1CQ7A

Aspartate aminotransferase (e.c. 2.6.1.1) complexed with c5-pyridoxal-5p-phosphate
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Free energy requirement for domain movement of an enzyme
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 132
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1999-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1cq7A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1cq7A01
1W3UA 1ARTA 2G6WA 4KXKA 3AATA 1ASGA 1AMSA 3GETA 3HT4A 4O6ZA 3RCHA 1AIAA 2DGMA 3ZZJA 1U08A 3E6GA 3N0LA 3BCBA 4J5UA 3B1DA 1WSTA 2X3LA 1BT4A 2GSAA 3FQ8A 2BYJA 3G7QA 4JF0A 4WYAA 3F6TA 3NDNA 4A0FA 1AMAA 3WKRA 1ASCA 2D7YA 3MEBA 4WYEA 4Y0DA 3RQ1A 4XEWA 1C9CA 2W8VA 1ASMA 1SPAA 1WKGA 3AEMA 3QN6A 4GRXA 3H7FA 1E5EA 1V72A 2YKVA 4IXZA 3FFHA 4AO4A 4A0RA 2BHXA 1AHEA 4ZSYA 2C81A 4JEWA 1QJ3A 3PIUA 2EO5A 1BW0A 4XJLA 1TATA 1TOEA 3VK3A 2PO3A 4PFFA 5M4BA 3ZRPA 2Z67A 2HP2A 2OKKA 4DBCA 2AY3A 4JEVA 4M2MA 3CQ5A 3E9KA 3PDBA 1FC4A 3LVLB 4TMRA 5FT4A 1GEWA 1BS0A 1CZEA 2W8JA 4I8AA 4XQ2A 1B4XA 1H0CA 2CJHA 3BN1A 1N8PA 1TOJA 3K7YA 4Q6RA 4WLHA 5D95A 1I29A 3A9XA 3AEPA 4W91A 2E7UA 2ZY5A 3PAAA 2HOXA 2W8UA 1Z3ZA 3FQ7A 4U2HA 2D7ZA 2DKBA 2W7GA 3EI9A 4GE7A 1N2TA 1V2DA 3ELPA 2E7JA 4WYDA 1UU2A 2VMNA 1CL2A 4A0GA 2NMPA 2BWPA 4BMKA 3PJ0A 1ELUA 1IX7A 3DR7A 3QM2A 1AKCA 4R2NA 1B8GA 3ECDA 4WP0A 4Q31A 3CAIA 3VK4A 3GSBA 3MADA 1JS6A 1S07A 1GC0A 2AATA 4HF8A 3HBXA 3AEJA 3QHXA 3COGA 2W8WA 4GDYA 4ZWVA 5C6UA 1IX8A 5F9SA 2BWOA 5FT8A 2D64A 1N31A 3TFTA 3IHJA 2D63A 1LK9A 3AENA 1AX4A 4UHOA 3HMUA 4R8DA 1YJSA 2QLRA 2VGWA 1E5FA 4H51A 1PMMA 1KKPA 3I4JA 5E5IA 3E2ZB 1UKJA 2Q7WA 4TV7A 1MAPA 2ZP7A 3ATHA 4BA5A 2WK9A 3WCNA 1YIYA 1GC3A 1JS3A 1D7VA 1ECXA 1AHYA 1I43A 2AY7A 5HXXA 1YJZA 1VJOA 2JJGA 4UQVA 2ZJGA 1ASBA 3PGYA 4RITA 1ELQA 3R9AA 4BA4A 1S0AA 4M2KA 2R5CB 4IXOA 3ZRRA 2VGVA 1ASFA 1AAWA 2AY4A 2EPJA 2AY6A 2Z9XA 1WYTB 2DGKA 2O7CA 4E77A 3DR4A 3I5TA 3II0A 3JWAA 4W1WA 5D5SA 4E1OA 5LH9A 1GC2A 2ZSMA 2VMUA 2AY8A 3W1JA 4PIWA 3E2YA 2ORDA 2W7HA 3RUYA 5M49A 1TPLA 2Z61A 1BJNA 3PA9A 1Z7DA 2DGLA 3K28A 5EAVA 1MDOA 4EFFA 2VGZA 3NYUA 1AJRA 2WK7A 2YOBA 3B46A 5DB5A 3KKIA 1MLYA 2XBNA 4P7YA 3A8UX 3TQXA 3QPGA 1G7XA 3AELA 4HVKA 4UHNA 1KMJA 3DODA 1C4KA 1AY4A 1KL1A 3GWPA 1TARA 2Z1ZA 3WY7A 1IX6A 4XJMA 4MKJA 5JAYA 1AJSB 2FNIA 2CFBA 1AY8A 1LC7A 4ZSWA 3FZ6A 3NYSA 4CXQA 3FVXA 1WYVA 2QBTA 2AY9A 1ASEA 3ACZA 4Y0HA 4RIZA 5EIGB 5E3KA 3NTJA 2GB3A 2JJHA 1W7LA 2D65A 5DJ1A 3EI7A 4A72A 4RJ0A 4WYFA 2VMRA 2AY5A 1GD9A 2VI9A 1ASLA 1AMQA 4AZJA 1CJ0A 4MQRA 2CY8A 4N0WA 1J32A 1SFFA 1BKGA 3OKSA 2PB0A 1SZSA 1G7WA 2QA3A 3MBBA 4LNMA 1VP4A 1BJOB 5G2PA 3BWOA 3CQ4A 3MAFA 3KGXA 5G09A 4FL0A 2V1PA 2FM1A 2W7EA 1S09A 2WK8A 3NU8A 1OHYA 3WX9A 2BI9A 4IYOA 1D2FA 4NOGA 2ZY3A 2AY2A 1KMKA 3P6KA 1O61A 2AEUA 3A2BA 3AEOA 2QB2A 3IF2A 2JJEA 3ELEA 4F5MA 4WB0B 4ADEA 3E77A 4ZDPA 4IXSA 2VMTA 4R5ZA 2W7JA 3MAUA 2BIGA 2EZ2A 3PD6B 1AICA 1DFOA 3B8XA 5TF5A 3TATA 2ZY4A 2W7KA 3GZCA 4E3QA 2YRIA 2BIAA 4WXBA 1H1CA 1T3IA 2HUFA 1G4XA 4B9BA 4F5GA 1MGVA 5HDMA 4ATQA 3MC6A 1YAAA 4IW7A 1GCKA 3BB8A 2YCTA 3EZSA 4LW2A 4PFNA 3UWCA 3LVJA 5G2QA 1M32A 2X5DA 1ASDA 3LG0A 1AJSA 3GZDC 4W1XA 3JWBA 4BHDA 4ZWMA 3FVSA 5DX5A 1CS1A 1DJEA 2Z9WA 4P3MA 4JEZA 1AHXA 1KL2A 1X29A 2HORA 3Q8NA 3NUIA 1D7UA 1YIZA 1B9HA 1TOGA 2VMPA 4ZLVA 1AKBA 5M4DA 5K8BA 1IVRA 2E54A 3DC1A 1ORDA 3TFUA 1CZCA 2VGUA 2PB2A 4WYCA 1EJIA 1DJ9A 2QMAA 2R5EA 2C0RA 4WLJA 3AOWA 4XJOA 3WKSA 4A00A 1M7YA 1M0QA 1I48A 2ZYJA 3EZ1A 3QBOA 1PFFA 2BI5A 1KKJA 2CINA 4RJYA 2W7LA 1FG7A 5EAAA 2V0YA 4UHMA 3VK2A 4JEYA 3ISLA 3EI5A 1IJIA 3P1TA 4AOAA 4FFCA 3GR9A 5FT6A 3TCMA 4DGTA 3LY1A 4LNLA 2BI3A 1QGNA 2GMUA 3FTBA 3H14A 3FZ8A 1P3WA 1S06A 2VGSA 2HOZA 1M4NA 2R2NA 4QGRA 4RM1A 1YOOA 1OHWA 3BV0A 3LVKA 3RBFA 4F4EA 3F0HA 3GZDA 3NU7A 1X2AA 3LV2A 3NNKA 4OBUA 2AY1A 3NX3A 1MDXA 2ZC0A 2TPLA 2FQ6A 4MSOA 2YRRA 1LW4A 4JF1A 7AATA 3RBLA 2VMOA 1WYUB 3ZRQA 3WZFA 4XJPA 4ADCA 2CTZA 2JISA 3DXWA 3BWNC 1OHVA 4J8LA 3FSLA 1TASA 1MAQA 1V2FA 3T32A 1M0NA 1MDZA 1C0NA 4AO9A 2Z9UA 1AAMA 4OTLA 3EIBA 3LWSA 2X5FA 5M46A 3RCHB 4F5HA 2VMXA 3HVYA 1RVYA 1YNUA 1AKAA 3QI6A 3FD0A 5AX8A 2ZUKA 4JE5A 3A9ZA 4TN4A 4RAEA 4JEXA 3NYTA 3FDDA 2HOYA 3W1HA 1GEXA 5I92A 4WXGA 3FQAA 1CL1A 1LW5A 4MY5A 4K2BA 4EB5A 1M0PA 4R5FA 3JW9A 3FRKA 1GEYA 1M0OA 4RKCA 1PG8A 2W7MA 1OXPA 3KGWA 2VYCA 5G0AA 3E2ZA 3QGUA 1LS3A 5F8VA 4GE4A 1IUGA 3AEMC 2Z1YA 3WCOA 1B5OA 1OXOA 4OMAA 4A6UA 3PDBB 4WYGA 4LC3A 4ZM3A 4OT8A 1LC8A 2F8JA 2CJGA 3BS8A 1C7GA 2C7TA 3VP6A 2D61A 1AHGA 1UU1A 4K2MA 1DJUA 3DXVA 4E3RA 2DOUA 3B1EA 2YCPA 3FDBA 5J8QA 4GSAA 1G4VA 4U1TA 3VOMA 2R5CA 1EQBA 4MGRA 2VIAA 4ZAHA 2VMQA 5EUDA 2QB3A 3EUCA 4ITXA 4L0OA 5HHYA 1WYTA 2ZY2A 3USFA 2CH1A 3DYDA 4OCAA 1CQ7A 1W23A 4AZKA 1M6SA 1VEFA 2AEVA 4F5JA 3ASBA 1RV4A 1GBNA 1TOIA 2WKAA 1ARSA 3FFRA 3FKDA 3KE3A 3L8AA 1Y4IA 3HDOA 4ZDOA 4RKDA 4MQPA 3AOVA 1CQ6A 4F5FA 3FZ7A 1AIBA 4N0BA 1JF9A 2HZPA 2EH6A 4EB7A 4UOYA 1J04A 2EZ1A 2YCNA 1BQAA 1O69A 3AENB 1FG3A 1SVVA 4Q75A 1JG8A 2Z20A 2DR1A 1W7MA 1D7SA 2HUUA 4DQ6A 3AEJC 1XEYA 1C7OA 4W1VA 2CSTA 2YKUA 4ZASA 1GDEA 4WD2A 4M2JA 5BJ4A 2VMSA 3N75A 4A0HA 5LHAA 1QISA 3A9YA 5EIGA 5G4IA 4CVQA 2CJDA 2VMYA 4OBVA 2YKXA 3UAKA 3GBXA 1EG5A 3OP7A 1X28A 2HUIA 5G4JA 4W8IA 3BCXA 1AHFA 1RVUA 1X0MA 2VMZA 3ASAA 1ARHA 1IAYA 1SF2A 2DKJA 4IX8A 2X8UA 2OGEA 1QZ9A 1BJOA 2BIEA 3EI6A 2BYLA 1V2EA 2JGTA 3WGCA 1S08A 2HP1A 1BJ4A 1W7NA 1BQDA 3FCRA 2W7FA 2BKWA 2O1BA 2YHKA 4KAMA 3HLMA 1UU0A 2BI2A 2GMSA 3NUBA 2FNUA 3M5UA 2OKJA 1I41A 3EIAA 3F9TA 3L44A 1DGDA 4ZDLA 4LW4A 4WB0A 4ATPA 4CXRA 4EMYA 3AV7A 4ISYA 1SZUA 4PVFA 3HL2A 5EUEA 2VGTA 4ADBA 3D6KA 2FN6A 1PMOA 2W7DA 3N5MA 1QIRA 3FVUA 4WXFA 3VAXA 3G8MA 2RFVA 3PD6A 3CQ6A 1D7RA 2VLFA 4LNJA 2FYFA 4GEBA 2C44A 4BQ0A 1XI9A 1WKHA 1WYVB 4F5IA 1B9IA 1ZODA 2JJFA 1LKCA 3DRDA 1BJWA 1O4SA 1DTYA 2VLHA 2D5YA 1GC4A 2ZSLA 3G0TA 2CANA 3W1IA 1OATA 2D66A 1MLZA 2BWNA 3MAFB 3RI6A 3CBFA 1ASAA 2VMWA 4IYOB 2Z9VA 4IY7A 3K40A 5DJ9A 2GQNA 2OQXA 1SZKA 1TOKA 1ZC9A 1YJYA 3WLXA 2E7IA 4ADDA 3GJUA 3MKJA 2CH2A 5E4ZA 4ITGA 3DU4A 4JE5D 3HQTA 3I16A 4WBTA 1QJ5A 4MKKA 9AATA 1AY5A 3JTXA 1DKAA 4ZM4A 4A6RA 4Q76A 5IWQA 1ARGA 4EU1A 4GE9A 4Y0IA 1ARIA 3PPLA 2OATA 2YKYA 2BI1A 5EFSA 1CQ8A 4W5KA 5FT5A 4MQQA 5EQCA 1ZOBA 3B1CA 5BJ3A 3UE8A 2W7IA 4CBRA 4F5LA 1C7NA 2VIBA 4A6TA 8AATA 4KYOA 3BC8A 4AH3A 4F5KA 1QITA 2W8TA 3MC6C 2CB1A 1ASNA 1DGEA 3JZLA 3BWNA 3PDXA 1IBJA 5EUNA 2JG2A 2OGAA 3E2FA 4OC9A 2EGYA 2XH1A 3EI8A 3NRAA 4RLGA 4OYTA 1WYUA 3ZZKA 2O0RA 4B98A 3JU7A 2VMVA 2VI8A 1RV3A 4K2IA 4XK1A 2R0TA 1O62A 4CBSA 3BCAA 4XAUA 3WGBA 1AMRA 1IAXA 3LVMA 3R4TA 1B5PA 1LC5A 3DZZA
