W8UA 1V72A 4GRXA 1O62A 1KKJA 1WYVA 1WKHA 4XK1A 1M0PA 4TV7A 4GE7A 2ZYJA 3AATA 2W7LA 4WD2A 1ELUA 1JG8A 1OHVA 5E4ZA 3BWOA 3TFTA 4UHNA 2BI9A 2EO5A 3NYUA 3NRAA 1VP4A 2QB2A 1TOIA 3LVJA 4W91A 4BMKA 4F5MA 3RI6A 4E3RA 2OQXA 4E77A 2ZY3A 3TATA 3FDBA 4WYCA 3COGA 2WB6A 1SPAA 2WK7A 3FD0A 4UOYA 1C9CA 4ZAHA 4WXFA 1M6SA 1ZOBA 5J8QA 2QLRA 3LG0A 3EI9A 1DJEA 3PD6A 4F5GA 1KL1A 4OMAA 4A0RA 5E5IA 3TCMA 1ARHA 1CS1A 3GSBA 4IXOA 1B5OA 4AH3A 5M46A 1BJOA 1KKPA 5K8BA 2C7TA 1I29A 3FZ6A 2VMZA 3GR9A 4IX8A 5BJ4A 4R5ZA 2E7JA 2D65A 2VMXA 1ASLA 1JS6A 1Y4IA 4ZWVA 1YJZA 3I4JA 1JS3A 3WZFA 4OCAA 3F0HA 4PVFA 4ZDPA 1H0CA 1SZSA 4P7YA 4XJOA 4EB5A 5M4BA 1GCKA 1C4KA 1MGVA 3GZCA 3MC6C 2DGKA 2WK8A 2ZJGA 1WSTA 1AAMA 1AMRA 3AOVA 2KFPA 3N4SA 1BS0A 3HBXA 1VJOA 1S08A 1ARTA 5G0AA 5JAYA 3WKRA 1CL1A 2YRRA 3DR4A 1QZ9A 3WCOA 4E3QA 4TN4A 2GSAA 1OHWA 1V2EA 4OTLA 2VMVA 1TOEA 4BQ0A 1X0MA 3TQXA 1LS3A 2O1BA 3UE8A 2QB3A 3GZDA 3N4RA 1WYTA 1E5FA 3CQ4A 4WYDA 2FQ6A 1BQAA 2Z9VA 1S0AA 2BYJA 2QA3A 2VMYA 5FT8A 2XBNA 2D64A 4R8DA 3ZRQA 1WKGA 3GETA 4EB7A 3WGCA 2EZ1A 3PDXA 4JE5D 3E2FA 1P3WA 1XEYA 2HZPA 4E1OA 4WBTA 3DU4A 1SFFA 3AEJA 3HT4A 3JW9A 3QPGA 3RCHA 4ADDA 3PAAA 2ZSMA 1AHEA 3JWBA 3WKSA 1GBNA 3F9TA 3FVXA 2Z1ZA 4Q75A 3ZZKA 1AY8A 1X28A 4U2HA 1AIBA 1B5PA 4IYOB 5G09A 2ZY4A 2O7CA 3QHXA 1IVRA 1AHYA 1CZCA 3L8AA 4A0FA 4XJPA 2X5FA 1W3UA 2OKKA 2R2NA 4W1WA 4DGTA 4DQ6A 3VP6A 1V2DA 1SZKA 2O0RA 2AY4A 1JF9A 3N5MA 2AY2A 1LK9A 3FFHA 2YKUA 5EIGA 4ADCA 2D5YA 3HVYA 2CH2A 1BJOB 2W8WA 2FNUA 3A8UX 1VEFA 2W7FA 3BN1A 3KGXA 1AX4A 4A0HA 4J5UA 3DC1A 4P3MA 4AO4A 1LKCA 2YOBA 5M49A 1O61A 1ARGA 4R2NA 4WLHA 1BW0A 5HDMA 5HHYA 1DGDA 1EQBA 1QJ5A 4BA4A 2VMRA 1RVUA 1MLYA 1V2FA 1DJUA 3EIAA 3KE3A 4ATQA 1B8GA 1X29A 2X5DA 2VGVA 2BWNA 4LW4A 1M0OA 3CQ5A 3FZ8A 3P1TA 1BJWA 3FVUA 4MQQA 2W8JA 4ZSWA 5G2PA 4ITXA 2OKJA 3BCBA 1ASCA 1QIRA 1TATA 3EZSA 2VMWA 4F5IA 3AOWA 2BIEA 3LV2A 3NYTA 4JF1A 4W1VA 4QGRA 5G2QA 4A6UA 1CQ7A 1M4NA 4EFFA 3MAFB 1AIAA 3HDOA 3E77A 4WXGA 3FFRA 4ZLVA 5EUEA 3EI6A 4XAUA 2ZP7A 3B46A 2GMSA 4JF0A 3IHJA 1BJ4A 4XQ2A 4K2MA 2ZY2A 4GDYA 4OBUA 3JTXA 1W23A 2VMSA 3LVKA 3N0LA 1Z7DA 3PDBB 2OGAA 4MSOA 4RLGA 2AY3A 3TFUA 5HXXA 2VMPA 4IXSA 5LHAA 2HOYA 1RV3A 4B9BA 3K7YA 2W7EA 1ASMA 1DTYA 3FRKA 2HOZA 4LC3A 3RCHB 3VK3A 1C7GA 3DRDA 2YHKA 4ITGA 3G0TA 5M4DA 4ADEA 2BI2A 3AENA 1YOOA 5DJ1A 3R4TA 1LW4A 2OATA 4ZDOA 4EMYA 1CQ6A 3QGUA 1IJIA 1PFFA 2CJGA 2HUIA 2R5EA 3VK2A 4K2IA 3VK4A 4MKJA 1LC7A 1D7UA 3NTJA 3USFA 4XJMA 2W7MA 1GD9A 3ACZA 1GC4A 2V0YA 1ARSA 4Q31A 4GE9A 4LNMA 4JE5A 3N4XA 4WYGA 2E54A 1O4SA 1ARIA 1BT4A 1EJIA 4CBSA 2BYLA 2VLFA 5FT4A 3IF2A 1W7NA 3FSLA 3WY7A 4OC9A 1TOKA 4K05A 4LNLA 1QGNA 3LVMA 1FC4A 4A6RA 4JEWA 3N7NA 1CJ0A 4RKDA 2WK9A 1GEXA 1IBJA 3VOMA 1KMKA 2ZSLA 1LW5A 4GE4A 2HOXA 3FCRA 4RJ0A 2BIAA 1AMSA 3PA9A 3DZZA 1RVYA 1E5EA 1AJSA 1UU1A 2FN6A 1IUGA 2JGTA 2Z67A 3B1CA 2AATA 3AEMA 3MAUA 1AY5A 3P6KA 3CBFA 3GZDC 5EIGB 3HLMA 1MDZA 5E3KA 3FDDA 3FTBA 4LNJA 4JEZA 3BV0A 1D7SA 1X2AA 2DGLA 2D63A 3MEBA 2E7IA 3II0A 2XH1A 2VMOA 1AHFA 3DYDA 4XJLA 2EYQA 4UHMA 3BS8A 4O6ZA 1LC5A 4PFFA 3AENB 3AEJC 1GDEA 1M7YA 3EI8A 1W7MA 1DGEA 4W1XA 3G7QA 2Z9UA 1YIYA 2ZY5A 3PJ0A 3I16A 2BWOA 4Y0IA 1S09A 1M0QA 3KGWA 1BJNA 3E9KA 4AOAA 3AEOA 4WP0A 2HUUA 2JG2A 3HL2A 1AHGA 2CJDA 2EZ2A 2QMAA 3ELEA 1C7OA 1B4XA 3RBLA 3K40A 4PFNA 1KMJA 1AJSB 2AY7A 4OT8A 5DB5A 1GC2A 4F5LA 1I43A 2AY6A 3ATHA 4MQRA 2QSRA 4H51A 5G4IA 1PMMA 3A9ZA 3M5UA 4ZWMA 1SF2A 1TOGA 4F5FA 2OGEA 1SVVA 5FT6A 2BIGA 4R5FA 4JEVA 1YNUA 2JJHA 2CFBA 4N0WA 2ZUKA 4HF8A 4CVQA 4M2KA 3LY1A 3DXVA 3LVLB 1TARA 4IY7A 3N75A 5EAAA 2ORDA 4JEYA 1AICA 3UAKA 2RFVA 2GQNA 3AV7A 4IXZA 1ASFA 4HVKA 4A0GA 1WYTB 3AELA 4BA5A 4IYOA 4WB0A 2Z9XA 3FQ8A 1SZUA 1QISA 3B1EA 3WGBA 1PMOA 1M32A 1QITA 2BI5A 3H7FA 1CL2A 4ZSYA 2D7YA 4KYOA 2FKIA 2G6WA 2FM1A 3BCXA 1ASEA 2R5CA 4UHOA 3FVSA 5LH9A 3NU8A 1UKJA 3VAXA 1ASDA 1S07A 3BCAA 3H14A 1IAXA 2YKVA 1TOJA 4UQVA 4AZJA 3EUCA 4RITA 3NUBA 3OKSA 2GMUA 3A2BA 3A9YA 2Z20A 3KKIA 4ZDLA 3E2ZB 3GJUA 2W7KA 3E2ZA 3ZZJA 3DR7A 3MBBA 2VGTA 3PGYA 4WLJA 4ADBA 3G8MA 4ISYA 1YJYA 4FFCA 4KAMA 2VGSA 2CANA 3CQ6A 2C0RA 3D6KA 2DR1A 4A72A 1GC3A 1PG8A 2W7GA 3W1IA 4OYTA 3H9XA 3EI7A 2TPLA 4Q76A 3ASAA 1AHXA 3MAFA 1GEWA 3FZ7A 3NU7A 4WB0B 4F4EA 4I8AA 4NOGA 1IX7A 4RAEA 1B9IA 1AMAA 4JEXA 1ASNA 1WYVB 2W7IA 5DJ9A 