2BI3A

Radiation damage of the schiff base in phosphoserine aminotransferase (structure d)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
360
structure length
360
Chain Sequence
VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
total genus 126
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2bi3A01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2bi3A02
3CQ5A 4NOGA 4WXBA 1CL2A 2VGTA 3MAFB 2Z9VA 3B1DA 1W7NA 4IW7A 3AENB 3EI5A 1JG8A 3W1IA 2OGEA 4XEWA 3II0A 3PJ0A 3UWCA 4F5GA 1ECXA 3E2ZB 4Y0IA 4FFCA 2W7KA 3N75A 3HMUA 1GEWA 3PD6A 4RAEA 4MQPA 2ZUKA 5JAYA 2D66A 2CJGA 3EI7A 4XJPA 4A6UA 3IHJA 3FVXA 4BQ0A 2CJHA 1N8PA 2ORDA 3BWNC 1AICA 3EIAA 3Q8NA 2D5YA 1IVRA 3AEMC 5EFSA 3FQ7A 1ARTA 2CFBA 2ZSMA 3NUIA 3FDDA 2D65A 3ZZKA 2CY8A 2X8UA 3RQ1A 5C6UA 4UQVA 1X0MA 1LC8A 5K8BA 2OKJA 2VMSA 3E9KA 3MC6A 2CANA 2GMSA 3A9ZA 3DU4A 1GDEA 2AY3A 1V72A 2ZY3A 4AZJA 2BI2A 2DGKA 2HORA 1YNUA 3ASBA 1GC0A 1ARIA 1LC5A 1IX7A 3HVYA 3N0LA 3T32A 1BJOB 3EZSA 4W8IA 3JWBA 4UHOA 1YOOA 4PVFA 1V2FA 4ADBA 4DBCA 3HQTA 3JZLA 2E54A 4WBTA 3I16A 4IXSA 4CBRA 4IYOB 4WYCA 2WKAA 1RV3A 2YKYA 3QM2A 1D7UA 2Z20A 3GBXA 2VMQA 1WKHA 1DGEA 5EUDA 4XQ2A 2BKWA 5EQCA 2NMPA 1AMAA 4MQRA 1S07A 5J8QA 3FQ8A 5AX8A 1OHYA 4ZASA 2Q7WA 2BHXA 2X5FA 2XBNA 2OGAA 1ARGA 1IX8A 1AY5A 1SFFA 3WX9A 3KE3A 3E2FA 2BYJA 1IAXA 2AY2A 3WCNA 2FNUA 2EGYA 5G4IA 1AMQA 3FD0A 1MGVA 4RLGA 1Z3ZA 3K28A 5E4ZA 1AJSA 4WB0B 4WLHA 2VMNA 1QGNA 1CQ6A 2QBTA 1QJ3A 2ZJGA 4EMYA 2X5DA 1AJSB 2JG2A 1X28A 4WB0A 3A2BA 5DX5A 3AOVA 3W1JA 2VMZA 4ZSWA 4PIWA 5BJ3A 2R0TA 3AELA 3P1TA 4A00A 4WP0A 1V2DA 1QZ9A 2RFVA 3MADA 4F5LA 1AHGA 2EPJA 4ISYA 1JS6A 3PPLA 2JGTA 2VMXA 4GEBA 2YCTA 3GR9A 3PGYA 4JF0A 3EZ1A 3E2YA 4RITA 3FFRA 4ITGA 4K2IA 4DGTA 2D61A 3FFHA 4ADEA 1Z7DA 1VJOA 4WYFA 2VMUA 4B98A 1O62A 1G4XA 3MAUA 3TFTA 2AEUA 3BS8A 1PG8A 2BWOA 1CJ0A 4M2KA 1EG5A 3BCAA 4A6RA 4F4EA 4F5HA 3AATA 1DTYA 3HBXA 4DQ6A 1ZC9A 1YIZA 1TOEA 1U08A 2ZSLA 5IWQA 1TOKA 2V0YA 3BB8A 1TARA 1UU1A 1X29A 3LVMA 4F5JA 3USFA 4AOAA 4UHMA 5M49A 4M2JA 1RVYA 1VEFA 2EH6A 3E2ZA 4MY5A 5FT5A 1MLYA 1DGDA 4HF8A 4A72A 1BJNA 1MDZA 2VGWA 4Q76A 3DC1A 1GCKA 3BCBA 4XK1A 5BJ4A 4ZM3A 1TOJA 4UOYA 1BQDA 2C7TA 8AATA 2CSTA 5EAAA 3VK4A 1CQ8A 3AEOA 1OHVA 1LS3A 1LC7A 2VMVA 1BQAA 2HOXA 4J8LA 2O1BA 1PMMA 2VGSA 1I41A 1ELQA 1KMKA 4W1WA 1TATA 1V2EA 2D7ZA 5TF5A 4OMAA 1J04A 2ZP7A 3FQAA 4BA5A 1BJWA 2W8WA 3G0TA 1I43A 5M46A 3D6KA 1IUGA 4IX8A 1GEXA 3ISLA 1WYVA 4JEWA 1MAPA 1JF9A 2D63A 4HVKA 3KKIA 3DYDA 1KKPA 1IAYA 1B9IA 1WYTB 1FC4A 1AHFA 1ZODA 3TATA 1RV4A 2HUUA 