chains in the Genus database with same CATH superfamily
1W3UA 1ARTA 2G6WA 4KXKA 3AATA 1ASGA 1AMSA 3GETA 3HT4A 4O6ZA 3RCHA 1AIAA 2DGMA 3ZZJA 1U08A 3E6GA 3N0LA 3BCBA 4J5UA 3B1DA 1WSTA 2X3LA 1BT4A 2GSAA 3FQ8A 2BYJA 3G7QA 4JF0A 4WYAA 3F6TA 3NDNA 4A0FA 1AMAA 3WKRA 1ASCA 2D7YA 3MEBA 4WYEA 4Y0DA 3RQ1A 4XEWA 1C9CA 2W8VA 1ASMA 1SPAA 1WKGA 3AEMA 3QN6A 4GRXA 3H7FA 1E5EA 1V72A 2YKVA 4IXZA 3FFHA 4AO4A 4A0RA 2BHXA 1AHEA 4ZSYA 2C81A 4JEWA 1QJ3A 3PIUA 2EO5A 1BW0A 4XJLA 1TATA 1TOEA 3VK3A 2PO3A 4PFFA 5M4BA 3ZRPA 2Z67A 2HP2A 2OKKA 4DBCA 2AY3A 4JEVA 4M2MA 3CQ5A 3E9KA 3PDBA 1FC4A 3LVLB 4TMRA 5FT4A 1GEWA 1BS0A 1CZEA 2W8JA 4I8AA 4XQ2A 1B4XA 1H0CA 2CJHA 3BN1A 1N8PA 1TOJA 3K7YA 4Q6RA 4WLHA 5D95A 1I29A 3A9XA 3AEPA 4W91A 2E7UA 2ZY5A 3PAAA 2HOXA 2W8UA 1Z3ZA 3FQ7A 4U2HA 2D7ZA 2DKBA 2W7GA 3EI9A 4GE7A 1N2TA 1V2DA 3ELPA 2E7JA 4WYDA 1UU2A 2VMNA 1CL2A 4A0GA 2WB6A 2NMPA 2BWPA 4BMKA 3PJ0A 1ELUA 1IX7A 3DR7A 3QM2A 1AKCA 4R2NA 1B8GA 3ECDA 4WP0A 4Q31A 3CAIA 3VK4A 3GSBA 3MADA 1JS6A 1S07A 1GC0A 2AATA 4HF8A 3HBXA 2G7JA 3AEJA 3QHXA 3COGA 2W8WA 4GDYA 4ZWVA 5C6UA 1IX8A 2EYQA 5F9SA 2BWOA 5FT8A 2D64A 1N31A 3TFTA 3IHJA 2D63A 1LK9A 3AENA 1AX4A 4UHOA 3HMUA 4R8DA 1YJSA 2QLRA 2VGWA 1E5FA 4H51A 1PMMA 1KKPA 3I4JA 5E5IA 3E2ZB 1UKJA 2Q7WA 4TV7A 1MAPA 2ZP7A 3ATHA 4BA5A 2WK9A 3WCNA 1YIYA 1GC3A 1JS3A 1D7VA 1ECXA 1AHYA 1I43A 2AY7A 5HXXA 1YJZA 1VJOA 2JJGA 4UQVA 2ZJGA 1ASBA 3PGYA 4RITA 1ELQA 3R9AA 4BA4A 1S0AA 4M2KA 2R5CB 4IXOA 3ZRRA 2VGVA 1ASFA 1AAWA 2AY4A 2EPJA 2AY6A 2Z9XA 1WYTB 2DGKA 2O7CA 4E77A 3DR4A 3I5TA 3II0A 3JWAA 4W1WA 5D5SA 4E1OA 5LH9A 1GC2A 1KAFA 2ZSMA 2VMUA 2AY8A 3W1JA 4PIWA 3E2YA 2ORDA 2W7HA 3RUYA 3H9XA 5M49A 1TPLA 2Z61A 1BJNA 3PA9A 1Z7DA 2DGLA 3K28A 5EAVA 1MDOA 4EFFA 2VGZA 3NYUA 1AJRA 2WK7A 2YOBA 3B46A 5DB5A 3KKIA 1MLYA 2XBNA 4P7YA 3A8UX 3TQXA 3QPGA 1G7XA 3AELA 4HVKA 4UHNA 1KMJA 3DODA 1C4KA 1AY4A 1KL1A 3GWPA 1TARA 2Z1ZA 3WY7A 1IX6A 4XJMA 4MKJA 5JAYA 1AJSB 2FNIA 2CFBA 1AY8A 1LC7A 4ZSWA 3FZ6A 3NYSA 4CXQA 3FVXA 1WYVA 2QBTA 2AY9A 1ASEA 3ACZA 4Y0HA 4RIZA 5EIGB 5E3KA 3NTJA 2GB3A 2JJHA 1W7LA 2D65A 5DJ1A 3EI7A 4A72A 4RJ0A 4WYFA 2VMRA 2AY5A 1GD9A 2VI9A 1ASLA 1AMQA 4AZJA 1CJ0A 4MQRA 2CY8A 4N0WA 1J32A 1SFFA 1BKGA 3OKSA 2PB0A 1SZSA 1G7WA 2QA3A 3MBBA 4LNMA 1VP4A 1BJOB 5G2PA 3BWOA 3CQ4A 3MAFA 3KGXA 5G09A 4FL0A 2V1PA 2FM1A 2W7EA 1S09A 2WK8A 3NU8A 1OHYA 3WX9A 2QSRA 2BI9A 4IYOA 1D2FA 4NOGA 2ZY3A 2AY2A 1KMKA 3P6KA 1O61A 2AEUA 3A2BA 3AEOA 2QB2A 5KTBA 3IF2A 2JJEA 3ELEA 4F5MA 4WB0B 4ADEA 3E77A 4ZDPA 4IXSA 2VMTA 4R5ZA 2W7JA 3MAUA 2BIGA 2EZ2A 3PD6B 1AICA 1DFOA 3B8XA 5TF5A 3TATA 2ZY4A 2W7KA 3GZCA 4E3QA 2YRIA 2BIAA 4WXBA 1H1CA 1T3IA 2HUFA 1G4XA 4B9BA 4F5GA 1MGVA 5HDMA 4ATQA 3MC6A 1YAAA 4IW7A 1GCKA 3BB8A 2YCTA 3EZSA 4LW2A 4PFNA 3UWCA 3LVJA 5G2QA 1M32A 2X5DA 1ASDA 3LG0A 1AJSA 3GZDC 4W1XA 3JWBA 4BHDA 4ZWMA 3FVSA 5DX5A 1CS1A 1DJEA 2Z9WA 4P3MA 4JEZA 1AHXA 1KL2A 1X29A 2HORA 3Q8NA 3NUIA 1D7UA 1YIZA 1B9HA 1TOGA 2VMPA 4ZLVA 1AKBA 5M4DA 5K8BA 1IVRA 2E54A 3DC1A 1ORDA 3TFUA 1CZCA 2VGUA 2PB2A 4WYCA 1EJIA 1DJ9A 2QMAA 2R5EA 2C0RA 4WLJA 3AOWA 4XJOA 3WKSA 4A00A 1M7YA 1M0QA 1I48A 2ZYJA 3EZ1A 3QBOA 1PFFA 2BI5A 1KKJA 2CINA 4RJYA 2W7LA 1FG7A 5EAAA 2V0YA 4UHMA 3VK2A 4JEYA 3ISLA 3EI5A 1IJIA 3P1TA 4AOAA 4FFCA 3GR9A 5FT6A 3TCMA 4DGTA 3LY1A 4LNLA 2BI3A 1QGNA 2GMUA 3FTBA 3H14A 3FZ8A 1P3WA 1S06A 2VGSA 2HOZA 1M4NA 2R2NA 4QGRA 4RM1A 1YOOA 1OHWA 3BV0A 3LVKA 3RBFA 4F4EA 3F0HA 3GZDA 3NU7A 1X2AA 3LV2A 3NNKA 4OBUA 2AY1A 3NX3A 1MDXA 2ZC0A 2TPLA 2FQ6A 4MSOA 2YRRA 1LW4A 4JF1A 7AATA 3RBLA 2VMOA 1WYUB 3ZRQA 3WZFA 4XJPA 4ADCA 2CTZA 2JISA 3DXWA 4H63Q 3BWNC 1OHVA 4J8LA 3FSLA 1TASA 1MAQA 1V2FA 3T32A 1M0NA 1MDZA 1C0NA 4AO9A 2Z9UA 1AAMA 4OTLA 3N4SA 3EIBA 3LWSA 2X5FA 5M46A 3RCHB 4F5HA 2VMXA 3HVYA 1RVYA 1YNUA 1AKAA 3QI6A 3FD0A 5AX8A 2ZUKA 4JE5A 3A9ZA 4TN4A 4RAEA 4JEXA 3NYTA 3FDDA 2HOYA 3W1HA 1GEXA 5I92A 4WXGA 3FQAA 1CL1A 1LW5A 4MY5A 4K2BA 4EB5A 1M0PA 4R5FA 3JW9A 3FRKA 1GEYA 1M0OA 4RKCA 1PG8A 2W7MA 3N4XA 1OXPA 3KGWA 2VYCA 5G0AA 3E2ZA 3QGUA 1LS3A 5F8VA 4GE4A 1IUGA 3AEMC 2Z1YA 3WCOA 1B5OA 1OXOA 4OMAA 4A6UA 3PDBB 4WYGA 4LC3A 4ZM3A 4OT8A 1LC8A 2F8JA 2CJGA 3BS8A 1C7GA 2C7TA 3VP6A 2D61A 1AHGA 1UU1A 4K2MA 1DJUA 3DXVA 4E3RA 2DOUA 3B1EA 2YCPA 3FDBA 5J8QA 4GSAA 1G4VA 4U1TA 3VOMA 2R5CA 1EQBA 4MGRA 2VIAA 4ZAHA 2VMQA 5EUDA 2QB3A 3EUCA 4ITXA 4L0OA 5HHYA 1WYTA 2ZY2A 3USFA 2CH1A 3DYDA 4OCAA 1CQ7A 1W23A 4AZKA 1M6SA 1VEFA 2AEVA 4F5JA 3ASBA 1RV4A 1GBNA 1TOIA 2WKAA 1ARSA 3FFRA 3FKDA 3KE3A 3L8AA 1Y4IA 3HDOA 4ZDOA 4RKDA 4MQPA 3AOVA 1CQ6A 4F5FA 3FZ7A 1AIBA 4N0BA 1JF9A 2HZPA 2EH6A 4EB7A 4UOYA 1J04A 2EZ1A 2YCNA 1BQAA 1O69A 3AENB 1FG3A 1SVVA 4Q75A 1JG8A 2Z20A 2DR1A 1W7MA 1D7SA 2HUUA 4DQ6A 3AEJC 1XEYA 1C7OA 4W1VA 2CSTA 2YKUA 4ZASA 1GDEA 4WD2A 4M2JA 5BJ4A 2VMSA 3N75A 4A0HA 5LHAA 1QISA 3A9YA 5EIGA 5G4IA 4CVQA 2CJDA 2VMYA 4OBVA 2YKXA 3UAKA 3GBXA 1EG5A 3OP7A 1X28A 2HUIA 5G4JA 4W8IA 3BCXA 1AHFA 1RVUA 1X0MA 2VMZA 3ASAA 1ARHA 1IAYA 1SF2A 2DKJA 4IX8A 2X8UA 2OGEA 1QZ9A 1BJOA 2BIEA 3EI6A 2BYLA 1V2EA 2JGTA 3WGCA 1S08A 2HP1A 1BJ4A 1W7NA 1BQDA 3FCRA 2W7FA 2BKWA 2O1BA 2YHKA 4KAMA 3HLMA 1UU0A 2BI2A 2GMSA 3NUBA 2FNUA 3M5UA 2OKJA 1I41A 3EIAA 3F9TA 3L44A 1DGDA 4ZDLA 4LW4A 4WB0A 4ATPA 4CXRA 4EMYA 3AV7A 4ISYA 