3F6TA 1DFOA 3W1JA 2V1PA 1AJRA 2VLHA 4F5HA 9AATA 1KL2A 2X8UA 3E6GA 4A00A 1I41A 4W8IA 4Y0DA 4DBCA 3ZRPA 4BHDA 5TF5A 1YIZA 2WKAA 3LWSA 3Q8NA 1OATA 1J32A 1AKAA 1ASAA 3MKJA 3QI6A 2W7JA 1DJ9A 1UU0A 1AY4A 1D2FA 4IW7A 2AEVA 2DOUA 2G7JA 3JZLA 3NDNA 1D7VA 2PB0A 4KXKA 2HORA 4GSAA 3R9AA 5I92A 1AMQA 1CZEA 3EIBA 3K28A 3PD6B 3CAIA 5DX5A 2VMUA 4Y0HA 3PIUA 5FT5A 5C6UA 4LW2A 4MQPA 5AX8A 4WYAA 2C44A 1WYUA 2EPJA 1N2TA 1EG5A 1GEYA 3BB8A 3MC6A 1MLZA 1ZC9A 2VMTA 1G4VA 2A1VA 1AKBA 2VIAA 1LC8A 1TASA 1ECXA 2CJHA 2DKJA 2FNIA 3BWNA 3GBXA 2VMQA 1T3IA 4GEBA 5IWQA 3UWCA 1CQ8A 1G7WA 3AEMC 1N8PA 3FQAA 4ZM3A 2Z9WA 2W7DA 4WYFA 3NUIA 1ORDA 4XEWA 2DGMA 8AATA 2AEUA 1FG7A 2VGUA 3T32A 2VGZA 1FG3A 1ZODA 2C81A 3NX3A 4AZKA 1QJ3A 2AY5A 3L44A 3GWPA 2AY8A 3A9XA 1AKCA 2QBTA 1MAPA 4RKCA 1H1CA 1YJSA 3QBOA 1I48A 4ATPA 3PPLA 4N0BA 3EI5A 4U1TA 3FKDA 4A6TA 2EGYA 2BI1A 1IX6A 2PO3A 2W7HA 4F5JA 1C0NA 3RBFA 3HQTA 2YCTA 1W7LA 3ELPA 3RQ1A 3FQ7A 2CINA 2YCNA 2F8JA 5EUNA 5EFSA 1BQDA 4CBRA 4FL0A 2CH1A 2AY9A 2VI8A 2W8VA 4CXQA 4H63Q 4CXRA 2BHXA 2R5CB 1AAWA 2YCPA 3JWAA 3W1HA 4F5KA 1M0NA 3HMUA 3MADA 1RV4A 3ASBA 2BKWA 2VMNA 4MY5A 2FYFA 2YRIA 2VI9A 1D7RA 2EH6A 4AO9A 4MGRA 4WXBA 4OBVA 1S06A 2W8TA 1TPLA 1DKAA 2Z61A 2HUFA 1J04A 4J8LA 2DKBA 1N31A 2AY1A 2CTZA 1U08A 2CB1A 4M2MA 3PDBA 1O69A 4MKKA 2BI3A 1MAQA 5BJ3A 3DXWA 2GB3A 5D95A 1G7XA 1Z3ZA 4L0OA 3ZRRA 3B1DA 4TMRA 5EQCA 2VYCA 1C7NA 2D66A 2JJFA 4W5KA 2D7ZA 2HP1A 3OP7A 2YKXA 5F9SA 3AEPA 3ECDA 1OXOA 5F8VA 1XI9A 5KTBA 2D61A 3I5TA 3NNKA 2X3LA 2ZC0A 2VIBA 3DODA 1G4XA 3QM2A 3NYSA 1ASGA 2PB2A 2R0TA 4RM1A 3RUYA 3EZ1A 1IAYA 3WCNA 2CSTA 4PIWA 1OHYA 2HP2A 4ZM4A 2JISA 1IX8A 1GC0A 3E2YA 2Z1YA 2VGWA 4K2BA 5EAVA 5G4JA 2CY8A 1OXPA 5EUDA 5D5SA 3B8XA 4WYEA 1MDXA 3ISLA 3BWNC 3WX9A 3JU7A 7AATA 1YAAA 4B98A 1MDOA 1ASBA 1ELQA 2Q7WA 4ZASA 2BWPA 1BKGA 2JJGA 2NMPA 2E7UA 3WLXA 1B9HA 4RJYA 4Q6RA 3QN6A 1WYUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKY A;  2JJE A;  4EU1 A;  3BC8 A;  4RIZ A;  4M2J A;  1UU2 A;  2W8U A;  1V72 A;  4GRX A;  1O62 A;  1KKJ A;  1WYV A;  1WKH A;  4XK1 A;  1M0P A;  4TV7 A;  4GE7 A;  2ZYJ A;  3AAT A;  2W7L A;  4WD2 A;  1ELU A;  1JG8 A;  1OHV A;  5E4Z A;  3BWO A;  3TFT A;  4UHN A;  2BI9 A;  2EO5 A;  3NYU A;  3NRA A;  1VP4 A;  2QB2 A;  1TOI A;  3LVJ A;  4W91 A;  4BMK A;  4F5M A;  3RI6 A;  4E3R A;  2OQX A;  4E77 A;  2ZY3 A;  3TAT A;  3FDB A;  4WYC A;  3COG A;  1SPA A;  2WK7 A;  3FD0 A;  4UOY A;  1C9C A;  4ZAH A;  4WXF A;  1M6S A;  1ZOB A;  5J8Q A;  2QLR A;  3LG0 A;  3EI9 A;  1DJE A;  3PD6 A;  4F5G A;  1KL1 A;  4OMA A;  4A0R A;  5E5I A;  3TCM A;  1ARH A;  1CS1 A;  3GSB A;  4IXO A;  1B5O A;  4AH3 A;  5M46 A;  1BJO A;  1KKP A;  5K8B A;  2C7T A;  1I29 A;  3FZ6 A;  2VMZ A;  3GR9 A;  4IX8 A;  5BJ4 A;  4R5Z A;  2E7J A;  2D65 A;  2VMX A;  1ASL A;  1JS6 A;  1Y4I A;  4ZWV A;  1YJZ A;  3I4J A;  1JS3 A;  3WZF A;  4OCA A;  3F0H A;  4PVF A;  4ZDP A;  1H0C A;  1SZS A;  4P7Y A;  4XJO A;  4EB5 A;  5M4B A;  1GCK A;  1C4K A;  1MGV A;  3GZC A;  3MC6 C;  2DGK A;  2WK8 A;  2ZJG A;  1WST A;  1AAM A;  1AMR A;  3AOV A;  1BS0 A;  3HBX A;  1VJO A;  1S08 A;  1ART A;  5G0A A;  5JAY A;  3WKR A;  1CL1 A;  2YRR A;  3DR4 A;  1QZ9 A;  3WCO A;  4E3Q A;  4TN4 A;  2GSA A;  1OHW A;  1V2E A;  4OTL A;  2VMV A;  1TOE A;  4BQ0 A;  1X0M A;  3TQX A;  1LS3 A;  2O1B A;  3UE8 A;  2QB3 A;  3GZD A;  1WYT A;  1E5F A;  3CQ4 A;  4WYD A;  2FQ6 A;  1BQA A;  2Z9V A;  1S0A A;  2BYJ A;  2QA3 A;  2VMY A;  5FT8 A;  2XBN A;  2D64 A;  4R8D A;  3ZRQ A;  1WKG A;  3GET A;  4EB7 A;  3WGC A;  2EZ1 A;  3PDX A;  4JE5 D;  3E2F A;  1P3W A;  1XEY A;  2HZP A;  4E1O A;  4WBT A;  3DU4 A;  1SFF A;  3AEJ A;  3HT4 A;  3JW9 A;  3QPG A;  3RCH A;  4ADD A;  3PAA A;  2ZSM A;  1AHE A;  3JWB A;  3WKS A;  1GBN A;  3F9T A;  3FVX A;  2Z1Z A;  4Q75 A;  3ZZK A;  1AY8 A;  1X28 A;  4U2H A;  1AIB A;  1B5P A;  4IYO B;  5G09 A;  2ZY4 A;  2O7C A;  3QHX A;  1IVR A;  1AHY A;  1CZC A;  3L8A A;  4A0F A;  4XJP A;  2X5F A;  1W3U A;  2OKK A;  2R2N A;  4W1W A;  4DGT A;  4DQ6 A;  3VP6 A;  1V2D A;  1SZK A;  2O0R A;  2AY4 A;  1JF9 A;  3N5M A;  2AY2 A;  1LK9 A;  3FFH A;  2YKU A;  5EIG A;  4ADC A;  2D5Y A;  3HVY A;  2CH2 A;  1BJO B;  2W8W A;  2FNU A;  3A8U X;  1VEF A;  2W7F A;  3BN1 A;  3KGX A;  1AX4 