2PB0A 2TPLA 3GZDC 3N5MA 1CQ7A 1LW4A 4WXGA 4CVQA 3L8AA 1C7GA 3FKDA 4XJOA 2AY9A 2HUFA 3PA9A 4E3QA 2BI9A 2ZC0A 3GZDA 1M0OA 5EIGA 4W5KA 2W7EA 3TCMA 1G7WA 3LVLB 3FVSA 3NYUA 5LHAA 1AMSA 2VLFA 4OTLA 2EO5A 5F8VA 3AEJA 4WD2A 2BIGA 1S0AA 2G6WA 3JW9A 2ZY4A 1WYTA 5EAVA 4ZDPA 3R4TA 4A6TA 2YKVA 4A0FA 2R5CA 4KAMA 5FT6A 2FM1A 3DXWA 1D2FA 3FTBA 3FDBA 4ZAHA 4WYGA 3ECDA 5DJ1A 1AAMA 3JTXA 3LG0A 3AEJC 3M5UA 3PDXA 4GE7A 3GWPA 3RBFA 1DKAA 4IXOA 4MQQA 1S06A 1AHEA 3NU8A 2VYCA 3ELPA 4U2HA 3BWNA 1ARHA 3BC8A 3HLMA 1BJ4A 1ASNA 1AY4A 4W91A 3RUYA 1OHWA 2YKUA 2HOZA 3A9XA 1UU0A 3QN6A 1YAAA 1GC3A 4ZLVA 3G8MA 4JEVA 1O69A 3VOMA 4OYTA 3VP6A 2W8UA 1O4SA 1ASCA 2PO3A 1YJZA 4GE9A 1SPAA 4LNJA 3DXVA 1ORDA 1UKJA 1ASAA 2VMWA 1SF2A 1TOGA 4RM1A 1C7OA 3LV2A 3OKSA 1ASDA 2W8JA 2E7IA 1ARSA 1KL1A 1AKBA 5HXXA 4IXZA 4ZWMA 3NUBA 1QIRA 1M4NA 2C81A 3GZCA 4GSAA 4JEZA 1XEYA 3MAFA 2BWPA 2D7YA 1G4VA 3DODA 3AENA 1AIAA 4P3MA 3TQXA 3WGBA 4F5KA 3UE8A 1B8GA 1SZKA 1YJSA 4RKDA 2AY1A 4MGRA 3DZZA 4ATQA 2E7JA 2E7UA 2CB1A 2QB3A 1N31A 2OQXA 2X3LA 1CL1A 1GC4A 1RVUA 4GDYA 3RCHB 3BWOA 3FZ8A 3QI6A 3PD6B 2C0RA 1W7MA 5G09A 3JU7A 2VI8A 2Z9UA 4Q6RA 5G4JA 3G7QA 2GSAA 2W7GA 3I5TA 3W1HA 3ZZJA 2QMAA 2W7FA 2DGLA 2VIAA 2VMOA 4ZDLA 1ASLA 2VLHA 4ADDA 4EFFA 3LWSA 1AHYA 2YRIA 1TOIA 1WYVB 3CAIA 4R2NA 4F5IA 4CXQA 4N0WA 3BV0A 4O6ZA 4CBSA 1P3WA 1X2AA 2OATA 3MBBA 4A0GA 4BHDA 1B5PA 3PDBB 4TMRA 2VGZA 3GETA 3TFUA 1MAQA 1BKGA 3WZFA 1D7RA 2AY4A 4XJLA 4K2MA 1PFFA 1CS1A 3VK3A 1CZCA 1H1CA 1J32A 2W7LA 3EI9A 3F6TA 4XAUA 3F9TA 3DR4A 4MSOA 2Z1ZA 1YJYA 3WGCA 4F5MA 4JEXA 3FZ7A 4EB7A 2VGUA 2HP1A 5DB5A 1S08A 2O7CA 2PB2A 5E3KA 5M4BA 4E77A 3ACZA 2VIBA 1SZSA 3NNKA 1GBNA 4TN4A 4CXRA 4ZM4A 1M32A 1SVVA 3AEPA 1DJ9A 3WY7A 5D5SA 4MKKA 1E5EA 1O61A 3MC6C 7AATA 2ZY2A 1MDOA 1LKCA 2ZYJA 3GJUA 3RBLA 1AHXA 9AATA 3DRDA 4WXFA 5HDMA 2DKBA 2JJEA 2QA3A 3F0HA 3WLXA 4W1XA 4OT8A 1QISA 1C0NA 4F5FA 1OATA 3AV7A 1S09A 2Z1YA 4LW2A 1GC2A 4E1OA 2AATA 3HL2A 3ZRQA 3E77A 1AIBA 2AEVA 4ITXA 1C7NA 4MKJA 2WK9A 3EIBA 2W7JA 4JEYA 5EIGB 1OXPA 3HDOA 4IYOA 2OKKA 4OCAA 3EUCA 1LK9A 1ASGA 1KKJA 4U1TA 3QGUA 5FT8A 4BA4A 1ASMA 4R8DA 1QJ5A 4B9BA 3LVKA 1M0QA 3B8XA 5LH9A 2JJFA 4AO9A 1M6SA 5F9SA 2R5CB 2VGVA 2W7MA 3PIUA 2R2NA 3FVUA 2BI1A 1AMRA 3P6KA 2EZ1A 2CTZA 2BYLA 3RCHA 3K40A 2DGMA 3QPGA 5G2QA 5I92A 1AKCA 2O0RA 1B4XA 3HT4A 1I29A 3WKRA 1ASEA 1AX4A 2YOBA 4M2MA 3R9AA 2QB2A 4L0OA 3AEMA 3MEBA 3ZRPA 2W8TA 3QHXA 2HP2A 2Z9XA 3LVJA 1AY8A 2JJGA 3GSBA 4Q75A 5E5IA 2GQNA 2CINA 2DR1A 2Z61A 3VK2A 3NRAA 1W3UA 1M7YA 1M0NA 4JE5D 3PDBA 1G7XA 3FZ6A 4EB5A 