1SZUA 4PVFA 3HL2A 5EUEA 2VGTA 4ADBA 3D6KA 2FN6A 1PMOA 2W7DA 3N5MA 1QIRA 3FVUA 4WXFA 3VAXA 3G8MA 2RFVA 3PD6A 3CQ6A 1D7RA 2VLFA 3N4RA 4LNJA 4K05A 2FYFA 4GEBA 2C44A 3N7NA 4BQ0A 1XI9A 1WKHA 1WYVB 4F5IA 1B9IA 1ZODA 2JJFA 1LKCA 3DRDA 1BJWA 1O4SA 1DTYA 2VLHA 2D5YA 1GC4A 2ZSLA 3G0TA 2CANA 3W1IA 1OATA 2D66A 1MLZA 2BWNA 3MAFB 3RI6A 3CBFA 1ASAA 2VMWA 4IYOB 2A1VA 2Z9VA 4IY7A 3K40A 5DJ9A 2GQNA 2OQXA 1SZKA 1TOKA 1ZC9A 1YJYA 2KFPA 3WLXA 2E7IA 4ADDA 3GJUA 3MKJA 2CH2A 5E4ZA 4ITGA 3DU4A 4JE5D 3HQTA 3I16A 4WBTA 1QJ5A 4MKKA 9AATA 1AY5A 3JTXA 1DKAA 4ZM4A 4A6RA 4Q76A 5IWQA 1ARGA 4EU1A 4GE9A 4Y0IA 1ARIA 3PPLA 2OATA 2YKYA 2BI1A 5EFSA 1CQ8A 4W5KA 5FT5A 4MQQA 5EQCA 1ZOBA 3B1CA 5BJ3A 3UE8A 2W7IA 4CBRA 4F5LA 1C7NA 2VIBA 4A6TA 8AATA 4KYOA 3BC8A 4AH3A 4F5KA 1QITA 2W8TA 3MC6C 2CB1A 1ASNA 1DGEA 3JZLA 3BWNA 3PDXA 1IBJA 5EUNA 2JG2A 2OGAA 2FKIA 3E2FA 4OC9A 2EGYA 2XH1A 3EI8A 3NRAA 4RLGA 4OYTA 1WYUA 3ZZKA 2O0RA 4B98A 3JU7A 2VMVA 2VI8A 1RV3A 4K2IA 4XK1A 2R0TA 1O62A 4CBSA 3BCAA 4XAUA 3WGBA 1AMRA 1IAXA 3LVMA 3R4TA 1B5PA 1LC5A 3DZZA
chains in the Genus database with same CATH topology
1W3UA 1ARTA 2G6WA 4KXKA 3AATA 1ASGA 1AMSA 3GETA 3HT4A 4O6ZA 3RCHA 1AIAA 2DGMA 3ZZJA 1U08A 3E6GA 3N0LA 3BCBA 4J5UA 3B1DA 1WSTA 2X3LA 1BT4A 2GSAA 3FQ8A 2BYJA 3G7QA 4JF0A 4WYAA 3F6TA 3NDNA 4A0FA 1AMAA 3WKRA 1ASCA 2D7YA 3MEBA 4WYEA 4Y0DA 3RQ1A 4XEWA 1C9CA 2W8VA 1ASMA 1SPAA 1WKGA 3AEMA 3QN6A 4GRXA 3H7FA 1E5EA 1V72A 2YKVA 4IXZA 3FFHA 4AO4A 4A0RA 2BHXA 1AHEA 4ZSYA 2C81A 4JEWA 1QJ3A 3PIUA 2EO5A 1BW0A 4XJLA 1TATA 1TOEA 3VK3A 2PO3A 4PFFA 5M4BA 3ZRPA 2Z67A 2HP2A 2OKKA 4DBCA 2AY3A 4JEVA 4M2MA 3CQ5A 3E9KA 3PDBA 1FC4A 3LVLB 4TMRA 5FT4A 1GEWA 1BS0A 1CZEA 2W8JA 4I8AA 4XQ2A 1B4XA 1H0CA 2CJHA 3BN1A 1N8PA 1TOJA 3K7YA 4Q6RA 4WLHA 5D95A 1I29A 3A9XA 3AEPA 4W91A 2E7UA 2ZY5A 3PAAA 2HOXA 2W8UA 1Z3ZA 3FQ7A 4U2HA 2D7ZA 2DKBA 2W7GA 3EI9A 4GE7A 1N2TA 1V2DA 3ELPA 2E7JA 4WYDA 1UU2A 2VMNA 1CL2A 4A0GA 2WB6A 2NMPA 2BWPA 4BMKA 3PJ0A 1ELUA 1IX7A 3DR7A 3QM2A 1AKCA 4R2NA 1B8GA 3ECDA 4WP0A 4Q31A 3CAIA 3VK4A 3GSBA 3MADA 1JS6A 1S07A 1GC0A 2AATA 4HF8A 3HBXA 2G7JA 3AEJA 3QHXA 3COGA 2W8WA 4GDYA 4ZWVA 5C6UA 1IX8A 2EYQA 5F9SA 2BWOA 5FT8A 2D64A 1N31A 3TFTA 3IHJA 2D63A 1LK9A 3AENA 1AX4A 4UHOA 3HMUA 4R8DA 1YJSA 2QLRA 2VGWA 1E5FA 4H51A 1PMMA 1KKPA 3I4JA 5E5IA 3E2ZB 1UKJA 2Q7WA 4TV7A 1MAPA 2ZP7A 3ATHA 4BA5A 2WK9A 3WCNA 1YIYA 1GC3A 1JS3A 1D7VA 1ECXA 1AHYA 1I43A 2AY7A 5HXXA 1YJZA 1VJOA 2JJGA 4UQVA 2ZJGA 1ASBA 3PGYA 4RITA 1ELQA 3R9AA 4BA4A 1S0AA 4M2KA 2R5CB 4IXOA 3ZRRA 2VGVA 1ASFA 1AAWA 2AY4A 2EPJA 2AY6A 2Z9XA 1WYTB 2DGKA 2O7CA 4E77A 3DR4A 3I5TA 3II0A 3JWAA 4W1WA 5D5SA 4E1OA 5LH9A 1GC2A 2ZSMA 2VMUA 2AY8A 3W1JA 4PIWA 3E2YA 2ORDA 2W7HA 3RUYA 3H9XA 5M49A 1TPLA 2Z61A 1BJNA 3PA9A 1Z7DA 2DGLA 3K28A 5EAVA 1MDOA 4EFFA 2VGZA 3NYUA 1AJRA 2WK7A 2YOBA 3B46A 5DB5A 3KKIA 1MLYA 2XBNA 4P7YA 3A8UX 3TQXA 3QPGA 1G7XA 3AELA 4HVKA 4UHNA 1KMJA 3DODA 1C4KA 1AY4A 1KL1A 3GWPA 1TARA 2Z1ZA 3WY7A 1IX6A 4XJMA 4MKJA 5JAYA 1AJSB 2FNIA 2CFBA 1AY8A 1LC7A 4ZSWA 3FZ6A 3NYSA 4CXQA 3FVXA 1WYVA 2QBTA 2AY9A 1ASEA 3ACZA 4Y0HA 4RIZA 5EIGB 5E3KA 3NTJA 2GB3A 2JJHA 1W7LA 2D65A 5DJ1A 3EI7A 4A72A 4RJ0A 4WYFA 2VMRA 2AY5A 1GD9A 2VI9A 1ASLA 1AMQA 4AZJA 1CJ0A 4MQRA 2CY8A 4N0WA 1J32A 1SFFA 1BKGA 3OKSA 2PB0A 1SZSA 1G7WA 2QA3A 3MBBA 4LNMA 1VP4A 1BJOB 5G2PA 3BWOA 3CQ4A 3MAFA 3KGXA 5G09A 4FL0A 2V1PA 2FM1A 2W7EA 1S09A 2WK8A 3NU8A 1OHYA 3WX9A 2QSRA 2BI9A 4IYOA 1D2FA 4NOGA 2ZY3A 2AY2A 1KMKA 3P6KA 1O61A 2AEUA 3A2BA 3AEOA 2QB2A 5KTBA 3IF2A 2JJEA 3ELEA 4F5MA 4WB0B 4ADEA 3E77A 4ZDPA 4IXSA 2VMTA 4R5ZA 2W7JA 3MAUA 2BIGA 2EZ2A 3PD6B 1AICA 1DFOA 3B8XA 5TF5A 3TATA 2ZY4A 2W7KA 3GZCA 4E3QA 2YRIA 2BIAA 4WXBA 1H1CA 1T3IA 2HUFA 1G4XA 4B9BA 4F5GA 1MGVA 5HDMA 4ATQA 3MC6A 1YAAA 4IW7A 1GCKA 3BB8A 2YCTA 3EZSA 4LW2A 4PFNA 3UWCA 3LVJA 5G2QA 1M32A 2X5DA 1ASDA 3LG0A 1AJSA 3GZDC 4W1XA 3JWBA 4BHDA 4ZWMA 3FVSA 5DX5A 1CS1A 1DJEA 2Z9WA 4P3MA 4JEZA 1AHXA 1KL2A 1X29A 2HORA 3Q8NA 3NUIA 1D7UA 1YIZA 1B9HA 1TOGA 2VMPA 4ZLVA 1AKBA 5M4DA 5K8BA 1IVRA 2E54A 3DC1A 1ORDA 3TFUA 1CZCA 2VGUA 2PB2A 4WYCA 1EJIA 1DJ9A 2QMAA 2R5EA 2C0RA 4WLJA 3AOWA 4XJOA 3WKSA 4A00A 1M7YA 1M0QA 1I48A 2ZYJA 3EZ1A 3QBOA 1PFFA 2BI5A 1KKJA 2CINA 4RJYA 2W7LA 1FG7A 5EAAA 2V0YA 4UHMA 3VK2A 4JEYA 3ISLA 3EI5A 1IJIA 3P1TA 4AOAA 4FFCA 3GR9A 5FT6A 3TCMA 4DGTA 3LY1A 4LNLA 2BI3A 1QGNA 2GMUA 3FTBA 3H14A 3FZ8A 1P3WA 1S06A 2VGSA 2HOZA 1M4NA 2R2NA 4QGRA 4RM1A 1YOOA 1OHWA 3BV0A 3LVKA 3RBFA 4F4EA 3F0HA 3GZDA 3NU7A 1X2AA 3LV2A 3NNKA 4OBUA 2AY1A 3NX3A 1MDXA 2ZC0A 2TPLA 2FQ6A 4MSOA 2YRRA 1LW4A 4JF1A 7AATA 3RBLA 2VMOA 1WYUB 3ZRQA 3WZFA 4XJPA 4ADCA 2CTZA 2JISA 3DXWA 4H63Q 3BWNC 1OHVA 4J8LA 3FSLA 1TASA 1MAQA 1V2FA 3T32A 1M0NA 1MDZA 1C0NA 4AO9A 2Z9UA 1AAMA 4OTLA 3N4SA 3EIBA 3LWSA 2X5FA 5M46A 3RCHB 4F5HA 2VMXA 3HVYA 1RVYA 1YNUA 1AKAA 3QI6A 3FD0A 5AX8A 2ZUKA 4JE5A 3A9ZA 4TN4A 4RAEA 4JEXA 3NYTA 3FDDA 2HOYA 3W1HA 1GEXA 5I92A 4WXGA 3FQAA 1CL1A 1LW5A 4MY5A 4K2BA 4EB5A 1M0PA 4R5FA 3JW9A 3FRKA 1GEYA 1M0OA 4RKCA 1PG8A 2W7MA 3N4XA 1OXPA 3KGWA 2VYCA 5G0AA 3E2ZA 3QGUA 1LS3A 5F8VA 4GE4A 1IUGA 3AEMC 2Z1YA 3WCOA 1B5OA 1OXOA 4OMAA 4A6UA 3PDBB 4WYGA 4LC3A 4ZM3A 4OT8A 1LC8A 2F8JA 2CJGA 3BS8A 1C7GA 2C7TA 3VP6A 2D61A 1AHGA 1UU1A 4K2MA 1DJUA 3DXVA 4E3RA 2DOUA 3B1EA 2YCPA 3FDBA 5J8QA 4GSAA 1G4VA 4U1TA 3VOMA 2R5CA 1EQBA 4MGRA 2VIAA 4ZAHA 2VMQA 5EUDA 2QB3A 3EUCA 4ITXA 4L0OA 5HHYA 1WYTA 2ZY2A 3USFA 2CH1A 3DYDA 4OCAA 1CQ7A 1W23A 4AZKA 1M6SA 1VEFA 2AEVA 4F5JA 3ASBA 1RV4A 1GBNA 1TOIA 2WKAA 1ARSA 3FFRA 3FKDA 3KE3A 3L8AA 1Y4IA 3HDOA 4ZDOA 4RKDA 4MQPA 3AOVA 1CQ6A 4F5FA 3FZ7A 1AIBA 4N0BA 1JF9A 2HZPA 2EH6A 4EB7A 4UOYA 1J04A 2EZ1A 2YCNA 1BQAA 1O69A 3AENB 1FG3A 1SVVA 4Q75A 1JG8A 2Z20A 2DR1A 1W7MA 1D7SA 2HUUA 4DQ6A 3AEJC 1XEYA 1C7OA 4W1VA 2CSTA 2YKUA 4ZASA 1GDEA 4WD2A 4M2JA 5BJ4A 2VMSA 3N75A 4A0HA 5LHAA 1QISA 3A9YA 5EIGA 5G4IA 4CVQA 2CJDA 2VMYA 4OBVA 2YKXA 3UAKA 3GBXA 