A;  4A0H A;  4J5U A;  3DC1 A;  4P3M A;  4AO4 A;  1LKC A;  2YOB A;  5M49 A;  1O61 A;  1ARG A;  4R2N A;  4WLH A;  1BW0 A;  5HDM A;  5HHY A;  1DGD A;  1EQB A;  1QJ5 A;  4BA4 A;  2VMR A;  1RVU A;  1MLY A;  1V2F A;  1DJU A;  3EIA A;  3KE3 A;  4ATQ A;  1B8G A;  1X29 A;  2X5D A;  2VGV A;  2BWN A;  4LW4 A;  1M0O A;  3CQ5 A;  3FZ8 A;  3P1T A;  1BJW A;  3FVU A;  4MQQ A;  2W8J A;  4ZSW A;  5G2P A;  4ITX A;  2OKJ A;  3BCB A;  1ASC A;  1QIR A;  1TAT A;  3EZS A;  2VMW A;  4F5I A;  3AOW A;  2BIE A;  3LV2 A;  3NYT A;  4JF1 A;  4W1V A;  4QGR A;  5G2Q A;  4A6U A;  1CQ7 A;  1M4N A;  4EFF A;  3MAF B;  1AIA A;  3HDO A;  3E77 A;  4WXG A;  3FFR A;  4ZLV A;  5EUE A;  3EI6 A;  4XAU A;  2ZP7 A;  3B46 A;  2GMS A;  4JF0 A;  3IHJ A;  1BJ4 A;  4XQ2 A;  4K2M A;  2ZY2 A;  4GDY A;  4OBU A;  3JTX A;  1W23 A;  2VMS A;  3LVK A;  3N0L A;  1Z7D A;  3PDB B;  2OGA A;  4MSO A;  4RLG A;  2AY3 A;  3TFU A;  5HXX A;  2VMP A;  4IXS A;  5LHA A;  2HOY A;  1RV3 A;  4B9B A;  3K7Y A;  2W7E A;  1ASM A;  1DTY A;  3FRK A;  2HOZ A;  4LC3 A;  3RCH B;  3VK3 A;  1C7G A;  3DRD A;  2YHK A;  4ITG A;  3G0T A;  5M4D A;  4ADE A;  2BI2 A;  3AEN A;  1YOO A;  5DJ1 A;  3R4T A;  1LW4 A;  2OAT A;  4ZDO A;  4EMY A;  1CQ6 A;  3QGU A;  1IJI A;  1PFF A;  2CJG A;  2HUI A;  2R5E A;  3VK2 A;  4K2I A;  3VK4 A;  4MKJ A;  1LC7 A;  1D7U A;  3NTJ A;  3USF A;  4XJM A;  2W7M A;  1GD9 A;  3ACZ A;  1GC4 A;  2V0Y A;  1ARS A;  4Q31 A;  4GE9 A;  4LNM A;  4JE5 A;  4WYG A;  2E54 A;  1O4S A;  1ARI A;  1BT4 A;  1EJI A;  4CBS A;  2BYL A;  2VLF A;  5FT4 A;  3IF2 A;  1W7N A;  3FSL A;  3WY7 A;  4OC9 A;  1TOK A;  4LNL A;  1QGN A;  3LVM A;  1FC4 A;  4A6R A;  4JEW A;  1CJ0 A;  4RKD A;  2WK9 A;  1GEX A;  1IBJ A;  3VOM A;  1KMK A;  2ZSL A;  1LW5 A;  4GE4 A;  2HOX A;  3FCR A;  4RJ0 A;  2BIA A;  1AMS A;  3PA9 A;  3DZZ A;  1RVY A;  1E5E A;  1AJS A;  1UU1 A;  2FN6 A;  1IUG A;  2JGT A;  2Z67 A;  3B1C A;  2AAT A;  3AEM A;  3MAU A;  1AY5 A;  3P6K A;  3CBF A;  3GZD C;  5EIG B;  3HLM A;  1MDZ A;  5E3K A;  3FDD A;  3FTB A;  4LNJ A;  4JEZ A;  3BV0 A;  1D7S A;  1X2A A;  2DGL A;  2D63 A;  3MEB A;  2E7I A;  3II0 A;  2XH1 A;  2VMO A;  1AHF A;  3DYD A;  4XJL A;  4UHM A;  3BS8 A;  4O6Z A;  1LC5 A;  4PFF A;  3AEN B;  3AEJ C;  1GDE A;  1M7Y A;  3EI8 A;  1W7M A;  1DGE A;  4W1X A;  3G7Q A;  2Z9U A;  1YIY A;  2ZY5 A;  3PJ0 A;  3I16 A;  2BWO A;  4Y0I A;  1S09 A;  1M0Q A;  3KGW A;  1BJN A;  3E9K A;  4AOA A;  3AEO A;  4WP0 A;  2HUU A;  2JG2 A;  3HL2 A;  1AHG A;  2CJD A;  2EZ2 A;  2QMA A;  3ELE A;  1C7O A;  1B4X A;  3RBL A;  3K40 A;  4PFN A;  1KMJ A;  1AJS B;  2AY7 A;  4OT8 A;  5DB5 A;  1GC2 A;  4F5L A;  1I43 A;  2AY6 A;  3ATH A;  4MQR A;  4H51 A;  5G4I A;  1PMM A;  3A9Z A;  3M5U A;  4ZWM A;  1SF2 A;  1TOG A;  4F5F A;  2OGE A;  1SVV A;  5FT6 A;  2BIG A;  4R5F A;  4JEV A;  1YNU A;  2JJH A;  2CFB A;  4N0W A;  2ZUK A;  4HF8 A;  4CVQ A;  4M2K A;  3LY1 A;  3DXV A;  3LVL B;  1TAR A;  4IY7 A;  3N75 A;  5EAA A;  2ORD A;  4JEY A;  1AIC A;  3UAK A;  2RFV A;  2GQN A;  3AV7 A;  4IXZ A;  1ASF A;  4HVK A;  4A0G A;  1WYT B;  3AEL A;  4BA5 A;  4IYO A;  4WB0 A;  2Z9X A;  3FQ8 A;  1SZU A;  1QIS A;  3B1E A;  3WGB A;  1PMO A;  1M32 A;  1QIT A;  2BI5 A;  3H7F A;  1CL2 A;  4ZSY A;  2D7Y A;  4KYO A;  2G6W A;  2FM1 A;  3BCX A;  1ASE A;  2R5C A;  4UHO A;  3FVS A;  5LH9 A;  3NU8 A;  1UKJ A;  3VAX A;  1ASD A;  1S07 A;  3BCA A;  3H14 A;  1IAX A;  2YKV A;  1TOJ A;  4UQV A;  4AZJ A;  3EUC A;  4RIT A;  3NUB A;  3OKS A;  2GMU A;  3A2B A;  3A9Y A;  2Z20 A;  3KKI A;  4ZDL A;  3E2Z B;  3GJU A;  2W7K A;  3E2Z A;  3ZZJ A;  3DR7 A;  3MBB A;  2VGT A;  3PGY A;  4WLJ A;  4ADB A;  3G8M A;  4ISY A;  1YJY A;  4FFC A;  4KAM A;  2VGS A;  2CAN A;  3CQ6 A;  2C0R A;  3D6K A;  2DR1 A;  4A72 A;  1GC3 A;  1PG8 A;  2W7G A;  3W1I A;  4OYT A;  3EI7 A;  2TPL A;  4Q76 A;  3ASA A;  1AHX A;  3MAF A;  1GEW A;  3FZ7 A;  3NU7 A;  4WB0 B;  4F4E A;  4I8A A;  4NOG A;  1IX7 A;  4RAE A;  1B9I A;  1AMA A;  4JEX A;  1ASN A;  1WYV B;  2W7I A;  5DJ9 A;  3F6T A;  1DFO A;  3W1J A;  2V1P A;  1AJR A;  2VLH A;  4F5H A;  9AAT A;  1KL2 A;  2X8U A;  3E6G A;  4A00 A;  1I41 A;  4W8I A;  4Y0D A;  4DBC A;  3ZRP A;  4BHD A;  5TF5 A;  1YIZ A;  2WKA A;  3LWS A;  3Q8N A;  1OAT A;  