4QGRA 1AKAA 5G0AA 2YHKA 1C4KA 3NYSA 4PFNA 1IBJA 2YRRA 4R5FA 5D95A 3CQ6A 4LC3A 1DJUA 4LNLA 2R5EA 5HHYA 3WKSA 4WLJA 4WYDA 2CJDA 2AY8A 1BS0A 4GRXA 4ZSYA 1C9CA 3ASAA 1ASFA 4EU1A 4BMKA 2FN6A 4J5UA 1B9HA 4A0HA 4TV7A 4AO4A 1E5FA 2HOYA 2W7DA 1CZEA 2BIAA 2VI9A 3LY1A 3NX3A 4W1VA 2W7HA 2VMPA 3B1EA 3CQ4A 3H14A 4JF1A 1YIYA 3PAAA 3EI8A 1FG7A 4RKCA 4UHNA 4K2BA 5DJ9A 1IX6A 1OXOA 4KXKA 2FYFA 1LW5A 1ELUA 1MDXA 5G2PA 2F8JA 3H7FA 4KYOA 4JE5A 1W23A 2GB3A 2WK7A 3NDNA 4LW4A 4E3RA 1WYUA 3FCRA 1UU2A 1ZOBA 2VMTA 1DFOA 1N2TA 1KMJA 3VAXA 4RJYA 1SZUA 3AOWA 3NYTA 2HUIA 3A9YA 2JISA 2WK8A 2C44A 2AY6A 4ZDOA 1QITA 2AY7A 4RIZA 1M0PA 1W7LA 3ELEA 4WYAA 1IJIA 3WCOA 2XH1A 3FRKA 1AJRA 4Q31A 1H0CA 1JS3A 2VMRA 3EI6A 1I48A 1AAWA 2YKXA 3OP7A 3KGWA 4LNMA 4Y0HA 2DKJA 2ZY5A 1WYUB 2V1PA 1XI9A 2FQ6A 2W7IA 2JJHA 2BI5A 3E6GA 5FT4A 1WKGA 3DR7A 4WYEA 4Y0DA 1VP4A 2AY5A 1WSTA 4R5ZA 3I4JA 1FG3A 1TPLA 3QBOA 1BJOA 3RI6A 2EZ2A 4RJ0A 2GMUA 3COGA 3BN1A 3A8UX 1B5OA 1D7VA 2BIEA 2BWNA 4ADCA 4OC9A 2D64A 4A0RA 1PMOA 1KL2A 3ATHA 2BI3A 3ZRRA 2HZPA 4H51A 3NTJA 2DOUA 4N0BA 3K7YA 2FNIA 4I8AA 3MKJA 1Y4IA 5EUEA 3B46A 3NU7A 2Z9WA 4IY7A 2YCNA 1EQBA 4PFFA 4ZWVA 3BCXA 4AZKA 3KGXA 3JWAA 2CH1A 1EJIA 1GD9A 4OBVA 3UAKA 2Z67A 3L44A 1GEYA 1MLZA 3CBFA 4GE4A 2W8VA 1ASBA 1D7SA 2YCPA 3IF2A 2QLRA 4OBUA 4FL0A 4AH3A 1BW0A 5EUNA 5M4DA 4P7YA 3B1CA 4XJMA 2VMYA 1T3IA 1BT4A 4ATPA 3FSLA 2CH2A 1TASA 1DJEA
chains in the Genus database with same CATH superfamily
3CQ5A 4NOGA 4WXBA 1CL2A 2VGTA 3MAFB 2Z9VA 3B1DA 1W7NA 4IW7A 3AENB 3EI5A 1JG8A 3W1IA 2OGEA 4XEWA 3II0A 3PJ0A 3UWCA 4F5GA 1ECXA 3E2ZB 4Y0IA 4FFCA 2W7KA 3N75A 3HMUA 1GEWA 3PD6A 4RAEA 4MQPA 2ZUKA 5JAYA 2D66A 2CJGA 3EI7A 4XJPA 4A6UA 3IHJA 3FVXA 4BQ0A 2CJHA 1N8PA 2ORDA 3BWNC 1AICA 3EIAA 3Q8NA 2D5YA 1IVRA 3AEMC 5EFSA 3FQ7A 1ARTA 4H63Q 2CFBA 2ZSMA 3NUIA 3FDDA 2D65A 3ZZKA 2CY8A 2X8UA 3RQ1A 5C6UA 4UQVA 1X0MA 1LC8A 5K8BA 2OKJA 2VMSA 3E9KA 3MC6A 2CANA 2GMSA 3A9ZA 3DU4A 1GDEA 2AY3A 1V72A 2ZY3A 4AZJA 2BI2A 2DGKA 2HORA 1YNUA 3ASBA 1GC0A 1ARIA 1LC5A 1IX7A 3HVYA 3N0LA 3T32A 1BJOB 3EZSA 4W8IA 3JWBA 4UHOA 1YOOA 4PVFA 1V2FA 4ADBA 4DBCA 3HQTA 3JZLA 2E54A 4WBTA 3I16A 1KAFA 4IXSA 4CBRA 4IYOB 4WYCA 2WKAA 1RV3A 2YKYA 3QM2A 1D7UA 2Z20A 3GBXA 2VMQA 1WKHA 1DGEA 5EUDA 4XQ2A 2BKWA 5EQCA 2NMPA 1AMAA 4MQRA 1S07A 5J8QA 3FQ8A 5AX8A 1OHYA 4ZASA 2Q7WA 2BHXA 2X5FA 2XBNA 2OGAA 1ARGA 1IX8A 1AY5A 1SFFA 3WX9A 3KE3A 3E2FA 2BYJA 1IAXA 2AY2A 3WCNA 2FNUA 2EGYA 5G4IA 1AMQA 3FD0A 1MGVA 4RLGA 1Z3ZA 3K28A 5E4ZA 1AJSA 4WB0B 4WLHA 2VMNA 1QGNA 1CQ6A 2QBTA 1QJ3A 