1EG5A 3OP7A 1X28A 2HUIA 5G4JA 4W8IA 3BCXA 1AHFA 1RVUA 1X0MA 2VMZA 3ASAA 1ARHA 1IAYA 1SF2A 2DKJA 4IX8A 2X8UA 2OGEA 1QZ9A 1BJOA 2BIEA 3EI6A 2BYLA 1V2EA 2JGTA 3WGCA 1S08A 2HP1A 1BJ4A 1W7NA 1BQDA 3FCRA 2W7FA 2BKWA 2O1BA 2YHKA 4KAMA 3HLMA 1UU0A 2BI2A 2GMSA 3NUBA 2FNUA 3M5UA 2OKJA 1I41A 3EIAA 3F9TA 3L44A 1DGDA 4ZDLA 4LW4A 4WB0A 4ATPA 4CXRA 4EMYA 3AV7A 4ISYA 1SZUA 4PVFA 3HL2A 5EUEA 2VGTA 4ADBA 3D6KA 2FN6A 1PMOA 2W7DA 3N5MA 1QIRA 3FVUA 4WXFA 3VAXA 3G8MA 2RFVA 3PD6A 3CQ6A 1D7RA 2VLFA 3N4RA 4LNJA 4K05A 2FYFA 4GEBA 2C44A 3N7NA 4BQ0A 1XI9A 1WKHA 1WYVB 4F5IA 1B9IA 1ZODA 2JJFA 1LKCA 3DRDA 1BJWA 1O4SA 1DTYA 2VLHA 2D5YA 1GC4A 2ZSLA 3G0TA 2CANA 3W1IA 1OATA 2D66A 1MLZA 2BWNA 3MAFB 3RI6A 3CBFA 1ASAA 2VMWA 4IYOB 2A1VA 2Z9VA 4IY7A 3K40A 5DJ9A 2GQNA 2OQXA 1SZKA 1TOKA 1ZC9A 1YJYA 2KFPA 3WLXA 2E7IA 4ADDA 3GJUA 3MKJA 2CH2A 5E4ZA 4ITGA 3DU4A 4JE5D 3HQTA 3I16A 4WBTA 1QJ5A 4MKKA 9AATA 1AY5A 3JTXA 1DKAA 4ZM4A 4A6RA 4Q76A 5IWQA 1ARGA 4EU1A 4GE9A 4Y0IA 1ARIA 3PPLA 2OATA 2YKYA 2BI1A 5EFSA 1CQ8A 4W5KA 5FT5A 4MQQA 5EQCA 1ZOBA 3B1CA 5BJ3A 3UE8A 2W7IA 4CBRA 4F5LA 1C7NA 2VIBA 4A6TA 8AATA 4KYOA 3BC8A 4AH3A 4F5KA 1QITA 2W8TA 3MC6C 2CB1A 1ASNA 1DGEA 3JZLA 3BWNA 3PDXA 1IBJA 5EUNA 2JG2A 2OGAA 2FKIA 3E2FA 4OC9A 2EGYA 2XH1A 3EI8A 3NRAA 4RLGA 4OYTA 1WYUA 3ZZKA 2O0RA 4B98A 3JU7A 2VMVA 2VI8A 1RV3A 4K2IA 4XK1A 2R0TA 1O62A 4CBSA 3BCAA 4XAUA 3WGBA 1AMRA 1IAXA 3LVMA 3R4TA 1B5PA 1LC5A 3DZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3U A;  1ART A;  2G6W A;  4KXK A;  3AAT A;  1ASG A;  1AMS A;  3GET A;  3HT4 A;  4O6Z A;  3RCH A;  1AIA A;  2DGM A;  3ZZJ A;  1U08 A;  3E6G A;  3N0L A;  3BCB A;  4J5U A;  3B1D A;  1WST A;  2X3L A;  1BT4 A;  2GSA A;  3FQ8 A;  2BYJ A;  3G7Q A;  4JF0 A;  4WYA A;  3F6T A;  3NDN A;  4A0F A;  1AMA A;  3WKR A;  1ASC A;  2D7Y A;  3MEB A;  4WYE A;  4Y0D A;  3RQ1 A;  4XEW A;  1C9C A;  2W8V A;  1ASM A;  1SPA A;  1WKG A;  3AEM A;  3QN6 A;  4GRX A;  3H7F A;  1E5E A;  1V72 A;  2YKV A;  4IXZ A;  3FFH A;  4AO4 A;  4A0R A;  2BHX A;  1AHE A;  4ZSY A;  2C81 A;  4JEW A;  1QJ3 A;  3PIU A;  2EO5 A;  1BW0 A;  4XJL A;  1TAT A;  1TOE A;  3VK3 A;  2PO3 A;  4PFF A;  5M4B A;  3ZRP A;  2Z67 A;  2HP2 A;  2OKK A;  4DBC A;  2AY3 A;  4JEV A;  4M2M A;  3CQ5 A;  3E9K A;  3PDB A;  1FC4 A;  3LVL B;  4TMR A;  5FT4 A;  1GEW A;  1BS0 A;  1CZE A;  2W8J A;  4I8A A;  4XQ2 A;  1B4X A;  1H0C A;  2CJH A;  3BN1 A;  1N8P A;  1TOJ A;  3K7Y A;  4Q6R A;  4WLH A;  5D95 A;  1I29 A;  3A9X A;  3AEP A;  4W91 A;  2E7U A;  2ZY5 A;  3PAA A;  2HOX A;  2W8U A;  1Z3Z A;  3FQ7 A;  4U2H A;  2D7Z A;  2DKB A;  2W7G A;  3EI9 A;  4GE7 A;  1N2T A;  1V2D A;  3ELP A;  2E7J A;  4WYD A;  1UU2 A;  2VMN A;  1CL2 A;  4A0G A;  2NMP A;  2BWP A;  4BMK A;  3PJ0 A;  1ELU A;  1IX7 A;  3DR7 A;  3QM2 A;  1AKC A;  4R2N A;  1B8G A;  3ECD A;  4WP0 A;  4Q31 A;  3CAI A;  3VK4 A;  3GSB A;  3MAD A;  1JS6 A;  1S07 A;  1GC0 A;  2AAT A;  4HF8 A;  3HBX A;  3AEJ A;  3QHX A;  3COG A;  2W8W A;  4GDY A;  4ZWV A;  5C6U A;  1IX8 A;  5F9S A;  2BWO A;  5FT8 A;  2D64 A;  1N31 A;  3TFT A;  3IHJ A;  2D63 A;  1LK9 A;  3AEN A;  1AX4 A;  4UHO A;  3HMU A;  4R8D A;  1YJS A;  2QLR A;  2VGW A;  1E5F A;  4H51 A;  1PMM A;  1KKP A;  3I4J A;  5E5I A;  3E2Z B;  1UKJ A;  2Q7W A;  4TV7 A;  1MAP A;  2ZP7 A;  3ATH A;  4BA5 A;  2WK9 A;  3WCN A;  1YIY A;  1GC3 A;  1JS3 A;  1D7V A;  1ECX A;  1AHY A;  1I43 A;  2AY7 A;  5HXX A;  1YJZ A;  1VJO A;  2JJG A;  4UQV A;  2ZJG A;  1ASB A;  3PGY A;  4RIT A;  1ELQ A;  3R9A A;  4BA4 A;  1S0A A;  4M2K A;  2R5C B;  4IXO A;  3ZRR A;  2VGV A;  1ASF A;  1AAW A;  2AY4 A;  2EPJ A;  2AY6 A;  2Z9X A;  1WYT B;  2DGK A;  2O7C A;  4E77 A;  3DR4 A;  3I5T A;  3II0 A;  3JWA A;  4W1W A;  5D5S A;  4E1O A;  5LH9 A;  1GC2 A;  2ZSM A;  2VMU A;  2AY8 A;  3W1J A;  4PIW A;  3E2Y A;  2ORD A;  2W7H A;  3RUY A;  5M49 A;  1TPL A;  2Z61 A;  1BJN A;  3PA9 A;  1Z7D A;  2DGL A;  3K28 A;  5EAV A;  1MDO A;  4EFF A;  2VGZ A;  3NYU A;  1AJR A;  2WK7 A;  2YOB A;  3B46 A;  5DB5 A;  3KKI A;  1MLY A;  2XBN A;  4P7Y A;  3A8U X;  3TQX A;  3QPG A;  1G7X A;  3AEL A;  4HVK A;  4UHN A;  1KMJ A;  3DOD A;  1C4K A;  1AY4 A;  1KL1 A;  3GWP A;  1TAR A;  2Z1Z A;  3WY7 A;  1IX6 A;  4XJM A;  4MKJ A;  5JAY A;  1AJS B;  2FNI A;  2CFB A;  1AY8 A;  1LC7 A;  4ZSW A;  3FZ6 A;  3NYS A;  4CXQ A;  3FVX A;  1WYV A;  2QBT A;  2AY9 A;  1ASE A;  3ACZ A;  4Y0H A;  4RIZ A;  5EIG B;  5E3K A;  3NTJ A;  2GB3 A;  2JJH A;  1W7L A;  2D65 A;  5DJ1 A;  3EI7 A;  4A72 A;  4RJ0 A;  4WYF A;  2VMR A;  2AY5 A;  1GD9 A;  2VI9 A;  1ASL A;  1AMQ A;  4AZJ A;  1CJ0 A;  4MQR A;  2CY8 A;  4N0W A;  1J32 A;  1SFF A;  1BKG A;  3OKS A;  2PB0 A;  1SZS A;  1G7W A;  2QA3 A;  3MBB A;  4LNM A;  1VP4 A;  1BJO B;  5G2P A;  3BWO A;  3CQ4 A;  3MAF A;  3KGX A;  5G09 A;  4FL0 A;  2V1P A;  2FM1 A;  2W7E A;  1S09 A;  2WK8 A;  3NU8 A;  1OHY A;  3WX9 A;  2BI9 A;  4IYO A;  1D2F A;  4NOG A;  2ZY3 A;  2AY2 A;  1KMK A;  3P6K A;  1O61 A;  2AEU A;  3A2B A;  3AEO A;  2QB2 A;  3IF2 A;  2JJE A;  3ELE A;  4F5M A;  4WB0 B;  4ADE A;  3E77 A;  4ZDP A;  4IXS A;  2VMT A;  4R5Z A;  2W7J A;  3MAU A;  2BIG A;  2EZ2 A;  3PD6 B;  1AIC A;  1DFO A;  3B8X A;  5TF5 A;  3TAT A;  2ZY4 A;  2W7K A;  3GZC A;  4E3Q A;  2YRI A;  2BIA A;  4WXB A;  1H1C A;  1T3I A;  2HUF A;  1G4X A;  4B9B A;  4F5G A;  1MGV A;  5HDM A;  4ATQ A;  3MC6 A;  1YAA A;  4IW7 A;  1GCK A;  3BB8 A;  2YCT A;  3EZS A;  4LW2 A;  4PFN A;  3UWC A;  3LVJ A;  5G2Q A;  1M32 A;  2X5D A;  1ASD A;  3LG0 A;  1AJS A;  3GZD C;  4W1X A;  3JWB A;  4BHD A;  4ZWM A;  3FVS A;  5DX5 A;  1CS1 A;  1DJE A;  2Z9W A;  4P3M A;  4JEZ A;  1AHX A;  1KL2 A;  1X29 A;  2HOR A;  3Q8N A;  3NUI A;  1D7U A;  1YIZ A;  1B9H A;  1TOG A;  2VMP A;  4ZLV A;  1AKB A;  5M4D A;  5K8B A;  1IVR A;  2E54 A;  3DC1 A;  1ORD A;  3TFU A;  1CZC A;  2VGU A;  2PB2 A;  4WYC A;  1EJI A;  1DJ9 A;  2QMA