1J32 A;  1AKA A;  1ASA A;  3MKJ A;  3QI6 A;  2W7J A;  1DJ9 A;  1UU0 A;  1AY4 A;  1D2F A;  4IW7 A;  2AEV A;  2DOU A;  3JZL A;  3NDN A;  1D7V A;  2PB0 A;  4KXK A;  2HOR A;  4GSA A;  3R9A A;  5I92 A;  1AMQ A;  1CZE A;  3EIB A;  3K28 A;  3PD6 B;  3CAI A;  5DX5 A;  2VMU A;  4Y0H A;  3PIU A;  5FT5 A;  5C6U A;  4LW2 A;  4MQP A;  5AX8 A;  4WYA A;  2C44 A;  1WYU A;  2EPJ A;  1N2T A;  1EG5 A;  1GEY A;  3BB8 A;  3MC6 A;  1MLZ A;  1ZC9 A;  2VMT A;  1G4V A;  1AKB A;  2VIA A;  1LC8 A;  1TAS A;  1ECX A;  2CJH A;  2DKJ A;  2FNI A;  3BWN A;  3GBX A;  2VMQ A;  1T3I A;  4GEB A;  5IWQ A;  3UWC A;  1CQ8 A;  1G7W A;  3AEM C;  1N8P A;  3FQA A;  4ZM3 A;  2Z9W A;  2W7D A;  4WYF A;  3NUI A;  1ORD A;  4XEW A;  2DGM A;  8AAT A;  2AEU A;  1FG7 A;  2VGU A;  3T32 A;  2VGZ A;  1FG3 A;  1ZOD A;  2C81 A;  3NX3 A;  4AZK A;  1QJ3 A;  2AY5 A;  3L44 A;  3GWP A;  2AY8 A;  3A9X A;  1AKC A;  2QBT A;  1MAP A;  4RKC A;  1H1C A;  1YJS A;  3QBO A;  1I48 A;  4ATP A;  3PPL A;  4N0B A;  3EI5 A;  4U1T A;  3FKD A;  4A6T A;  2EGY A;  2BI1 A;  1IX6 A;  2PO3 A;  2W7H A;  4F5J A;  1C0N A;  3RBF A;  3HQT A;  2YCT A;  1W7L A;  3ELP A;  3RQ1 A;  3FQ7 A;  2CIN A;  2YCN A;  2F8J A;  5EUN A;  5EFS A;  1BQD A;  4CBR A;  4FL0 A;  2CH1 A;  2AY9 A;  2VI8 A;  2W8V A;  4CXQ A;  4CXR A;  2BHX A;  2R5C B;  1AAW A;  2YCP A;  3JWA A;  3W1H A;  4F5K A;  1M0N A;  3HMU A;  3MAD A;  1RV4 A;  3ASB A;  2BKW A;  2VMN A;  4MY5 A;  2FYF A;  2YRI A;  2VI9 A;  1D7R A;  2EH6 A;  4AO9 A;  4MGR A;  4WXB A;  4OBV A;  1S06 A;  2W8T A;  1TPL A;  1DKA A;  2Z61 A;  2HUF A;  1J04 A;  4J8L A;  2DKB A;  1N31 A;  2AY1 A;  2CTZ A;  1U08 A;  2CB1 A;  4M2M A;  3PDB A;  1O69 A;  4MKK A;  2BI3 A;  1MAQ A;  5BJ3 A;  3DXW A;  2GB3 A;  5D95 A;  1G7X A;  1Z3Z A;  4L0O A;  3ZRR A;  3B1D A;  4TMR A;  5EQC A;  2VYC A;  1C7N A;  2D66 A;  2JJF A;  4W5K A;  2D7Z A;  2HP1 A;  3OP7 A;  2YKX A;  5F9S A;  3AEP A;  3ECD A;  1OXO A;  5F8V A;  1XI9 A;  2D61 A;  3I5T A;  3NNK A;  2X3L A;  2ZC0 A;  2VIB A;  3DOD A;  1G4X A;  3QM2 A;  3NYS A;  1ASG A;  2PB2 A;  2R0T A;  4RM1 A;  3RUY A;  3EZ1 A;  1IAY A;  3WCN A;  2CST A;  4PIW A;  1OHY A;  2HP2 A;  4ZM4 A;  2JIS A;  1IX8 A;  1GC0 A;  3E2Y A;  2Z1Y A;  2VGW A;  4K2B A;  5EAV A;  5G4J A;  2CY8 A;  1OXP A;  5EUD A;  5D5S A;  3B8X A;  4WYE A;  1MDX A;  3ISL A;  3BWN C;  3WX9 A;  3JU7 A;  7AAT A;  1YAA A;  4B98 A;  1MDO A;  1ASB A;  1ELQ A;  2Q7W A;  4ZAS A;  2BWP A;  1BKG A;  2JJG A;  2NMP A;  2E7U A;  3WLX A;  1B9H A;  4RJY A;  4Q6R A;  3QN6 A;  1WYU B; 
#chains in the Genus database with same CATH topology
 2YKY A;  2JJE A;  4EU1 A;  3BC8 A;  4RIZ A;  4M2J A;  1UU2 A;  2W8U A;  1V72 A;  4GRX A;  1O62 A;  1KKJ A;  1WYV A;  1WKH A;  4XK1 A;  1M0P A;  4TV7 A;  4GE7 A;  2ZYJ A;  3AAT A;  2W7L A;  4WD2 A;  1ELU A;  1JG8 A;  1OHV A;  5E4Z A;  3BWO A;  3TFT A;  4UHN A;  2BI9 A;  2EO5 A;  3NYU A;  3NRA A;  1VP4 A;  2QB2 A;  1TOI A;  3LVJ A;  4W91 A;  4BMK A;  4F5M A;  3RI6 A;  4E3R A;  2OQX A;  4E77 A;  2ZY3 A;  3TAT A;  3FDB A;  4WYC A;  3COG A;  2WB6 A;  1SPA A;  2WK7 A;  3FD0 A;  4UOY A;  1C9C A;  4ZAH A;  4WXF A;  1M6S A;  1ZOB A;  5J8Q A;  2QLR A;  3LG0 A;  3EI9 A;  1DJE A;  3PD6 A;  4F5G A;  1KL1 A;  4OMA A;  4A0R A;  5E5I A;  3TCM A;  1ARH A;  1CS1 A;  3GSB A;  4IXO A;  1B5O A;  4AH3 A;  5M46 A;  1BJO A;  1KKP A;  5K8B A;  2C7T A;  1I29 A;  3FZ6 A;  2VMZ A;  3GR9 A;  4IX8 A;  5BJ4 A;  4R5Z A;  2E7J A;  2D65 A;  2VMX A;  1ASL A;  1JS6 A;  1Y4I A;  4ZWV A;  1YJZ A;  3I4J A;  1JS3 A;  3WZF A;  4OCA A;  3F0H A;  4PVF A;  4ZDP A;  1H0C A;  1SZS A;  4P7Y A;  4XJO A;  4EB5 A;  5M4B A;  1GCK A;  1C4K A;  1MGV A;  3GZC A;  3MC6 C;  2DGK A;  2WK8 A;  2ZJG A;  1WST A;  1AAM A;  1AMR A;  3AOV A;  2KFP A;  3N4S A;  1BS0 A;  3HBX A;  1VJO A;  1S08 A;  1ART A;  5G0A A;  5JAY A;  3WKR A;  1CL1 A;  2YRR A;  3DR4 A;  1QZ9 A;  3WCO A;  4E3Q A;  4TN4 A;  2GSA A;  1OHW A;  1V2E A;  4OTL A;  2VMV A;  1TOE A;  4BQ0 A;  1X0M A;  3TQX A;  1LS3 A;  2O1B A;  3UE8 A;  2QB3 A;  3GZD A;  3N4R A;  1WYT A;  1E5F A;  3CQ4 A;  4WYD A;  2FQ6 A;  1BQA A;  2Z9V A;  1S0A A;  2BYJ A;  2QA3 A;  2VMY A;  5FT8 A;  2XBN A;  2D64 A;  4R8D A;  3ZRQ A;  1WKG A;  3GET A;  4EB7 A;  3WGC A;  