2ZJGA 4EMYA 2X5DA 1AJSB 2JG2A 1X28A 4WB0A 3A2BA 5DX5A 3AOVA 3W1JA 2VMZA 4ZSWA 4PIWA 5BJ3A 2R0TA 3AELA 3P1TA 4A00A 4WP0A 1V2DA 1QZ9A 2RFVA 3MADA 4F5LA 1AHGA 2EPJA 2FKIA 4ISYA 1JS6A 3PPLA 2JGTA 2VMXA 4GEBA 2YCTA 3GR9A 3PGYA 2KFPA 4JF0A 3EZ1A 3E2YA 4RITA 3FFRA 4ITGA 4K2IA 4DGTA 2D61A 3FFHA 4ADEA 1Z7DA 1VJOA 4WYFA 2VMUA 4B98A 1O62A 1G4XA 3MAUA 3TFTA 2AEUA 3BS8A 1PG8A 2BWOA 1CJ0A 4M2KA 1EG5A 3BCAA 4A6RA 4F4EA 4F5HA 3AATA 1DTYA 3HBXA 4DQ6A 1ZC9A 1YIZA 1TOEA 1U08A 2ZSLA 5IWQA 1TOKA 2V0YA 3BB8A 1TARA 1UU1A 1X29A 3LVMA 4F5JA 3USFA 4AOAA 4UHMA 5M49A 4M2JA 1RVYA 1VEFA 2EH6A 3E2ZA 4MY5A 5FT5A 1MLYA 1DGDA 4HF8A 4A72A 1BJNA 1MDZA 2VGWA 4Q76A 3DC1A 1GCKA 3BCBA 4XK1A 5BJ4A 4ZM3A 2A1VA 1TOJA 4UOYA 1BQDA 2C7TA 8AATA 2CSTA 5EAAA 3VK4A 1CQ8A 3AEOA 1OHVA 1LS3A 1LC7A 2VMVA 1BQAA 2HOXA 4J8LA 2O1BA 1PMMA 2VGSA 1I41A 1ELQA 1KMKA 4W1WA 1TATA 1V2EA 2D7ZA 5TF5A 4OMAA 1J04A 2ZP7A 3FQAA 4BA5A 1BJWA 2W8WA 3G0TA 1I43A 5M46A 3D6KA 1IUGA 4IX8A 1GEXA 3ISLA 1WYVA 4JEWA 1MAPA 1JF9A 2D63A 4HVKA 3KKIA 3DYDA 1KKPA 1IAYA 1B9IA 1WYTB 1FC4A 1AHFA 1ZODA 3TATA 1RV4A 2HUUA 2PB0A 2TPLA 3GZDC 2WB6A 3N5MA 1CQ7A 1LW4A 4WXGA 4CVQA 3L8AA 1C7GA 3FKDA 4XJOA 2AY9A 2HUFA 3PA9A 4E3QA 2BI9A 2ZC0A 3GZDA 1M0OA 5EIGA 4W5KA 2W7EA 3TCMA 1G7WA 3LVLB 3FVSA 3NYUA 5LHAA 1AMSA 2VLFA 4OTLA 2EO5A 5F8VA 3AEJA 4WD2A 2BIGA 1S0AA 2G6WA 3JW9A 2ZY4A 1WYTA 5EAVA 4ZDPA 3R4TA 4A6TA 2YKVA 4A0FA 2R5CA 4KAMA 5FT6A 2FM1A 3DXWA 1D2FA 3FTBA 3FDBA 4ZAHA 4WYGA 3ECDA 5DJ1A 1AAMA 3JTXA 3LG0A 3AEJC 3M5UA 3PDXA 4GE7A 3GWPA 3RBFA 1DKAA 4IXOA 4MQQA 1S06A 1AHEA 3NU8A 2VYCA 3ELPA 4U2HA 3BWNA 1ARHA 3BC8A 3HLMA 1BJ4A 1ASNA 1AY4A 4W91A 3RUYA 1OHWA 2YKUA 2HOZA 3A9XA 1UU0A 3QN6A 1YAAA 1GC3A 4ZLVA 3G8MA 4JEVA 1O69A 3VOMA 4OYTA 3VP6A 2W8UA 1O4SA 1ASCA 2PO3A 1YJZA 4GE9A 1SPAA 4LNJA 3DXVA 1ORDA 1UKJA 1ASAA 2VMWA 1SF2A 1TOGA 4RM1A 1C7OA 3LV2A 4K05A 3OKSA 1ASDA 2W8JA 2E7IA 1ARSA 1KL1A 1AKBA 5HXXA 4IXZA 4ZWMA 3NUBA 1QIRA 1M4NA 2C81A 3GZCA 4GSAA 4JEZA 1XEYA 3MAFA 2BWPA 2D7YA 1G4VA 3DODA 3AENA 1AIAA 4P3MA 3TQXA 3WGBA 4F5KA 3UE8A 1B8GA 1SZKA 1YJSA 4RKDA 2AY1A 4MGRA 3DZZA 4ATQA 2E7JA 2E7UA 2CB1A 2QB3A 1N31A 2OQXA 2X3LA 1CL1A 1GC4A 1RVUA 4GDYA 3RCHB 5KTBA 3BWOA 3FZ8A 3QI6A 3PD6B 2C0RA 1W7MA 5G09A 3JU7A 2VI8A 2Z9UA 4Q6RA 5G4JA 3G7QA 2GSAA 2W7GA 3I5TA 3W1HA 3ZZJA 2QMAA 2W7FA 2DGLA 2VIAA 2VMOA 4ZDLA 1ASLA 2VLHA 4ADDA 4EFFA 3LWSA 1AHYA 2YRIA 1TOIA 1WYVB 3CAIA 4R2NA 4F5IA 4CXQA 4N0WA 3BV0A 4O6ZA 3N7NA 4CBSA 1P3WA 1X2AA 2OATA 3MBBA 4A0GA 4BHDA 1B5PA 3PDBB 4TMRA 2VGZA 3GETA 3H9XA 3TFUA 1MAQA 