A;  2R5E A;  2C0R A;  4WLJ A;  3AOW A;  4XJO A;  3WKS A;  4A00 A;  1M7Y A;  1M0Q A;  1I48 A;  2ZYJ A;  3EZ1 A;  3QBO A;  1PFF A;  2BI5 A;  1KKJ A;  2CIN A;  4RJY A;  2W7L A;  1FG7 A;  5EAA A;  2V0Y A;  4UHM A;  3VK2 A;  4JEY A;  3ISL A;  3EI5 A;  1IJI A;  3P1T A;  4AOA A;  4FFC A;  3GR9 A;  5FT6 A;  3TCM A;  4DGT A;  3LY1 A;  4LNL A;  2BI3 A;  1QGN A;  2GMU A;  3FTB A;  3H14 A;  3FZ8 A;  1P3W A;  1S06 A;  2VGS A;  2HOZ A;  1M4N A;  2R2N A;  4QGR A;  4RM1 A;  1YOO A;  1OHW A;  3BV0 A;  3LVK A;  3RBF A;  4F4E A;  3F0H A;  3GZD A;  3NU7 A;  1X2A A;  3LV2 A;  3NNK A;  4OBU A;  2AY1 A;  3NX3 A;  1MDX A;  2ZC0 A;  2TPL A;  2FQ6 A;  4MSO A;  2YRR A;  1LW4 A;  4JF1 A;  7AAT A;  3RBL A;  2VMO A;  1WYU B;  3ZRQ A;  3WZF A;  4XJP A;  4ADC A;  2CTZ A;  2JIS A;  3DXW A;  3BWN C;  1OHV A;  4J8L A;  3FSL A;  1TAS A;  1MAQ A;  1V2F A;  3T32 A;  1M0N A;  1MDZ A;  1C0N A;  4AO9 A;  2Z9U A;  1AAM A;  4OTL A;  3EIB A;  3LWS A;  2X5F A;  5M46 A;  3RCH B;  4F5H A;  2VMX A;  3HVY A;  1RVY A;  1YNU A;  1AKA A;  3QI6 A;  3FD0 A;  5AX8 A;  2ZUK A;  4JE5 A;  3A9Z A;  4TN4 A;  4RAE A;  4JEX A;  3NYT A;  3FDD A;  2HOY A;  3W1H A;  1GEX A;  5I92 A;  4WXG A;  3FQA A;  1CL1 A;  1LW5 A;  4MY5 A;  4K2B A;  4EB5 A;  1M0P A;  4R5F A;  3JW9 A;  3FRK A;  1GEY A;  1M0O A;  4RKC A;  1PG8 A;  2W7M A;  1OXP A;  3KGW A;  2VYC A;  5G0A A;  3E2Z A;  3QGU A;  1LS3 A;  5F8V A;  4GE4 A;  1IUG A;  3AEM C;  2Z1Y A;  3WCO A;  1B5O A;  1OXO A;  4OMA A;  4A6U A;  3PDB B;  4WYG A;  4LC3 A;  4ZM3 A;  4OT8 A;  1LC8 A;  2F8J A;  2CJG A;  3BS8 A;  1C7G A;  2C7T A;  3VP6 A;  2D61 A;  1AHG A;  1UU1 A;  4K2M A;  1DJU A;  3DXV A;  4E3R A;  2DOU A;  3B1E A;  2YCP A;  3FDB A;  5J8Q A;  4GSA A;  1G4V A;  4U1T A;  3VOM A;  2R5C A;  1EQB A;  4MGR A;  2VIA A;  4ZAH A;  2VMQ A;  5EUD A;  2QB3 A;  3EUC A;  4ITX A;  4L0O A;  5HHY A;  1WYT A;  2ZY2 A;  3USF A;  2CH1 A;  3DYD A;  4OCA A;  1CQ7 A;  1W23 A;  4AZK A;  1M6S A;  1VEF A;  2AEV A;  4F5J A;  3ASB A;  1RV4 A;  1GBN A;  1TOI A;  2WKA A;  1ARS A;  3FFR A;  3FKD A;  3KE3 A;  3L8A A;  1Y4I A;  3HDO A;  4ZDO A;  4RKD A;  4MQP A;  3AOV A;  1CQ6 A;  4F5F A;  3FZ7 A;  1AIB A;  4N0B A;  1JF9 A;  2HZP A;  2EH6 A;  4EB7 A;  4UOY A;  1J04 A;  2EZ1 A;  2YCN A;  1BQA A;  1O69 A;  3AEN B;  1FG3 A;  1SVV A;  4Q75 A;  1JG8 A;  2Z20 A;  2DR1 A;  1W7M A;  1D7S A;  2HUU A;  4DQ6 A;  3AEJ C;  1XEY A;  1C7O A;  4W1V A;  2CST A;  2YKU A;  4ZAS A;  1GDE A;  4WD2 A;  4M2J A;  5BJ4 A;  2VMS A;  3N75 A;  4A0H A;  5LHA A;  1QIS A;  3A9Y A;  5EIG A;  5G4I A;  4CVQ A;  2CJD A;  2VMY A;  4OBV A;  2YKX A;  3UAK A;  3GBX A;  1EG5 A;  3OP7 A;  1X28 A;  2HUI A;  5G4J A;  4W8I A;  3BCX A;  1AHF A;  1RVU A;  1X0M A;  2VMZ A;  3ASA A;  1ARH A;  1IAY A;  1SF2 A;  2DKJ A;  4IX8 A;  2X8U A;  2OGE A;  1QZ9 A;  1BJO A;  2BIE A;  3EI6 A;  2BYL A;  1V2E A;  2JGT A;  3WGC A;  1S08 A;  2HP1 A;  1BJ4 A;  1W7N A;  1BQD A;  3FCR A;  2W7F A;  2BKW A;  2O1B A;  2YHK A;  4KAM A;  3HLM A;  1UU0 A;  2BI2 A;  2GMS A;  3NUB A;  2FNU A;  3M5U A;  2OKJ A;  1I41 A;  3EIA A;  3F9T A;  3L44 A;  1DGD A;  4ZDL A;  4LW4 A;  4WB0 A;  4ATP A;  4CXR A;  4EMY A;  3AV7 A;  4ISY A;  1SZU A;  4PVF A;  3HL2 A;  5EUE A;  2VGT A;  4ADB A;  3D6K A;  2FN6 A;  1PMO A;  2W7D A;  3N5M A;  1QIR A;  3FVU A;  4WXF A;  3VAX A;  3G8M A;  2RFV A;  3PD6 A;  3CQ6 A;  1D7R A;  2VLF A;  4LNJ A;  2FYF A;  4GEB A;  2C44 A;  4BQ0 A;  1XI9 A;  1WKH A;  1WYV B;  4F5I A;  1B9I A;  1ZOD A;  2JJF A;  1LKC A;  3DRD A;  1BJW A;  1O4S A;  1DTY A;  2VLH A;  2D5Y A;  1GC4 A;  2ZSL A;  3G0T A;  2CAN A;  3W1I A;  1OAT A;  2D66 A;  1MLZ A;  2BWN A;  3MAF B;  3RI6 A;  3CBF A;  1ASA A;  2VMW A;  4IYO B;  2Z9V A;  4IY7 A;  3K40 A;  5DJ9 A;  2GQN A;  2OQX A;  1SZK A;  1TOK A;  1ZC9 A;  1YJY A;  3WLX A;  2E7I A;  4ADD A;  3GJU A;  3MKJ A;  2CH2 A;  5E4Z A;  4ITG A;  3DU4 A;  4JE5 D;  3HQT A;  3I16 A;  4WBT A;  1QJ5 A;  4MKK A;  9AAT A;  1AY5 A;  3JTX A;  1DKA A;  4ZM4 A;  4A6R A;  4Q76 A;  5IWQ A;  1ARG A;  4EU1 A;  4GE9 A;  4Y0I A;  1ARI A;  3PPL A;  2OAT A;  2YKY A;  2BI1 A;  5EFS A;  1CQ8 A;  4W5K A;  5FT5 A;  4MQQ A;  5EQC A;  1ZOB A;  3B1C A;  5BJ3 A;  3UE8 A;  2W7I A;  4CBR A;  4F5L A;  1C7N A;  2VIB A;  4A6T A;  8AAT A;  4KYO A;  3BC8 A;  4AH3 A;  4F5K A;  1QIT A;  2W8T A;  3MC6 C;  2CB1 A;  1ASN A;  1DGE A;  3JZL A;  3BWN A;  3PDX A;  1IBJ A;  5EUN A;  2JG2 A;  2OGA A;  3E2F A;  4OC9 A;  2EGY A;  2XH1 A;  3EI8 A;  3NRA A;  4RLG A;  4OYT A;  1WYU A;  3ZZK A;  2O0R A;  4B98 A;  3JU7 A;  2VMV A;  2VI8 A;  1RV3 A;  4K2I A;  4XK1 A;  2R0T A;  1O62 A;  4CBS A;  3BCA A;  4XAU A;  3WGB A;  1AMR A;  1IAX A;  3LVM A;  3R4T A;  1B5P A;  1LC5 A;  3DZZ A; 
#chains in the Genus database with same CATH topology
 1W3U A;  1ART A;  2G6W A;  4KXK A;  3AAT A;  1ASG A;  1AMS A;  3GET A;  3HT4 A;  4O6Z A;  3RCH A;  1AIA A;  2DGM A;  3ZZJ A;  1U08 A;  3E6G A;  3N0L A;  3BCB A;  4J5U A;  3B1D A;  1WST A;  2X3L A;  1BT4 A;  2GSA A;  3FQ8 A;  2BYJ A;  3G7Q A;  4JF0 A;  4WYA A;  3F6T A;  3NDN A;  4A0F A;  1AMA A;  3WKR A;  1ASC A;  2D7Y A;  3MEB A;  4WYE A;  4Y0D A;  3RQ1 A;  4XEW A;  1C9C A;  2W8V A;  1ASM A;  1SPA A;  1WKG A;  3AEM A;  3QN6 A;  4GRX A;  3H7F A;  1E5E A;  1V72 A;  2YKV A;  4IXZ A;  3FFH A;  4AO4 A;  4A0R A;  2BHX A;  1AHE A;  4ZSY A;  2C81 A;  4JEW A;  1QJ3 A;  3PIU A;  2EO5 A;  1BW0 A;  4XJL A;  1TAT A;  1TOE A;  3VK3 A;  2PO3 A;  4PFF A;  5M4B A;  3ZRP A;  2Z67 A;  2HP2 A;  2OKK A;  4DBC A;  2AY3 A;  4JEV A;  4M2M A;  3CQ5 A;  3E9K A;  3PDB A;  1FC4 A;  3LVL B;  4TMR A;  5FT4 A;  1GEW A;  1BS0 A;  1CZE A;  2W8J A;  4I8A A;  4XQ2 A;  1B4X A;  1H0C A;  2CJH A;  3BN1 A;  1N8P A;  1TOJ A;  3K7Y A;  4Q6R A;  4WLH A;  5D95 A;  1I29 A;  3A9X A;  3AEP A;  4W91 A;  2E7U A;  2ZY5 A;  3PAA A;  2HOX A;  2W8U