2EZ1 A;  3PDX A;  4JE5 D;  3E2F A;  1P3W A;  1XEY A;  2HZP A;  4E1O A;  4WBT A;  3DU4 A;  1SFF A;  3AEJ A;  3HT4 A;  3JW9 A;  3QPG A;  3RCH A;  4ADD A;  3PAA A;  2ZSM A;  1AHE A;  3JWB A;  3WKS A;  1GBN A;  3F9T A;  3FVX A;  2Z1Z A;  4Q75 A;  3ZZK A;  1AY8 A;  1X28 A;  4U2H A;  1AIB A;  1B5P A;  4IYO B;  5G09 A;  2ZY4 A;  2O7C A;  3QHX A;  1IVR A;  1AHY A;  1CZC A;  3L8A A;  4A0F A;  4XJP A;  2X5F A;  1W3U A;  2OKK A;  2R2N A;  4W1W A;  4DGT A;  4DQ6 A;  3VP6 A;  1V2D A;  1SZK A;  2O0R A;  2AY4 A;  1JF9 A;  3N5M A;  2AY2 A;  1LK9 A;  3FFH A;  2YKU A;  5EIG A;  4ADC A;  2D5Y A;  3HVY A;  2CH2 A;  1BJO B;  2W8W A;  2FNU A;  3A8U X;  1KAF A;  1VEF A;  2W7F A;  3BN1 A;  3KGX A;  1AX4 A;  4A0H A;  4J5U A;  3DC1 A;  4P3M A;  4AO4 A;  1LKC A;  2YOB A;  5M49 A;  1O61 A;  1ARG A;  4R2N A;  4WLH A;  1BW0 A;  5HDM A;  5HHY A;  1DGD A;  1EQB A;  1QJ5 A;  4BA4 A;  2VMR A;  1RVU A;  1MLY A;  1V2F A;  1DJU A;  3EIA A;  3KE3 A;  4ATQ A;  1B8G A;  1X29 A;  2X5D A;  2VGV A;  2BWN A;  4LW4 A;  1M0O A;  3CQ5 A;  3FZ8 A;  3P1T A;  1BJW A;  3FVU A;  4MQQ A;  2W8J A;  4ZSW A;  5G2P A;  4ITX A;  2OKJ A;  3BCB A;  1ASC A;  1QIR A;  1TAT A;  3EZS A;  2VMW A;  4F5I A;  3AOW A;  2BIE A;  3LV2 A;  3NYT A;  4JF1 A;  4W1V A;  4QGR A;  5G2Q A;  4A6U A;  1CQ7 A;  1M4N A;  4EFF A;  3MAF B;  1AIA A;  3HDO A;  3E77 A;  4WXG A;  3FFR A;  4ZLV A;  5EUE A;  3EI6 A;  4XAU A;  2ZP7 A;  3B46 A;  2GMS A;  4JF0 A;  3IHJ A;  1BJ4 A;  4XQ2 A;  4K2M A;  2ZY2 A;  4GDY A;  4OBU A;  3JTX A;  1W23 A;  2VMS A;  3LVK A;  3N0L A;  1Z7D A;  3PDB B;  2OGA A;  4MSO A;  4RLG A;  2AY3 A;  3TFU A;  5HXX A;  2VMP A;  4IXS A;  5LHA A;  2HOY A;  1RV3 A;  4B9B A;  3K7Y A;  2W7E A;  1ASM A;  1DTY A;  3FRK A;  2HOZ A;  4LC3 A;  3RCH B;  3VK3 A;  1C7G A;  3DRD A;  2YHK A;  4ITG A;  3G0T A;  5M4D A;  4ADE A;  2BI2 A;  3AEN A;  1YOO A;  5DJ1 A;  3R4T A;  1LW4 A;  2OAT A;  4ZDO A;  4EMY A;  1CQ6 A;  3QGU A;  1IJI A;  1PFF A;  2CJG A;  2HUI A;  2R5E A;  3VK2 A;  4K2I A;  3VK4 A;  4MKJ A;  1LC7 A;  1D7U A;  3NTJ A;  3USF A;  4XJM A;  2W7M A;  1GD9 A;  3ACZ A;  1GC4 A;  2V0Y A;  1ARS A;  4Q31 A;  4GE9 A;  4LNM A;  4JE5 A;  3N4X A;  4WYG A;  2E54 A;  1O4S A;  1ARI A;  1BT4 A;  1EJI A;  4CBS A;  2BYL A;  2VLF A;  5FT4 A;  3IF2 A;  1W7N A;  3FSL A;  3WY7 A;  4OC9 A;  1TOK A;  4K05 A;  4LNL A;  1QGN A;  3LVM A;  1FC4 A;  4A6R A;  4JEW A;  3N7N A;  1CJ0 A;  4RKD A;  2WK9 A;  1GEX A;  1IBJ A;  3VOM A;  1KMK A;  2ZSL A;  1LW5 A;  4GE4 A;  2HOX A;  3FCR A;  4RJ0 A;  2BIA A;  1AMS A;  3PA9 A;  3DZZ A;  1RVY A;  1E5E A;  1AJS A;  1UU1 A;  2FN6 A;  1IUG A;  2JGT A;  2Z67 A;  3B1C A;  2AAT A;  3AEM A;  3MAU A;  1AY5 A;  3P6K A;  3CBF A;  3GZD C;  5EIG B;  3HLM A;  1MDZ A;  5E3K A;  3FDD A;  3FTB A;  4LNJ A;  4JEZ A;  3BV0 A;  1D7S A;  1X2A A;  2DGL A;  2D63 A;  3MEB A;  2E7I A;  3II0 A;  2XH1 A;  2VMO A;  1AHF A;  3DYD A;  4XJL A;  2EYQ A;  4UHM A;  3BS8 A;  4O6Z A;  1LC5 A;  4PFF A;  3AEN B;  3AEJ C;  1GDE A;  1M7Y A;  3EI8 A;  1W7M A;  1DGE A;  4W1X A;  3G7Q A;  2Z9U A;  1YIY A;  2ZY5 A;  3PJ0 A;  3I16 A;  2BWO A;  4Y0I A;  1S09 A;  1M0Q A;  3KGW A;  1BJN A;  3E9K A;  4AOA A;  3AEO A;  4WP0 A;  2HUU A;  2JG2 A;  3HL2 A;  1AHG A;  2CJD A;  2EZ2 A;  2QMA A;  3ELE A;  1C7O A;  1B4X A;  3RBL A;  3K40 A;  4PFN A;  1KMJ A;  1AJS B;  2AY7 A;  4OT8 A;  5DB5 A;  1GC2 A;  4F5L A;  1I43 A;  2AY6 A;  3ATH A;  4MQR A;  2QSR A;  4H51 A;  5G4I A;  1PMM A;  3A9Z A;  3M5U A;  4ZWM A;  1SF2 A;  1TOG A;  4F5F A;  2OGE A;  1SVV A;  5FT6 A;  2BIG A;  4R5F A;  4JEV A;  1YNU A;  2JJH A;  2CFB A;  4N0W A;  2ZUK A;  4HF8 A;  4CVQ A;  4M2K A;  3LY1 A;  3DXV A;  3LVL B;  1TAR A;  4IY7 A;  3N75 A;  5EAA A;  2ORD A;  4JEY A;  1AIC A;  3UAK A;  2RFV A;  2GQN A;  3AV7 A;  4IXZ A;  1ASF A;  4HVK A;  4A0G A;  1WYT B;  3AEL A;  4BA5 A;  4IYO A;  4WB0 A;  2Z9X A;  3FQ8 A;  1SZU A;  1QIS A;  3B1E A;  3WGB A;  1PMO A;  1M32 A;  1QIT A;  2BI5 A;  3H7F A;  1CL2 A;  4ZSY A;  2D7Y A;  4KYO A;  2FKI A;  2G6W A;  2FM1 A;  3BCX A;  1ASE A;  2R5C A;  4UHO A;  3FVS A;  5LH9 A;  3NU8 A;  1UKJ A;  3VAX A;  1ASD A;  1S07 A;  3BCA A;  3H14 A;  1IAX A;  2YKV A;  1TOJ A;  4UQV A;  4AZJ A;  3EUC A;  4RIT