1BKGA 3WZFA 1D7RA 2AY4A 4XJLA 4K2MA 1PFFA 1CS1A 3VK3A 1CZCA 1H1CA 1J32A 2W7LA 3EI9A 3F6TA 4XAUA 3F9TA 3DR4A 4MSOA 2Z1ZA 1YJYA 3WGCA 4F5MA 4JEXA 3FZ7A 4EB7A 2VGUA 2HP1A 5DB5A 1S08A 2O7CA 2PB2A 5E3KA 5M4BA 4E77A 3ACZA 2VIBA 1SZSA 3NNKA 1GBNA 4TN4A 4CXRA 4ZM4A 1M32A 1SVVA 3AEPA 1DJ9A 3WY7A 5D5SA 4MKKA 1E5EA 1O61A 3MC6C 7AATA 2ZY2A 1MDOA 1LKCA 2ZYJA 3GJUA 3RBLA 1AHXA 9AATA 3DRDA 4WXFA 5HDMA 2DKBA 2JJEA 2QA3A 3F0HA 3WLXA 4W1XA 4OT8A 1QISA 1C0NA 4F5FA 1OATA 3AV7A 1S09A 2Z1YA 4LW2A 1GC2A 4E1OA 2AATA 3HL2A 3ZRQA 3E77A 1AIBA 2AEVA 4ITXA 1C7NA 4MKJA 2EYQA 2WK9A 3EIBA 2W7JA 4JEYA 5EIGB 1OXPA 3HDOA 4IYOA 2OKKA 4OCAA 3EUCA 1LK9A 1ASGA 1KKJA 4U1TA 3QGUA 5FT8A 4BA4A 1ASMA 4R8DA 1QJ5A 4B9BA 3LVKA 1M0QA 3B8XA 5LH9A 2JJFA 4AO9A 1M6SA 5F9SA 2R5CB 2VGVA 2W7MA 3PIUA 2R2NA 3FVUA 2BI1A 1AMRA 3P6KA 2EZ1A 2CTZA 2BYLA 3RCHA 3K40A 2DGMA 3QPGA 5G2QA 5I92A 1AKCA 2O0RA 1B4XA 3HT4A 1I29A 3WKRA 1ASEA 1AX4A 2YOBA 4M2MA 3R9AA 2QB2A 4L0OA 3AEMA 3MEBA 3ZRPA 2W8TA 3QHXA 2HP2A 2Z9XA 3LVJA 1AY8A 2JJGA 3GSBA 4Q75A 5E5IA 2GQNA 2CINA 2DR1A 2Z61A 3VK2A 3NRAA 1W3UA 1M7YA 1M0NA 4JE5D 3PDBA 1G7XA 3FZ6A 4EB5A 4QGRA 1AKAA 5G0AA 2YHKA 1C4KA 3NYSA 4PFNA 1IBJA 2YRRA 4R5FA 5D95A 3CQ6A 4LC3A 1DJUA 4LNLA 2R5EA 5HHYA 3WKSA 4WLJA 4WYDA 2CJDA 2AY8A 2G7JA 1BS0A 4GRXA 4ZSYA 1C9CA 3ASAA 1ASFA 4EU1A 4BMKA 2FN6A 4J5UA 1B9HA 4A0HA 4TV7A 4AO4A 2QSRA 1E5FA 2HOYA 2W7DA 1CZEA 2BIAA 2VI9A 3LY1A 3NX3A 4W1VA 2W7HA 2VMPA 3B1EA 3CQ4A 3H14A 4JF1A 1YIYA 3PAAA 3EI8A 1FG7A 4RKCA 4UHNA 4K2BA 5DJ9A 1IX6A 1OXOA 4KXKA 2FYFA 1LW5A 1ELUA 1MDXA 5G2PA 2F8JA 3H7FA 4KYOA 4JE5A 1W23A 2GB3A 2WK7A 3NDNA 4LW4A 4E3RA 1WYUA 3FCRA 1UU2A 1ZOBA 2VMTA 1DFOA 1N2TA 1KMJA 3VAXA 4RJYA 1SZUA 3AOWA 3NYTA 2HUIA 3A9YA 3N4SA 2JISA 2WK8A 2C44A 2AY6A 4ZDOA 1QITA 2AY7A 4RIZA 1M0PA 1W7LA 3ELEA 4WYAA 1IJIA 3WCOA 2XH1A 3FRKA 1AJRA 3N4XA 4Q31A 1H0CA 1JS3A 2VMRA 3EI6A 1I48A 1AAWA 2YKXA 3OP7A 3KGWA 4LNMA 4Y0HA 2DKJA 2ZY5A 1WYUB 2V1PA 1XI9A 2FQ6A 2W7IA 2JJHA 2BI5A 3E6GA 5FT4A 1WKGA 3DR7A 4WYEA 4Y0DA 1VP4A 2AY5A 1WSTA 4R5ZA 3I4JA 1FG3A 1TPLA 3QBOA 1BJOA 3RI6A 2EZ2A 4RJ0A 2GMUA 3COGA 3BN1A 3A8UX 1B5OA 1D7VA 2BIEA 2BWNA 4ADCA 4OC9A 2D64A 4A0RA 1PMOA 1KL2A 3ATHA 2BI3A 3ZRRA 2HZPA 4H51A 3NTJA 2DOUA 4N0BA 3K7YA 2FNIA 4I8AA 3MKJA 1Y4IA 5EUEA 3B46A 3NU7A 2Z9WA 4IY7A 2YCNA 1EQBA 4PFFA 4ZWVA 3BCXA 4AZKA 3KGXA 3JWAA 2CH1A 1EJIA 1GD9A 4OBVA 3UAKA 2Z67A 3L44A 1GEYA 1MLZA 3CBFA 4GE4A 2W8VA 1ASBA 1D7SA 2YCPA 3IF2A 2QLRA 4OBUA 4FL0A 4AH3A 1BW0A 5EUNA 5M4DA 3N4RA 4P7YA 3B1CA 4XJMA 2VMYA 1T3IA 1BT4A 4ATPA 3FSLA 2CH2A 1TASA 1DJEA