A;  1Z3Z A;  3FQ7 A;  4U2H A;  2D7Z A;  2DKB A;  2W7G A;  3EI9 A;  4GE7 A;  1N2T A;  1V2D A;  3ELP A;  2E7J A;  4WYD A;  1UU2 A;  2VMN A;  1CL2 A;  4A0G A;  2WB6 A;  2NMP A;  2BWP A;  4BMK A;  3PJ0 A;  1ELU A;  1IX7 A;  3DR7 A;  3QM2 A;  1AKC A;  4R2N A;  1B8G A;  3ECD A;  4WP0 A;  4Q31 A;  3CAI A;  3VK4 A;  3GSB A;  3MAD A;  1JS6 A;  1S07 A;  1GC0 A;  2AAT A;  4HF8 A;  3HBX A;  2G7J A;  3AEJ A;  3QHX A;  3COG A;  2W8W A;  4GDY A;  4ZWV A;  5C6U A;  1IX8 A;  2EYQ A;  5F9S A;  2BWO A;  5FT8 A;  2D64 A;  1N31 A;  3TFT A;  3IHJ A;  2D63 A;  1LK9 A;  3AEN A;  1AX4 A;  4UHO A;  3HMU A;  4R8D A;  1YJS A;  2QLR A;  2VGW A;  1E5F A;  4H51 A;  1PMM A;  1KKP A;  3I4J A;  5E5I A;  3E2Z B;  1UKJ A;  2Q7W A;  4TV7 A;  1MAP A;  2ZP7 A;  3ATH A;  4BA5 A;  2WK9 A;  3WCN A;  1YIY A;  1GC3 A;  1JS3 A;  1D7V A;  1ECX A;  1AHY A;  1I43 A;  2AY7 A;  5HXX A;  1YJZ A;  1VJO A;  2JJG A;  4UQV A;  2ZJG A;  1ASB A;  3PGY A;  4RIT A;  1ELQ A;  3R9A A;  4BA4 A;  1S0A A;  4M2K A;  2R5C B;  4IXO A;  3ZRR A;  2VGV A;  1ASF A;  1AAW A;  2AY4 A;  2EPJ A;  2AY6 A;  2Z9X A;  1WYT B;  2DGK A;  2O7C A;  4E77 A;  3DR4 A;  3I5T A;  3II0 A;  3JWA A;  4W1W A;  5D5S A;  4E1O A;  5LH9 A;  1GC2 A;  1KAF A;  2ZSM A;  2VMU A;  2AY8 A;  3W1J A;  4PIW A;  3E2Y A;  2ORD A;  2W7H A;  3RUY A;  3H9X A;  5M49 A;  1TPL A;  2Z61 A;  1BJN A;  3PA9 A;  1Z7D A;  2DGL A;  3K28 A;  5EAV A;  1MDO A;  4EFF A;  2VGZ A;  3NYU A;  1AJR A;  2WK7 A;  2YOB A;  3B46 A;  5DB5 A;  3KKI A;  1MLY A;  2XBN A;  4P7Y A;  3A8U X;  3TQX A;  3QPG A;  1G7X A;  3AEL A;  4HVK A;  4UHN A;  1KMJ A;  3DOD A;  1C4K A;  1AY4 A;  1KL1 A;  3GWP A;  1TAR A;  2Z1Z A;  3WY7 A;  1IX6 A;  4XJM A;  4MKJ A;  5JAY A;  1AJS B;  2FNI A;  2CFB A;  1AY8 A;  1LC7 A;  4ZSW A;  3FZ6 A;  3NYS A;  4CXQ A;  3FVX A;  1WYV A;  2QBT A;  2AY9 A;  1ASE A;  3ACZ A;  4Y0H A;  4RIZ A;  5EIG B;  5E3K A;  3NTJ A;  2GB3 A;  2JJH A;  1W7L A;  2D65 A;  5DJ1 A;  3EI7 A;  4A72 A;  4RJ0 A;  4WYF A;  2VMR A;  2AY5 A;  1GD9 A;  2VI9 A;  1ASL A;  1AMQ A;  4AZJ A;  1CJ0 A;  4MQR A;  2CY8 A;  4N0W A;  1J32 A;  1SFF A;  1BKG A;  3OKS A;  2PB0 A;  1SZS A;  1G7W A;  2QA3 A;  3MBB A;  4LNM A;  1VP4 A;  1BJO B;  5G2P A;  3BWO A;  3CQ4 A;  3MAF A;  3KGX A;  5G09 A;  4FL0 A;  2V1P A;  2FM1 A;  2W7E A;  1S09 A;  2WK8 A;  3NU8 A;  1OHY A;  3WX9 A;  2QSR A;  2BI9 A;  4IYO A;  1D2F A;  4NOG A;  2ZY3 A;  2AY2 A;  1KMK A;  3P6K A;  1O61 A;  2AEU A;  3A2B A;  3AEO A;  2QB2 A;  5KTB A;  3IF2 A;  2JJE A;  3ELE A;  4F5M A;  4WB0 B;  4ADE A;  3E77 A;  4ZDP A;  4IXS A;  2VMT A;  4R5Z A;  2W7J A;  3MAU A;  2BIG A;  2EZ2 A;  3PD6 B;  1AIC A;  1DFO A;  3B8X A;  5TF5 A;  3TAT A;  2ZY4 A;  2W7K A;  3GZC A;  4E3Q A;  2YRI A;  2BIA A;  4WXB A;  1H1C A;  1T3I A;  2HUF A;  1G4X A;  4B9B A;  4F5G A;  1MGV A;  5HDM A;  4ATQ A;  3MC6 A;  1YAA A;  4IW7 A;  1GCK A;  3BB8 A;  2YCT A;  3EZS A;  4LW2 A;  4PFN A;  3UWC A;  3LVJ A;  5G2Q A;  1M32 A;  2X5D A;  1ASD A;  3LG0 A;  1AJS A;  3GZD C;  4W1X A;  3JWB A;  4BHD A;  4ZWM A;  3FVS A;  5DX5 A;  1CS1 A;  1DJE A;  2Z9W A;  4P3M A;  4JEZ A;  1AHX A;  1KL2 A;  1X29 A;  2HOR A;  3Q8N A;  3NUI A;  1D7U A;  1YIZ A;  1B9H A;  1TOG A;  2VMP A;  4ZLV A;  1AKB A;  5M4D A;  5K8B A;  1IVR A;  2E54 A;  3DC1 A;  1ORD A;  3TFU A;  1CZC A;  2VGU A;  2PB2 A;  4WYC A;  1EJI A;  1DJ9 A;  2QMA A;  2R5E A;  2C0R A;  4WLJ A;  3AOW A;  4XJO A;  3WKS A;  4A00 A;  1M7Y A;  1M0Q A;  1I48 A;  2ZYJ A;  3EZ1 A;  3QBO A;  1PFF A;  2BI5 A;  1KKJ A;  2CIN A;  4RJY A;  2W7L A;  1FG7 A;  5EAA A;  2V0Y A;  4UHM A;  3VK2 A;  4JEY A;  3ISL A;  3EI5 A;  1IJI A;  3P1T A;  4AOA A;  4FFC A;  3GR9 A;  5FT6 A;  3TCM A;  4DGT A;  3LY1 A;  4LNL A;  2BI3 A;  1QGN A;  2GMU A;  3FTB A;  3H14 A;  3FZ8 A;  1P3W A;  1S06 A;  2VGS A;  2HOZ A;  1M4N A;  2R2N A;  4QGR A;  4RM1 A;  1YOO A;  1OHW A;  3BV0 A;  3LVK A;  3RBF A;  4F4E A;  3F0H A;  3GZD A;  3NU7 A;  1X2A A;  3LV2 A;  3NNK A;  4OBU A;  2AY1 A;  3NX3 A;  1MDX A;  2ZC0 A;  2TPL A;  2FQ6 A;  4MSO A;  2YRR A;  1LW4 A;  4JF1 A;  7AAT A;  3RBL A;  2VMO A;  1WYU B;  3ZRQ A;  3WZF A;  4XJP A;  4ADC A;  2CTZ A;  2JIS A;  3DXW A;  4H63 Q;  3BWN C;  1OHV A;  4J8L A;  3FSL A;  1TAS A;  1MAQ A;  1V2F A;  3T32 A;  1M0N A;  1MDZ A;  1C0N A;  4AO9 A;  2Z9U A;  1AAM A;  4OTL A;  3N4S A;  3EIB A;  3LWS A;  2X5F A;  5M46 A;  3RCH B;  4F5H A;  2VMX A;  3HVY A;  1RVY A;  1YNU A;  1AKA A;  3QI6 A;  3FD0 A;  5AX8 A;  2ZUK A;  4JE5 A;  3A9Z A;  4TN4 A;  4RAE A;  4JEX A;  3NYT A;  3FDD A;  2HOY A;  3W1H A;  1GEX A;  5I92 A;  4WXG A;  3FQA A;  1CL1 A;  1LW5 A;  4MY5 A;  4K2B A;  4EB5 A;  1M0P A;  4R5F A;  3JW9 A;  3FRK A;  1GEY A;  1M0O A;  4RKC A;  1PG8 A;  2W7M A;  3N4X A;  1OXP A;  3KGW A;  2VYC A;  5G0A A;  3E2Z A;  3QGU A;  1LS3 A;  5F8V A;  4GE4 A;  1IUG A;  3AEM C;  2Z1Y A;  3WCO A;  1B5O A;  1OXO A;  4OMA A;  4A6U A;  3PDB B;  4WYG A;  4LC3 A;  4ZM3 A;  4OT8 A;  1LC8 A;  2F8J A;  2CJG A;  3BS8 A;  1C7G A;  2C7T A;  3VP6 A;  2D61 A;  1AHG A;  1UU1 A;  4K2M A;  1DJU A;  3DXV A;  4E3R A;  2DOU A;  3B1E A;  2YCP A;  3FDB A;  5J8Q A;  4GSA A;  1G4V A;  4U1T A;  3VOM A;  2R5C A;  1EQB A;  4MGR A;  2VIA A;  4ZAH A;  2VMQ A;  5EUD A;  2QB3 A;  3EUC A;  4ITX A;  4L0O A;  5HHY A;  1WYT A;  2ZY2 A;  3USF A;  2CH1 A;  3DYD A;  4OCA A;  1CQ7 A;  1W23 A;  4AZK A;  1M6S A;  1VEF A;  2AEV A;  4F5J A;  3ASB A;  1RV4 A;  1GBN A;  1TOI A;  2WKA A;  1ARS A;  3FFR A;  3FKD A;  3KE3 A;  3L8A A;  1Y4I A;  3HDO A;  4ZDO A;  4RKD A;  4MQP A;  3AOV A;  1CQ6 A;  4F5F A;  3FZ7 A;  1AIB A;  4N0B A;  1JF9 A;  2HZP A;  2EH6 A;  4EB7 A;  4UOY A;  1J04 A;  2EZ1 A;  2YCN A;  1BQA A;  1O69 A;  3AEN B;  1FG3 A;  1SVV A;  4Q75 A;  1JG8 A;  2Z20 A;  2DR1 A;  1W7M A;  1D7S A;  2HUU A;  4DQ6 A;  3AEJ C;  1XEY A;  1C7O A;  4W1V A;  2CST