A;  3NUB A;  3OKS A;  2GMU A;  3A2B A;  3A9Y A;  2Z20 A;  3KKI A;  4ZDL A;  3E2Z B;  3GJU A;  2W7K A;  3E2Z A;  3ZZJ A;  3DR7 A;  3MBB A;  2VGT A;  3PGY A;  4WLJ A;  4ADB A;  3G8M A;  4ISY A;  1YJY A;  4FFC A;  4KAM A;  2VGS A;  2CAN A;  3CQ6 A;  2C0R A;  3D6K A;  2DR1 A;  4A72 A;  1GC3 A;  1PG8 A;  2W7G A;  3W1I A;  4OYT A;  3H9X A;  3EI7 A;  2TPL A;  4Q76 A;  3ASA A;  1AHX A;  3MAF A;  1GEW A;  3FZ7 A;  3NU7 A;  4WB0 B;  4F4E A;  4I8A A;  4NOG A;  1IX7 A;  4RAE A;  1B9I A;  1AMA A;  4JEX A;  1ASN A;  1WYV B;  2W7I A;  5DJ9 A;  3F6T A;  1DFO A;  3W1J A;  2V1P A;  1AJR A;  2VLH A;  4F5H A;  9AAT A;  1KL2 A;  2X8U A;  3E6G A;  4A00 A;  1I41 A;  4W8I A;  4Y0D A;  4DBC A;  3ZRP A;  4BHD A;  5TF5 A;  1YIZ A;  2WKA A;  3LWS A;  3Q8N A;  1OAT A;  1J32 A;  1AKA A;  1ASA A;  3MKJ A;  3QI6 A;  2W7J A;  1DJ9 A;  1UU0 A;  1AY4 A;  1D2F A;  4IW7 A;  2AEV A;  2DOU A;  2G7J A;  3JZL A;  3NDN A;  1D7V A;  2PB0 A;  4KXK A;  2HOR A;  4GSA A;  3R9A A;  5I92 A;  1AMQ A;  1CZE A;  3EIB A;  3K28 A;  3PD6 B;  3CAI A;  5DX5 A;  2VMU A;  4Y0H A;  3PIU A;  5FT5 A;  5C6U A;  4LW2 A;  4MQP A;  5AX8 A;  4WYA A;  2C44 A;  1WYU A;  2EPJ A;  1N2T A;  1EG5 A;  1GEY A;  3BB8 A;  3MC6 A;  1MLZ A;  1ZC9 A;  2VMT A;  1G4V A;  2A1V A;  1AKB A;  2VIA A;  1LC8 A;  1TAS A;  1ECX A;  2CJH A;  2DKJ A;  2FNI A;  3BWN A;  3GBX A;  2VMQ A;  1T3I A;  4GEB A;  5IWQ A;  3UWC A;  1CQ8 A;  1G7W A;  3AEM C;  1N8P A;  3FQA A;  4ZM3 A;  2Z9W A;  2W7D A;  4WYF A;  3NUI A;  1ORD A;  4XEW A;  2DGM A;  8AAT A;  2AEU A;  1FG7 A;  2VGU A;  3T32 A;  2VGZ A;  1FG3 A;  1ZOD A;  2C81 A;  3NX3 A;  4AZK A;  1QJ3 A;  2AY5 A;  3L44 A;  3GWP A;  2AY8 A;  3A9X A;  1AKC A;  2QBT A;  1MAP A;  4RKC A;  1H1C A;  1YJS A;  3QBO A;  1I48 A;  4ATP A;  3PPL A;  4N0B A;  3EI5 A;  4U1T A;  3FKD A;  4A6T A;  2EGY A;  2BI1 A;  1IX6 A;  2PO3 A;  2W7H A;  4F5J A;  1C0N A;  3RBF A;  3HQT A;  2YCT A;  1W7L A;  3ELP A;  3RQ1 A;  3FQ7 A;  2CIN A;  2YCN A;  2F8J A;  5EUN A;  5EFS A;  1BQD A;  4CBR A;  4FL0 A;  2CH1 A;  2AY9 A;  2VI8 A;  2W8V A;  4CXQ A;  4H63 Q;  4CXR A;  2BHX A;  2R5C B;  1AAW A;  2YCP A;  3JWA A;  3W1H A;  4F5K A;  1M0N A;  3HMU A;  3MAD A;  1RV4 A;  3ASB A;  2BKW A;  2VMN A;  4MY5 A;  2FYF A;  2YRI A;  2VI9 A;  1D7R A;  2EH6 A;  4AO9 A;  4MGR A;  4WXB A;  4OBV A;  1S06 A;  2W8T A;  1TPL A;  1DKA A;  2Z61 A;  2HUF A;  1J04 A;  4J8L A;  2DKB A;  1N31 A;  2AY1 A;  2CTZ A;  1U08 A;  2CB1 A;  4M2M A;  3PDB A;  1O69 A;  4MKK A;  2BI3 A;  1MAQ A;  5BJ3 A;  3DXW A;  2GB3 A;  5D95 A;  1G7X A;  1Z3Z A;  4L0O A;  3ZRR A;  3B1D A;  4TMR A;  5EQC A;  2VYC A;  1C7N A;  2D66 A;  2JJF A;  4W5K A;  2D7Z A;  2HP1 A;  3OP7 A;  2YKX A;  5F9S A;  3AEP A;  3ECD A;  1OXO A;  5F8V A;  1XI9 A;  5KTB A;  2D61 A;  3I5T A;  3NNK A;  2X3L A;  2ZC0 A;  2VIB A;  3DOD A;  1G4X A;  3QM2 A;  3NYS A;  1ASG A;  2PB2 A;  2R0T A;  4RM1 A;  3RUY A;  3EZ1 A;  1IAY A;  3WCN A;  2CST A;  4PIW A;  1OHY A;  2HP2 A;  4ZM4 A;  2JIS A;  1IX8 A;  1GC0 A;  3E2Y A;  2Z1Y A;  2VGW A;  4K2B A;  5EAV A;  5G4J A;  2CY8 A;  1OXP A;  5EUD A;  5D5S A;  3B8X A;  4WYE A;  1MDX A;  3ISL A;  3BWN C;  3WX9 A;  3JU7 A;  7AAT A;  1YAA A;  4B98 A;  1MDO A;  1ASB A;  1ELQ A;  2Q7W A;  4ZAS A;  2BWP A;  1BKG A;  2JJG A;  2NMP A;  2E7U A;  3WLX A;  1B9H A;  4RJY A;  4Q6R A;  3QN6 A;  1WYU B; 
#chains in the Genus database with same CATH homology
 2YKY A;  2JJE A;  4EU1 A;  3BC8 A;  4RIZ A;  4M2J A;  1UU2 A;  2W8U A;  1V72 A;  4GRX A;  1O62 A;  1KKJ A;  1WYV A;  1WKH A;  4XK1 A;  1M0P A;  4TV7 A;  4GE7 A;  2ZYJ A;  3AAT A;  2W7L A;  4WD2 A;  1ELU A;  1JG8 A;  1OHV A;  5E4Z A;  3BWO A;  3TFT A;  4UHN A;  2BI9 A;  2EO5 A;  3NYU A;  3NRA A;  1VP4 A;  2QB2 A;  1TOI A;  3LVJ A;  4W91 A;  4BMK A;  4F5M A;  3RI6 A;  4E3R A;  2OQX A;  4E77 A;  2ZY3 A;  3TAT A;  3FDB A;  4WYC A;  3COG A;  2WB6 A;  1SPA A;  2WK7 A;  3FD0 A;  4UOY A;  1C9C A;  4ZAH A;  4WXF A;  1M6S A;  1ZOB A;  5J8Q A;  2QLR A;  3LG0 A;  3EI9 A;  1DJE A;  3PD6 A;  4F5G A;  1KL1 A;  4OMA A;  4A0R A;  5E5I A;  3TCM A;  1ARH A;  1CS1 A;  3GSB A;  4IXO A;  1B5O A;  4AH3 A;  5M46 A;  1BJO A;  1KKP A;  5K8B A;  2C7T A;  1I29 A;  3FZ6 A;  2VMZ A;  3GR9 A;  