chains in the Genus database with same CATH topology
3CQ5A 4NOGA 4WXBA 1CL2A 2VGTA 3MAFB 2Z9VA 3B1DA 1W7NA 4IW7A 3AENB 3EI5A 1JG8A 3W1IA 2OGEA 4XEWA 3II0A 3PJ0A 3UWCA 4F5GA 1ECXA 3E2ZB 4Y0IA 4FFCA 2W7KA 3N75A 3HMUA 1GEWA 3PD6A 4RAEA 4MQPA 2ZUKA 5JAYA 2D66A 2CJGA 3EI7A 4XJPA 4A6UA 3IHJA 3FVXA 4BQ0A 2CJHA 1N8PA 2ORDA 3BWNC 1AICA 3EIAA 3Q8NA 2D5YA 1IVRA 3AEMC 5EFSA 3FQ7A 1ARTA 4H63Q 2CFBA 2ZSMA 3NUIA 3FDDA 2D65A 3ZZKA 2CY8A 2X8UA 3RQ1A 5C6UA 4UQVA 1X0MA 1LC8A 5K8BA 2OKJA 2VMSA 3E9KA 3MC6A 2CANA 2GMSA 3A9ZA 3DU4A 1GDEA 2AY3A 1V72A 2ZY3A 4AZJA 2BI2A 2DGKA 2HORA 1YNUA 3ASBA 1GC0A 1ARIA 1LC5A 1IX7A 3HVYA 3N0LA 3T32A 1BJOB 3EZSA 4W8IA 3JWBA 4UHOA 1YOOA 4PVFA 1V2FA 4ADBA 4DBCA 3HQTA 3JZLA 2E54A 4WBTA 3I16A 4IXSA 4CBRA 4IYOB 4WYCA 2WKAA 1RV3A 2YKYA 3QM2A 1D7UA 2Z20A 3GBXA 2VMQA 1WKHA 1DGEA 5EUDA 4XQ2A 2BKWA 5EQCA 2NMPA 1AMAA 4MQRA 1S07A 5J8QA 3FQ8A 5AX8A 1OHYA 4ZASA 2Q7WA 2BHXA 2X5FA 2XBNA 2OGAA 1ARGA 1IX8A 1AY5A 1SFFA 3WX9A 3KE3A 3E2FA 2BYJA 1IAXA 2AY2A 3WCNA 2FNUA 2EGYA 5G4IA 1AMQA 3FD0A 1MGVA 4RLGA 1Z3ZA 3K28A 5E4ZA 1AJSA 4WB0B 4WLHA 2VMNA 1QGNA 1CQ6A 2QBTA 1QJ3A 2ZJGA 4EMYA 2X5DA 1AJSB 2JG2A 1X28A 4WB0A 3A2BA 5DX5A 3AOVA 3W1JA 2VMZA 4ZSWA 4PIWA 5BJ3A 2R0TA 3AELA 3P1TA 4A00A 4WP0A 1V2DA 1QZ9A 2RFVA 3MADA 4F5LA 1AHGA 2EPJA 2FKIA 4ISYA 1JS6A 3PPLA 2JGTA 2VMXA 4GEBA 2YCTA 3GR9A 3PGYA 2KFPA 4JF0A 3EZ1A 3E2YA 4RITA 3FFRA 4ITGA 4K2IA 4DGTA 2D61A 3FFHA 4ADEA 1Z7DA 1VJOA 4WYFA 2VMUA 4B98A 1O62A 1G4XA 3MAUA 3TFTA 2AEUA 3BS8A 1PG8A 2BWOA 1CJ0A 4M2KA 1EG5A 3BCAA 4A6RA 4F4EA 4F5HA 3AATA 1DTYA 3HBXA 4DQ6A 1ZC9A 1YIZA 1TOEA 1U08A 2ZSLA 5IWQA 1TOKA 2V0YA 3BB8A 1TARA 1UU1A 1X29A 3LVMA 4F5JA 3USFA 4AOAA 4UHMA 5M49A 4M2JA 1RVYA 1VEFA 2EH6A 3E2ZA 4MY5A 5FT5A 1MLYA 1DGDA 4HF8A 4A72A 1BJNA 1MDZA 2VGWA 4Q76A 3DC1A 1GCKA 3BCBA 4XK1A 5BJ4A 4ZM3A 2A1VA 1TOJA 4UOYA 1BQDA 2C7TA 8AATA 2CSTA 5EAAA 3VK4A 1CQ8A 3AEOA 1OHVA 1LS3A 1LC7A 2VMVA 1BQAA 2HOXA 4J8LA 2O1BA 1PMMA 2VGSA 1I41A 1ELQA 1KMKA 4W1WA 1TATA 1V2EA 2D7ZA 5TF5A 4OMAA 1J04A 2ZP7A 3FQAA 4BA5A 1BJWA 2W8WA 3G0TA 1I43A 5M46A 3D6KA 1IUGA 4IX8A 1GEXA 3ISLA 1WYVA 4JEWA 1MAPA 1JF9A 2D63A 4HVKA 3KKIA 3DYDA 1KKPA 1IAYA 1B9IA 1WYTB 1FC4A 1AHFA 1ZODA 3TATA 1RV4A 2HUUA 2PB0A 2TPLA 3GZDC 2WB6A 3N5MA 1CQ7A 1LW4A 4WXGA 4CVQA 3L8AA 1C7GA 3FKDA 4XJOA 2AY9A 2HUFA 3PA9A 4E3QA 2BI9A 2ZC0A 3GZDA 1M0OA 5EIGA 4W5KA 2W7EA 3TCMA 1G7WA 3LVLB 3FVSA 3NYUA 5LHAA 1AMSA 2VLFA 4OTLA 2EO5A 5F8VA 3AEJA 4WD2A 2BIGA 1S0AA 2G6WA 3JW9A 2ZY4A 1WYTA 5EAVA 4ZDPA 3R4TA 