A;  2YKU A;  4ZAS A;  1GDE A;  4WD2 A;  4M2J A;  5BJ4 A;  2VMS A;  3N75 A;  4A0H A;  5LHA A;  1QIS A;  3A9Y A;  5EIG A;  5G4I A;  4CVQ A;  2CJD A;  2VMY A;  4OBV A;  2YKX A;  3UAK A;  3GBX A;  1EG5 A;  3OP7 A;  1X28 A;  2HUI A;  5G4J A;  4W8I A;  3BCX A;  1AHF A;  1RVU A;  1X0M A;  2VMZ A;  3ASA A;  1ARH A;  1IAY A;  1SF2 A;  2DKJ A;  4IX8 A;  2X8U A;  2OGE A;  1QZ9 A;  1BJO A;  2BIE A;  3EI6 A;  2BYL A;  1V2E A;  2JGT A;  3WGC A;  1S08 A;  2HP1 A;  1BJ4 A;  1W7N A;  1BQD A;  3FCR A;  2W7F A;  2BKW A;  2O1B A;  2YHK A;  4KAM A;  3HLM A;  1UU0 A;  2BI2 A;  2GMS A;  3NUB A;  2FNU A;  3M5U A;  2OKJ A;  1I41 A;  3EIA A;  3F9T A;  3L44 A;  1DGD A;  4ZDL A;  4LW4 A;  4WB0 A;  4ATP A;  4CXR A;  4EMY A;  3AV7 A;  4ISY A;  1SZU A;  4PVF A;  3HL2 A;  5EUE A;  2VGT A;  4ADB A;  3D6K A;  2FN6 A;  1PMO A;  2W7D A;  3N5M A;  1QIR A;  3FVU A;  4WXF A;  3VAX A;  3G8M A;  2RFV A;  3PD6 A;  3CQ6 A;  1D7R A;  2VLF A;  3N4R A;  4LNJ A;  4K05 A;  2FYF A;  4GEB A;  2C44 A;  3N7N A;  4BQ0 A;  1XI9 A;  1WKH A;  1WYV B;  4F5I A;  1B9I A;  1ZOD A;  2JJF A;  1LKC A;  3DRD A;  1BJW A;  1O4S A;  1DTY A;  2VLH A;  2D5Y A;  1GC4 A;  2ZSL A;  3G0T A;  2CAN A;  3W1I A;  1OAT A;  2D66 A;  1MLZ A;  2BWN A;  3MAF B;  3RI6 A;  3CBF A;  1ASA A;  2VMW A;  4IYO B;  2A1V A;  2Z9V A;  4IY7 A;  3K40 A;  5DJ9 A;  2GQN A;  2OQX A;  1SZK A;  1TOK A;  1ZC9 A;  1YJY A;  2KFP A;  3WLX A;  2E7I A;  4ADD A;  3GJU A;  3MKJ A;  2CH2 A;  5E4Z A;  4ITG A;  3DU4 A;  4JE5 D;  3HQT A;  3I16 A;  4WBT A;  1QJ5 A;  4MKK A;  9AAT A;  1AY5 A;  3JTX A;  1DKA A;  4ZM4 A;  4A6R A;  4Q76 A;  5IWQ A;  1ARG A;  4EU1 A;  4GE9 A;  4Y0I A;  1ARI A;  3PPL A;  2OAT A;  2YKY A;  2BI1 A;  5EFS A;  1CQ8 A;  4W5K A;  5FT5 A;  4MQQ A;  5EQC A;  1ZOB A;  3B1C A;  5BJ3 A;  3UE8 A;  2W7I A;  4CBR A;  4F5L A;  1C7N A;  2VIB A;  4A6T A;  8AAT A;  4KYO A;  3BC8 A;  4AH3 A;  4F5K A;  1QIT A;  2W8T A;  3MC6 C;  2CB1 A;  1ASN A;  1DGE A;  3JZL A;  3BWN A;  3PDX A;  1IBJ A;  5EUN A;  2JG2 A;  2OGA A;  2FKI A;  3E2F A;  4OC9 A;  2EGY A;  2XH1 A;  3EI8 A;  3NRA A;  4RLG A;  4OYT A;  1WYU A;  3ZZK A;  2O0R A;  4B98 A;  3JU7 A;  2VMV A;  2VI8 A;  1RV3 A;  4K2I A;  4XK1 A;  2R0T A;  1O62 A;  4CBS A;  3BCA A;  4XAU A;  3WGB A;  1AMR A;  1IAX A;  3LVM A;  3R4T A;  1B5P A;  1LC5 A;  3DZZ A; 
#chains in the Genus database with same CATH homology
 1W3U A;  1ART A;  2G6W A;  4KXK A;  3AAT A;  1ASG A;  1AMS A;  3GET A;  3HT4 A;  4O6Z A;  3RCH A;  1AIA A;  2DGM A;  3ZZJ A;  1U08 A;  3E6G A;  3N0L A;  3BCB A;  4J5U A;  3B1D A;  1WST A;  2X3L A;  1BT4 A;  2GSA A;  3FQ8 A;  2BYJ A;  3G7Q A;  4JF0 A;  4WYA A;  3F6T A;  3NDN A;  4A0F A;  1AMA A;  3WKR A;  1ASC A;  2D7Y A;  3MEB A;  4WYE A;  4Y0D A;  3RQ1 A;  4XEW A;  1C9C A;  2W8V A;  1ASM A;  1SPA A;  1WKG A;  3AEM A;  3QN6 A;  4GRX A;  3H7F A;  1E5E A;  1V72 A;  2YKV A;  4IXZ A;  3FFH A;  4AO4 A;  4A0R A;  2BHX A;  1AHE A;  4ZSY A;  2C81 A;  4JEW A;  1QJ3 A;  3PIU A;  2EO5 A;  1BW0 A;  4XJL A;  1TAT A;  1TOE A;  3VK3 A;  2PO3 A;  4PFF A;  5M4B A;  3ZRP A;  2Z67 A;  2HP2 A;  2OKK A;  4DBC A;  2AY3 A;  4JEV A;  4M2M A;  3CQ5 A;  3E9K A;  3PDB A;  1FC4 A;  3LVL B;  4TMR A;  5FT4 A;  1GEW A;  1BS0 A;  1CZE A;  2W8J A;  4I8A A;  4XQ2 A;  1B4X A;  1H0C A;  2CJH A;  3BN1 A;  1N8P A;  1TOJ A;  3K7Y A;  4Q6R A;  4WLH A;  5D95 A;  1I29 A;  3A9X A;  3AEP A;  4W91 A;  2E7U A;  2ZY5 A;  3PAA A;  2HOX A;  2W8U A;  1Z3Z A;  3FQ7 A;  4U2H A;  2D7Z A;  2DKB A;  2W7G A;  3EI9 A;  4GE7 A;  1N2T A;  1V2D A;  3ELP A;  2E7J A;  4WYD A;  1UU2 A;  2VMN A;  1CL2 A;  4A0G A;  2WB6 A;  2NMP A;  2BWP A;  4BMK A;  3PJ0 A;  1ELU A;  1IX7 A;  3DR7 A;  3QM2 A;  1AKC A;  4R2N A;  1B8G A;  3ECD A;  4WP0 A;  4Q31 A;  3CAI A;  3VK4 A;  3GSB A;  3MAD A;  1JS6 A;  1S07 A;  1GC0 A;  2AAT A;  4HF8 A;  3HBX A;  2G7J A;  3AEJ A;  3QHX A;  3COG A;  2W8W A;  4GDY A;  4ZWV A;  5C6U A;  1IX8 A;  2EYQ A;  5F9S A;  2BWO A;  5FT8 A;  2D64 A;  1N31 A;  3TFT A;  3IHJ A;  2D63 A;  1LK9 A;  3AEN A;  1AX4 A;  4UHO A;  3HMU A;  4R8D A;  1YJS A;  2QLR A;  2VGW A;  1E5F A;  4H51 A;  1PMM A;  1KKP A;  3I4J A;  5E5I A;  3E2Z B;  1UKJ A;  2Q7W A;  4TV7 A;  1MAP A;  2ZP7 A;  3ATH A;  4BA5 A;  2WK9 A;  3WCN A;  1YIY A;  1GC3 A;  1JS3 A;  1D7V A;  1ECX A;  1AHY A;  1I43 A;  2AY7 A;  5HXX A;  1YJZ A;  1VJO A;  2JJG A;  4UQV A;  2ZJG A;  1ASB A;  3PGY A;  4RIT A;  1ELQ A;  3R9A A;  4BA4 A;  1S0A A;  4M2K A;  2R5C B;  4IXO A;  3ZRR A;  2VGV A;  1ASF A;  1AAW A;  2AY4 A;  2EPJ A;  2AY6 A;  2Z9X A;  1WYT B;  2DGK A;  2O7C A;  4E77 A;  3DR4 A;  3I5T A;  3II0 A;  3JWA A;  4W1W A;  5D5S A;  4E1O A;  5LH9 A;  1GC2 A;  2ZSM A;  2VMU A;  2AY8 A;  3W1J A;  4PIW A;  3E2Y A;  2ORD A;  2W7H A;  3RUY A;  3H9X A;  5M49 A;  1TPL A;  2Z61 A;  1BJN A;  3PA9 A;  1Z7D A;  2DGL A;  3K28 A;  5EAV A;  1MDO A;  4EFF A;  2VGZ A;  3NYU A;  1AJR A;  2WK7 A;  2YOB A;  3B46 A;  5DB5 A;  3KKI A;  1MLY A;  2XBN A;  4P7Y A;  3A8U X;  3TQX A;  3QPG A;  1G7X A;  3AEL A;  4HVK A;  4UHN A;  1KMJ A;  3DOD A;  1C4K A;  1AY4 A;  1KL1 A;  3GWP A;  1TAR A;  2Z1Z A;  3WY7 A;  1IX6 A;  4XJM A;  4MKJ A;  5JAY A;  1AJS B;  2FNI A;  2CFB A;  1AY8 A;  1LC7 A;  4ZSW A;  3FZ6 A;  3NYS A;  4CXQ A;  3FVX A;  1WYV A;  2QBT A;  2AY9 A;  1ASE A;  3ACZ A;  4Y0H A;  4RIZ A;  5EIG B;  5E3K A;  3NTJ A;  2GB3 A;  2JJH A;  1W7L A;  2D65 A;  5DJ1 A;  3EI7 A;  4A72 A;  4RJ0 A;  4WYF A;  2VMR A;  2AY5 A;  1GD9 A;  2VI9 A;  1ASL A;  1AMQ A;  4AZJ A;  1CJ0 A;  4MQR A;  2CY8 A;  4N0W A;  1J32 A;  1SFF A;  1BKG A;  3OKS A;  2PB0 A;  1SZS A;  1G7W A;  2QA3 A;  3MBB A;  4LNM A;  1VP4 A;  1BJO B;  5G2P A;  3BWO A;  3CQ4 A;  3MAF A;  3KGX A;  5G09 A;  4FL0 A;  2V1P A;  2FM1 A;  2W7E A;  1S09 A;  2WK8 A;  3NU8 A;  1OHY A;  3WX9 A;  2QSR A;  2BI9 A;  4IYO A;  1D2F