4IX8 A;  5BJ4 A;  4R5Z A;  2E7J A;  2D65 A;  2VMX A;  1ASL A;  1JS6 A;  1Y4I A;  4ZWV A;  1YJZ A;  3I4J A;  1JS3 A;  3WZF A;  4OCA A;  3F0H A;  4PVF A;  4ZDP A;  1H0C A;  1SZS A;  4P7Y A;  4XJO A;  4EB5 A;  5M4B A;  1GCK A;  1C4K A;  1MGV A;  3GZC A;  3MC6 C;  2DGK A;  2WK8 A;  2ZJG A;  1WST A;  1AAM A;  1AMR A;  3AOV A;  2KFP A;  3N4S A;  1BS0 A;  3HBX A;  1VJO A;  1S08 A;  1ART A;  5G0A A;  5JAY A;  3WKR A;  1CL1 A;  2YRR A;  3DR4 A;  1QZ9 A;  3WCO A;  4E3Q A;  4TN4 A;  2GSA A;  1OHW A;  1V2E A;  4OTL A;  2VMV A;  1TOE A;  4BQ0 A;  1X0M A;  3TQX A;  1LS3 A;  2O1B A;  3UE8 A;  2QB3 A;  3GZD A;  3N4R A;  1WYT A;  1E5F A;  3CQ4 A;  4WYD A;  2FQ6 A;  1BQA A;  2Z9V A;  1S0A A;  2BYJ A;  2QA3 A;  2VMY A;  5FT8 A;  2XBN A;  2D64 A;  4R8D A;  3ZRQ A;  1WKG A;  3GET A;  4EB7 A;  3WGC A;  2EZ1 A;  3PDX A;  4JE5 D;  3E2F A;  1P3W A;  1XEY A;  2HZP A;  4E1O A;  4WBT A;  3DU4 A;  1SFF A;  3AEJ A;  3HT4 A;  3JW9 A;  3QPG A;  3RCH A;  4ADD A;  3PAA A;  2ZSM A;  1AHE A;  3JWB A;  3WKS A;  1GBN A;  3F9T A;  3FVX A;  2Z1Z A;  4Q75 A;  3ZZK A;  1AY8 A;  1X28 A;  4U2H A;  1AIB A;  1B5P A;  4IYO B;  5G09 A;  2ZY4 A;  2O7C A;  3QHX A;  1IVR A;  1AHY A;  1CZC A;  3L8A A;  4A0F A;  4XJP A;  2X5F A;  1W3U A;  2OKK A;  2R2N A;  4W1W A;  4DGT A;  4DQ6 A;  3VP6 A;  1V2D A;  1SZK A;  2O0R A;  2AY4 A;  1JF9 A;  3N5M A;  2AY2 A;  1LK9 A;  3FFH A;  2YKU A;  5EIG A;  4ADC A;  2D5Y A;  3HVY A;  2CH2 A;  1BJO B;  2W8W A;  2FNU A;  3A8U X;  1VEF A;  2W7F A;  3BN1 A;  3KGX A;  1AX4 A;  4A0H A;  4J5U A;  3DC1 A;  4P3M A;  4AO4 A;  1LKC A;  2YOB A;  5M49 A;  1O61 A;  1ARG A;  4R2N A;  4WLH A;  1BW0 A;  5HDM A;  5HHY A;  1DGD A;  1EQB A;  1QJ5 A;  4BA4 A;  2VMR A;  1RVU A;  1MLY A;  1V2F A;  1DJU A;  3EIA A;  3KE3 A;  4ATQ A;  1B8G A;  1X29 A;  2X5D A;  2VGV A;  2BWN A;  4LW4 A;  1M0O A;  3CQ5 A;  3FZ8 A;  3P1T A;  1BJW A;  3FVU A;  4MQQ A;  2W8J A;  4ZSW A;  5G2P A;  4ITX A;  2OKJ A;  3BCB A;  1ASC A;  1QIR A;  1TAT A;  3EZS A;  2VMW A;  4F5I A;  3AOW A;  2BIE A;  3LV2 A;  3NYT A;  4JF1 A;  4W1V A;  4QGR A;  5G2Q A;  4A6U A;  1CQ7 A;  1M4N A;  4EFF A;  3MAF B;  1AIA A;  3HDO A;  3E77 A;  4WXG A;  3FFR A;  4ZLV A;  5EUE A;  3EI6 A;  4XAU A;  2ZP7 A;  3B46 A;  2GMS A;  4JF0 A;  3IHJ A;  1BJ4 A;  4XQ2 A;  4K2M A;  2ZY2 A;  4GDY A;  4OBU A;  3JTX A;  1W23 A;  2VMS A;  3LVK A;  3N0L A;  1Z7D A;  3PDB B;  2OGA A;  4MSO A;  4RLG A;  2AY3 A;  3TFU A;  5HXX A;  2VMP A;  4IXS A;  5LHA A;  2HOY A;  1RV3 A;  4B9B A;  3K7Y A;  2W7E A;  1ASM A;  1DTY A;  3FRK A;  2HOZ A;  4LC3 A;  3RCH B;  3VK3 A;  1C7G A;  3DRD A;  2YHK A;  4ITG A;  3G0T A;  5M4D A;  4ADE A;  2BI2 A;  3AEN A;  1YOO A;  5DJ1 A;  3R4T A;  1LW4 A;  2OAT A;  4ZDO A;  4EMY A;  1CQ6 A;  3QGU A;  1IJI A;  1PFF A;  2CJG A;  2HUI A;  2R5E A;  3VK2 A;  4K2I A;  3VK4 A;  4MKJ A;  1LC7 A;  1D7U A;  3NTJ A;  3USF A;  4XJM A;  2W7M A;  1GD9 A;  3ACZ A;  1GC4 A;  2V0Y A;  1ARS A;  4Q31 A;  4GE9 A;  4LNM A;  4JE5 A;  3N4X A;  4WYG A;  2E54 A;  1O4S A;  1ARI A;  1BT4 A;  1EJI A;  4CBS A;  2BYL A;  2VLF A;  5FT4 A;  3IF2 A;  1W7N A;  3FSL A;  3WY7 A;  4OC9 A;  1TOK A;  4K05 A;  4LNL A;  1QGN A;  3LVM A;  1FC4 A;  4A6R A;  4JEW A;  3N7N A;  1CJ0 A;  4RKD A;  2WK9 A;  1GEX A;  1IBJ A;  3VOM A;  1KMK A;  2ZSL A;  1LW5 A;  4GE4 A;  2HOX A;  3FCR A;  4RJ0 A;  2BIA A;  1AMS A;  3PA9 A;  3DZZ A;  1RVY A;  1E5E A;  1AJS A;  1UU1 A;  2FN6 A;  1IUG A;  2JGT A;  2Z67 A;  3B1C A;  2AAT A;  3AEM A;  3MAU A;  1AY5 A;  3P6K A;  3CBF A;  3GZD C;  5EIG B;  3HLM A;  1MDZ A;  5E3K A;  3FDD A;  3FTB A;  4LNJ A;  4JEZ A;  3BV0 A;  1D7S A;  1X2A A;  2DGL A;  2D63 A;  3MEB A;  2E7I A;  3II0 A;  2XH1 A;  2VMO A;  1AHF A;  3DYD A;  4XJL A;  2EYQ A;  4UHM A;  3BS8 A;  4O6Z A;  1LC5 A;  4PFF A;  3AEN B;  3AEJ C;  1GDE A;  1M7Y A;  3EI8 A;  1W7M A;  1DGE A;  4W1X A;  3G7Q A;  2Z9U A;  1YIY A;  2ZY5 A;  3PJ0 A;  3I16 A;  2BWO A;  4Y0I A;  1S09 A;  1M0Q A;  3KGW A;  1BJN A;  3E9K A;  4AOA A;  3AEO A;  4WP0 A;  2HUU A;  2JG2 A;  3HL2 A;  1AHG A;  2CJD A;  2EZ2 A;  2QMA A;  3ELE A;  1C7O A;  1B4X A;  3RBL A;  3K40 A;  4PFN A;  1KMJ A;  1AJS B;  2AY7 A;  4OT8 A;  5DB5 A;  1GC2 A;  4F5L A;  1I43 A;  2AY6 A;  