4A6TA 2YKVA 4A0FA 2R5CA 4KAMA 5FT6A 2FM1A 3DXWA 1D2FA 3FTBA 3FDBA 4ZAHA 4WYGA 3ECDA 5DJ1A 1AAMA 3JTXA 3LG0A 3AEJC 3M5UA 3PDXA 4GE7A 3GWPA 3RBFA 1DKAA 4IXOA 4MQQA 1S06A 1AHEA 3NU8A 2VYCA 3ELPA 4U2HA 3BWNA 1ARHA 3BC8A 3HLMA 1BJ4A 1ASNA 1AY4A 4W91A 3RUYA 1OHWA 2YKUA 2HOZA 3A9XA 1UU0A 3QN6A 1YAAA 1GC3A 4ZLVA 3G8MA 4JEVA 1O69A 3VOMA 4OYTA 3VP6A 2W8UA 1O4SA 1ASCA 2PO3A 1YJZA 4GE9A 1SPAA 4LNJA 3DXVA 1ORDA 1UKJA 1ASAA 2VMWA 1SF2A 1TOGA 4RM1A 1C7OA 3LV2A 4K05A 3OKSA 1ASDA 2W8JA 2E7IA 1ARSA 1KL1A 1AKBA 5HXXA 4IXZA 4ZWMA 3NUBA 1QIRA 1M4NA 2C81A 3GZCA 4GSAA 4JEZA 1XEYA 3MAFA 2BWPA 2D7YA 1G4VA 3DODA 3AENA 1AIAA 4P3MA 3TQXA 3WGBA 4F5KA 3UE8A 1B8GA 1SZKA 1YJSA 4RKDA 2AY1A 4MGRA 3DZZA 4ATQA 2E7JA 2E7UA 2CB1A 2QB3A 1N31A 2OQXA 2X3LA 1CL1A 1GC4A 1RVUA 4GDYA 3RCHB 5KTBA 3BWOA 3FZ8A 3QI6A 3PD6B 2C0RA 1W7MA 5G09A 3JU7A 2VI8A 2Z9UA 4Q6RA 5G4JA 3G7QA 2GSAA 2W7GA 3I5TA 3W1HA 3ZZJA 2QMAA 2W7FA 2DGLA 2VIAA 2VMOA 4ZDLA 1ASLA 2VLHA 4ADDA 4EFFA 3LWSA 1AHYA 2YRIA 1TOIA 1WYVB 3CAIA 4R2NA 4F5IA 4CXQA 4N0WA 3BV0A 4O6ZA 3N7NA 4CBSA 1P3WA 1X2AA 2OATA 3MBBA 4A0GA 4BHDA 1B5PA 3PDBB 4TMRA 2VGZA 3GETA 3H9XA 3TFUA 1MAQA 1BKGA 3WZFA 1D7RA 2AY4A 4XJLA 4K2MA 1PFFA 1CS1A 3VK3A 1CZCA 1H1CA 1J32A 2W7LA 3EI9A 3F6TA 4XAUA 3F9TA 3DR4A 4MSOA 2Z1ZA 1YJYA 3WGCA 4F5MA 4JEXA 3FZ7A 4EB7A 2VGUA 2HP1A 5DB5A 1S08A 2O7CA 2PB2A 5E3KA 5M4BA 4E77A 3ACZA 2VIBA 1SZSA 3NNKA 1GBNA 4TN4A 4CXRA 4ZM4A 1M32A 1SVVA 3AEPA 1DJ9A 3WY7A 5D5SA 4MKKA 1E5EA 1O61A 3MC6C 7AATA 2ZY2A 1MDOA 1LKCA 2ZYJA 3GJUA 3RBLA 1AHXA 9AATA 3DRDA 4WXFA 5HDMA 2DKBA 2JJEA 2QA3A 3F0HA 3WLXA 4W1XA 4OT8A 1QISA 1C0NA 4F5FA 1OATA 3AV7A 1S09A 2Z1YA 4LW2A 1GC2A 4E1OA 2AATA 3HL2A 3ZRQA 3E77A 1AIBA 2AEVA 4ITXA 1C7NA 4MKJA 2EYQA 2WK9A 3EIBA 2W7JA 4JEYA 5EIGB 1OXPA 3HDOA 4IYOA 2OKKA 4OCAA 3EUCA 1LK9A 1ASGA 1KKJA 4U1TA 3QGUA 5FT8A 4BA4A 1ASMA 4R8DA 1QJ5A 4B9BA 3LVKA 1M0QA 3B8XA 5LH9A 2JJFA 4AO9A 1M6SA 5F9SA 2R5CB 2VGVA 2W7MA 3PIUA 2R2NA 3FVUA 2BI1A 1AMRA 3P6KA 2EZ1A 2CTZA 2BYLA 3RCHA 3K40A 2DGMA 3QPGA 5G2QA 5I92A 1AKCA 2O0RA 1B4XA 3HT4A 1I29A 3WKRA 1ASEA 1AX4A 2YOBA 4M2MA 3R9AA 2QB2A 4L0OA 3AEMA 3MEBA 3ZRPA 2W8TA 3QHXA 2HP2A 2Z9XA 3LVJA 1AY8A 2JJGA 3GSBA 4Q75A 5E5IA 2GQNA 2CINA 2DR1A 2Z61A 3VK2A 3NRAA 1W3UA 1M7YA 1M0NA 4JE5D 3PDBA 1G7XA 3FZ6A 4EB5A 4QGRA 1AKAA 5G0AA 2YHKA 1C4KA 3NYSA 4PFNA 1IBJA 2YRRA 4R5FA 5D95A 3CQ6A 4LC3A 1DJUA 4LNLA 2R5EA 5HHYA 3WKSA 4WLJA 4WYDA 2CJDA 2AY8A 2G7JA 1BS0A 4GRXA 4ZSYA 1C9CA 3ASAA 1ASFA 4EU1A 4BMKA 2FN6A 4J5UA 1B9HA 4A0HA 4TV7A 4AO4A 2QSRA 1E5FA 2HOYA 