A;  4NOG A;  2ZY3 A;  2AY2 A;  1KMK A;  3P6K A;  1O61 A;  2AEU A;  3A2B A;  3AEO A;  2QB2 A;  5KTB A;  3IF2 A;  2JJE A;  3ELE A;  4F5M A;  4WB0 B;  4ADE A;  3E77 A;  4ZDP A;  4IXS A;  2VMT A;  4R5Z A;  2W7J A;  3MAU A;  2BIG A;  2EZ2 A;  3PD6 B;  1AIC A;  1DFO A;  3B8X A;  5TF5 A;  3TAT A;  2ZY4 A;  2W7K A;  3GZC A;  4E3Q A;  2YRI A;  2BIA A;  4WXB A;  1H1C A;  1T3I A;  2HUF A;  1G4X A;  4B9B A;  4F5G A;  1MGV A;  5HDM A;  4ATQ A;  3MC6 A;  1YAA A;  4IW7 A;  1GCK A;  3BB8 A;  2YCT A;  3EZS A;  4LW2 A;  4PFN A;  3UWC A;  3LVJ A;  5G2Q A;  1M32 A;  2X5D A;  1ASD A;  3LG0 A;  1AJS A;  3GZD C;  4W1X A;  3JWB A;  4BHD A;  4ZWM A;  3FVS A;  5DX5 A;  1CS1 A;  1DJE A;  2Z9W A;  4P3M A;  4JEZ A;  1AHX A;  1KL2 A;  1X29 A;  2HOR A;  3Q8N A;  3NUI A;  1D7U A;  1YIZ A;  1B9H A;  1TOG A;  2VMP A;  4ZLV A;  1AKB A;  5M4D A;  5K8B A;  1IVR A;  2E54 A;  3DC1 A;  1ORD A;  3TFU A;  1CZC A;  2VGU A;  2PB2 A;  4WYC A;  1EJI A;  1DJ9 A;  2QMA A;  2R5E A;  2C0R A;  4WLJ A;  3AOW A;  4XJO A;  3WKS A;  4A00 A;  1M7Y A;  1M0Q A;  1I48 A;  2ZYJ A;  3EZ1 A;  3QBO A;  1PFF A;  2BI5 A;  1KKJ A;  2CIN A;  4RJY A;  2W7L A;  1FG7 A;  5EAA A;  2V0Y A;  4UHM A;  3VK2 A;  4JEY A;  3ISL A;  3EI5 A;  1IJI A;  3P1T A;  4AOA A;  4FFC A;  3GR9 A;  5FT6 A;  3TCM A;  4DGT A;  3LY1 A;  4LNL A;  2BI3 A;  1QGN A;  2GMU A;  3FTB A;  3H14 A;  3FZ8 A;  1P3W A;  1S06 A;  2VGS A;  2HOZ A;  1M4N A;  2R2N A;  4QGR A;  4RM1 A;  1YOO A;  1OHW A;  3BV0 A;  3LVK A;  3RBF A;  4F4E A;  3F0H A;  3GZD A;  3NU7 A;  1X2A A;  3LV2 A;  3NNK A;  4OBU A;  2AY1 A;  3NX3 A;  1MDX A;  2ZC0 A;  2TPL A;  2FQ6 A;  4MSO A;  2YRR A;  1LW4 A;  4JF1 A;  7AAT A;  3RBL A;  2VMO A;  1WYU B;  3ZRQ A;  3WZF A;  4XJP A;  4ADC A;  2CTZ A;  2JIS A;  3DXW A;  4H63 Q;  3BWN C;  1OHV A;  4J8L A;  3FSL A;  1TAS A;  1MAQ A;  1V2F A;  3T32 A;  1M0N A;  1MDZ A;  1C0N A;  4AO9 A;  2Z9U A;  1AAM A;  4OTL A;  3N4S A;  3EIB A;  3LWS A;  2X5F A;  5M46 A;  3RCH B;  4F5H A;  2VMX A;  3HVY A;  1RVY A;  1YNU A;  1AKA A;  3QI6 A;  3FD0 A;  5AX8 A;  2ZUK A;  4JE5 A;  3A9Z A;  4TN4 A;  4RAE A;  4JEX A;  3NYT A;  3FDD A;  2HOY A;  3W1H A;  1GEX A;  5I92 A;  4WXG A;  3FQA A;  1CL1 A;  1LW5 A;  4MY5 A;  4K2B A;  4EB5 A;  1M0P A;  4R5F A;  3JW9 A;  3FRK A;  1GEY A;  1M0O A;  4RKC A;  1PG8 A;  2W7M A;  3N4X A;  1OXP A;  3KGW A;  2VYC A;  5G0A A;  3E2Z A;  3QGU A;  1LS3 A;  5F8V A;  4GE4 A;  1IUG A;  3AEM C;  2Z1Y A;  3WCO A;  1B5O A;  1OXO A;  4OMA A;  4A6U A;  3PDB B;  4WYG A;  4LC3 A;  4ZM3 A;  4OT8 A;  1LC8 A;  2F8J A;  2CJG A;  3BS8 A;  1C7G A;  2C7T A;  3VP6 A;  2D61 A;  1AHG A;  1UU1 A;  4K2M A;  1DJU A;  3DXV A;  4E3R A;  2DOU A;  3B1E A;  2YCP A;  3FDB A;  5J8Q A;  4GSA A;  1G4V A;  4U1T A;  3VOM A;  2R5C A;  1EQB A;  4MGR A;  2VIA A;  4ZAH A;  2VMQ A;  5EUD A;  2QB3 A;  3EUC A;  4ITX A;  4L0O A;  5HHY A;  1WYT A;  2ZY2 A;  3USF A;  2CH1 A;  3DYD A;  4OCA A;  1CQ7 A;  1W23 A;  4AZK A;  1M6S A;  1VEF A;  2AEV A;  4F5J A;  3ASB A;  1RV4 A;  1GBN A;  1TOI A;  2WKA A;  1ARS A;  3FFR A;  3FKD A;  3KE3 A;  3L8A A;  1Y4I A;  3HDO A;  4ZDO A;  4RKD A;  4MQP A;  3AOV A;  1CQ6 A;  4F5F A;  3FZ7 A;  1AIB A;  4N0B A;  1JF9 A;  2HZP A;  2EH6 A;  4EB7 A;  4UOY A;  1J04 A;  2EZ1 A;  2YCN A;  1BQA A;  1O69 A;  3AEN B;  1FG3 A;  1SVV A;  4Q75 A;  1JG8 A;  2Z20 A;  2DR1 A;  1W7M A;  1D7S A;  2HUU A;  4DQ6 A;  3AEJ C;  1XEY A;  1C7O A;  4W1V A;  2CST A;  2YKU A;  4ZAS A;  1GDE A;  4WD2 A;  4M2J A;  5BJ4 A;  2VMS A;  3N75 A;  4A0H A;  5LHA A;  1QIS A;  3A9Y A;  5EIG A;  5G4I A;  4CVQ A;  2CJD A;  2VMY A;  4OBV A;  2YKX A;  3UAK A;  3GBX A;  1EG5 A;  3OP7 A;  1X28 A;  2HUI A;  5G4J A;  4W8I A;  3BCX A;  1AHF A;  1RVU A;  1X0M A;  2VMZ A;  3ASA A;  1ARH A;  1IAY A;  1SF2 A;  2DKJ A;  4IX8 A;  2X8U A;  2OGE A;  1QZ9 A;  1BJO A;  2BIE A;  3EI6 A;  2BYL A;  1V2E A;  2JGT A;  3WGC A;  1S08 A;  2HP1 A;  1BJ4 A;  1W7N A;  1BQD A;  3FCR A;  2W7F A;  2BKW A;  2O1B A;  2YHK A;  4KAM A;  3HLM A;  1UU0 A;  2BI2 A;  2GMS A;  3NUB A;  2FNU A;  3M5U A;  2OKJ A;  1I41 A;  3EIA A;  3F9T A;  3L44 A;  1DGD A;  4ZDL A;  4LW4 A;  4WB0 A;  4ATP A;  4CXR A;  4EMY A;  3AV7 A;  4ISY A;  1SZU A;  4PVF A;  3HL2 A;  5EUE A;  2VGT A;  4ADB A;  3D6K A;  2FN6 A;  1PMO A;  2W7D A;  3N5M A;  1QIR A;  3FVU A;  4WXF A;  3VAX A;  3G8M A;  2RFV A;  3PD6 A;  3CQ6 A;  1D7R A;  2VLF A;  3N4R A;  4LNJ A;  4K05 A;  2FYF A;  4GEB A;  2C44 A;  3N7N A;  4BQ0 A;  1XI9 A;  1WKH A;  1WYV B;  4F5I A;  1B9I A;  1ZOD A;  2JJF A;  1LKC A;  3DRD A;  1BJW A;  1O4S A;  1DTY A;  2VLH A;  2D5Y A;  1GC4 A;  2ZSL A;  3G0T A;  2CAN A;  3W1I A;  1OAT A;  2D66 A;  1MLZ A;  2BWN A;  3MAF B;  3RI6 A;  3CBF A;  1ASA A;  2VMW A;  4IYO B;  2A1V A;  2Z9V A;  4IY7 A;  3K40 A;  5DJ9 A;  2GQN A;  2OQX A;  1SZK A;  1TOK A;  1ZC9 A;  1YJY A;  2KFP A;  3WLX A;  2E7I A;  4ADD A;  3GJU A;  3MKJ A;  2CH2 A;  5E4Z A;  4ITG A;  3DU4 A;  4JE5 D;  3HQT A;  3I16 A;  4WBT A;  1QJ5 A;  4MKK A;  9AAT A;  1AY5 A;  3JTX A;  1DKA A;  4ZM4 A;  4A6R A;  4Q76 A;  5IWQ A;  1ARG A;  4EU1 A;  4GE9 A;  4Y0I A;  1ARI A;  3PPL A;  2OAT A;  2YKY A;  2BI1 A;  5EFS A;  1CQ8 A;  4W5K A;  5FT5 A;  4MQQ A;  5EQC A;  1ZOB A;  3B1C A;  5BJ3 A;  3UE8 A;  2W7I A;  4CBR A;  4F5L A;  1C7N A;  2VIB A;  4A6T A;  8AAT A;  4KYO A;  3BC8 A;  4AH3 A;  4F5K A;  1QIT A;  2W8T A;  3MC6 C;  2CB1 A;  1ASN A;  1DGE A;  3JZL A;  3BWN A;  3PDX A;  1IBJ A;  5EUN A;  2JG2 A;  2OGA A;  2FKI A;  3E2F A;  4OC9 A;  2EGY A;  2XH1 A;  3EI8 A;  3NRA A;  4RLG A;  4OYT A;  1WYU A;  3ZZK A;  2O0R A;  4B98 A;  3JU7 A;  2VMV A;  2VI8 A;  1RV3 A;  4K2I A;  4XK1 A;  2R0T A;  1O62 A;  4CBS A;  3BCA A;  4XAU A;  3WGB A;  1AMR A;  1IAX A;  3LVM A;  3R4T A;  1B5P A;  1LC5 A;  3DZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...