3ATH A;  4MQR A;  2QSR A;  4H51 A;  5G4I A;  1PMM A;  3A9Z A;  3M5U A;  4ZWM A;  1SF2 A;  1TOG A;  4F5F A;  2OGE A;  1SVV A;  5FT6 A;  2BIG A;  4R5F A;  4JEV A;  1YNU A;  2JJH A;  2CFB A;  4N0W A;  2ZUK A;  4HF8 A;  4CVQ A;  4M2K A;  3LY1 A;  3DXV A;  3LVL B;  1TAR A;  4IY7 A;  3N75 A;  5EAA A;  2ORD A;  4JEY A;  1AIC A;  3UAK A;  2RFV A;  2GQN A;  3AV7 A;  4IXZ A;  1ASF A;  4HVK A;  4A0G A;  1WYT B;  3AEL A;  4BA5 A;  4IYO A;  4WB0 A;  2Z9X A;  3FQ8 A;  1SZU A;  1QIS A;  3B1E A;  3WGB A;  1PMO A;  1M32 A;  1QIT A;  2BI5 A;  3H7F A;  1CL2 A;  4ZSY A;  2D7Y A;  4KYO A;  2FKI A;  2G6W A;  2FM1 A;  3BCX A;  1ASE A;  2R5C A;  4UHO A;  3FVS A;  5LH9 A;  3NU8 A;  1UKJ A;  3VAX A;  1ASD A;  1S07 A;  3BCA A;  3H14 A;  1IAX A;  2YKV A;  1TOJ A;  4UQV A;  4AZJ A;  3EUC A;  4RIT A;  3NUB A;  3OKS A;  2GMU A;  3A2B A;  3A9Y A;  2Z20 A;  3KKI A;  4ZDL A;  3E2Z B;  3GJU A;  2W7K A;  3E2Z A;  3ZZJ A;  3DR7 A;  3MBB A;  2VGT A;  3PGY A;  4WLJ A;  4ADB A;  3G8M A;  4ISY A;  1YJY A;  4FFC A;  4KAM A;  2VGS A;  2CAN A;  3CQ6 A;  2C0R A;  3D6K A;  2DR1 A;  4A72 A;  1GC3 A;  1PG8 A;  2W7G A;  3W1I A;  4OYT A;  3H9X A;  3EI7 A;  2TPL A;  4Q76 A;  3ASA A;  1AHX A;  3MAF A;  1GEW A;  3FZ7 A;  3NU7 A;  4WB0 B;  4F4E A;  4I8A A;  4NOG A;  1IX7 A;  4RAE A;  1B9I A;  1AMA A;  4JEX A;  1ASN A;  1WYV B;  2W7I A;  5DJ9 A;  3F6T A;  1DFO A;  3W1J A;  2V1P A;  1AJR A;  2VLH A;  4F5H A;  9AAT A;  1KL2 A;  2X8U A;  3E6G A;  4A00 A;  1I41 A;  4W8I A;  4Y0D A;  4DBC A;  3ZRP A;  4BHD A;  5TF5 A;  1YIZ A;  2WKA A;  3LWS A;  3Q8N A;  1OAT A;  1J32 A;  1AKA A;  1ASA A;  3MKJ A;  3QI6 A;  2W7J A;  1DJ9 A;  1UU0 A;  1AY4 A;  1D2F A;  4IW7 A;  2AEV A;  2DOU A;  2G7J A;  3JZL A;  3NDN A;  1D7V A;  2PB0 A;  4KXK A;  2HOR A;  4GSA A;  3R9A A;  5I92 A;  1AMQ A;  1CZE A;  3EIB A;  3K28 A;  3PD6 B;  3CAI A;  5DX5 A;  2VMU A;  4Y0H A;  3PIU A;  5FT5 A;  5C6U A;  4LW2 A;  4MQP A;  5AX8 A;  4WYA A;  2C44 A;  1WYU A;  2EPJ A;  1N2T A;  1EG5 A;  1GEY A;  3BB8 A;  3MC6 A;  1MLZ A;  1ZC9 A;  2VMT A;  1G4V A;  2A1V A;  1AKB A;  2VIA A;  1LC8 A;  1TAS A;  1ECX A;  2CJH A;  2DKJ A;  2FNI A;  3BWN A;  3GBX A;  2VMQ A;  1T3I A;  4GEB A;  5IWQ A;  3UWC A;  1CQ8 A;  1G7W A;  3AEM C;  1N8P A;  3FQA A;  4ZM3 A;  2Z9W A;  2W7D A;  4WYF A;  3NUI A;  1ORD A;  4XEW A;  2DGM A;  8AAT A;  2AEU A;  1FG7 A;  2VGU A;  3T32 A;  2VGZ A;  1FG3 A;  1ZOD A;  2C81 A;  3NX3 A;  4AZK A;  1QJ3 A;  2AY5 A;  3L44 A;  3GWP A;  2AY8 A;  3A9X A;  1AKC A;  2QBT A;  1MAP A;  4RKC A;  1H1C A;  1YJS A;  3QBO A;  1I48 A;  4ATP A;  3PPL A;  4N0B A;  3EI5 A;  4U1T A;  3FKD A;  4A6T A;  2EGY A;  2BI1 A;  1IX6 A;  2PO3 A;  2W7H A;  4F5J A;  1C0N A;  3RBF A;  3HQT A;  2YCT A;  1W7L A;  3ELP A;  3RQ1 A;  3FQ7 A;  2CIN A;  2YCN A;  2F8J A;  5EUN A;  5EFS A;  1BQD A;  4CBR A;  4FL0 A;  2CH1 A;  2AY9 A;  2VI8 A;  2W8V A;  4CXQ A;  4H63 Q;  4CXR A;  2BHX A;  2R5C B;  1AAW A;  2YCP A;  3JWA A;  3W1H A;  4F5K A;  1M0N A;  3HMU A;  3MAD A;  1RV4 A;  3ASB A;  2BKW A;  2VMN A;  4MY5 A;  2FYF A;  2YRI A;  2VI9 A;  1D7R A;  2EH6 A;  4AO9 A;  4MGR A;  4WXB A;  4OBV A;  1S06 A;  2W8T A;  1TPL A;  1DKA A;  2Z61 A;  2HUF A;  1J04 A;  4J8L A;  2DKB A;  1N31 A;  2AY1 A;  2CTZ A;  1U08 A;  2CB1 A;  4M2M A;  3PDB A;  1O69 A;  4MKK A;  2BI3 A;  1MAQ A;  5BJ3 A;  3DXW A;  2GB3 A;  5D95 A;  1G7X A;  1Z3Z A;  4L0O A;  3ZRR A;  3B1D A;  4TMR A;  5EQC A;  2VYC A;  1C7N A;  2D66 A;  2JJF A;  4W5K A;  2D7Z A;  2HP1 A;  3OP7 A;  2YKX A;  5F9S A;  3AEP A;  3ECD A;  1OXO A;  5F8V A;  1XI9 A;  5KTB A;  2D61 A;  3I5T A;  3NNK A;  2X3L A;  2ZC0 A;  2VIB A;  3DOD A;  1G4X A;  3QM2 A;  3NYS A;  1ASG A;  2PB2 A;  2R0T A;  4RM1 A;  3RUY A;  3EZ1 A;  1IAY A;  3WCN A;  2CST A;  4PIW A;  1OHY A;  2HP2 A;  4ZM4 A;  2JIS A;  1IX8 A;  1GC0 A;  3E2Y A;  2Z1Y A;  2VGW A;  4K2B A;  5EAV A;  5G4J A;  2CY8 A;  1OXP A;  5EUD A;  5D5S A;  3B8X A;  4WYE A;  1MDX A;  3ISL A;  3BWN C;  3WX9 A;  3JU7 A;  7AAT A;  1YAA A;  4B98 A;  1MDO A;  1ASB A;  1ELQ A;  2Q7W A;  4ZAS A;  2BWP A;  1BKG A;  2JJG A;  2NMP A;  2E7U A;  3WLX A;  1B9H A;  4RJY A;  4Q6R A;  3QN6 A;  1WYU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...