2W7DA 1CZEA 2BIAA 2VI9A 3LY1A 3NX3A 4W1VA 2W7HA 2VMPA 3B1EA 3CQ4A 3H14A 4JF1A 1YIYA 3PAAA 3EI8A 1FG7A 4RKCA 4UHNA 4K2BA 5DJ9A 1IX6A 1OXOA 4KXKA 2FYFA 1LW5A 1ELUA 1MDXA 5G2PA 2F8JA 3H7FA 4KYOA 4JE5A 1W23A 2GB3A 2WK7A 3NDNA 4LW4A 4E3RA 1WYUA 3FCRA 1UU2A 1ZOBA 2VMTA 1DFOA 1N2TA 1KMJA 3VAXA 4RJYA 1SZUA 3AOWA 3NYTA 2HUIA 3A9YA 3N4SA 2JISA 2WK8A 2C44A 2AY6A 4ZDOA 1QITA 2AY7A 4RIZA 1M0PA 1W7LA 3ELEA 4WYAA 1IJIA 3WCOA 2XH1A 3FRKA 1AJRA 3N4XA 4Q31A 1H0CA 1JS3A 2VMRA 3EI6A 1I48A 1AAWA 2YKXA 3OP7A 3KGWA 4LNMA 4Y0HA 2DKJA 2ZY5A 1WYUB 2V1PA 1XI9A 2FQ6A 2W7IA 2JJHA 2BI5A 3E6GA 5FT4A 1WKGA 3DR7A 4WYEA 4Y0DA 1VP4A 2AY5A 1WSTA 4R5ZA 3I4JA 1FG3A 1TPLA 3QBOA 1BJOA 3RI6A 2EZ2A 4RJ0A 2GMUA 3COGA 3BN1A 3A8UX 1B5OA 1D7VA 2BIEA 2BWNA 4ADCA 4OC9A 2D64A 4A0RA 1PMOA 1KL2A 3ATHA 2BI3A 3ZRRA 2HZPA 4H51A 3NTJA 2DOUA 4N0BA 3K7YA 2FNIA 4I8AA 3MKJA 1Y4IA 5EUEA 3B46A 3NU7A 2Z9WA 4IY7A 2YCNA 1EQBA 4PFFA 4ZWVA 3BCXA 4AZKA 3KGXA 3JWAA 2CH1A 1EJIA 1GD9A 4OBVA 3UAKA 2Z67A 3L44A 1GEYA 1MLZA 3CBFA 4GE4A 2W8VA 1ASBA 1D7SA 2YCPA 3IF2A 2QLRA 4OBUA 4FL0A 4AH3A 1BW0A 5EUNA 5M4DA 3N4RA 4P7YA 3B1CA 4XJMA 2VMYA 1T3IA 1BT4A 4ATPA 3FSLA 2CH2A 1TASA 1DJEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQ5 A;  4NOG A;  4WXB A;  1CL2 A;  2VGT A;  3MAF B;  2Z9V A;  3B1D A;  1W7N A;  4IW7 A;  3AEN B;  3EI5 A;  1JG8 A;  3W1I A;  2OGE A;  4XEW A;  3II0 A;  3PJ0 A;  3UWC A;  4F5G A;  1ECX A;  3E2Z B;  4Y0I A;  4FFC A;  2W7K A;  3N75 A;  3HMU A;  1GEW A;  3PD6 A;  4RAE A;  4MQP A;  2ZUK A;  5JAY A;  2D66 A;  2CJG A;  3EI7 A;  4XJP A;  4A6U A;  3IHJ A;  3FVX A;  4BQ0 A;  2CJH A;  1N8P A;  2ORD A;  3BWN C;  1AIC A;  3EIA A;  3Q8N A;  2D5Y A;  1IVR A;  3AEM C;  5EFS A;  3FQ7 A;  1ART A;  2CFB A;  2ZSM A;  3NUI A;  3FDD A;  2D65 A;  3ZZK A;  2CY8 A;  2X8U A;  3RQ1 A;  5C6U A;  4UQV A;  1X0M A;  1LC8 A;  5K8B A;  2OKJ A;  2VMS A;  3E9K A;  3MC6 A;  2CAN A;  2GMS A;  3A9Z A;  3DU4 A;  1GDE A;  2AY3 A;  1V72 A;  2ZY3 A;  4AZJ A;  2BI2 A;  2DGK A;  2HOR A;  1YNU A;  3ASB A;  1GC0 A;  1ARI A;  1LC5 A;  1IX7 A;  3HVY A;  3N0L A;  3T32 A;  1BJO B;  3EZS A;  4W8I A;  3JWB A;  4UHO A;  1YOO A;  4PVF A;  1V2F A;  4ADB A;  4DBC A;  3HQT A;  3JZL A;  2E54 A;  4WBT A;  3I16 A;  4IXS A;  4CBR A;  4IYO B;  4WYC A;  2WKA A;  1RV3 A;  2YKY A;  3QM2 A;  1D7U A;  2Z20 A;  3GBX A;  2VMQ A;  1WKH A;  1DGE A;  5EUD A;  4XQ2 A;  2BKW A;  5EQC A;  2NMP A;  1AMA A;  4MQR A;  1S07 A;  5J8Q A;  3FQ8 A;  5AX8 A;  1OHY A;  4ZAS A;  2Q7W A;  2BHX A;  2X5F A;  2XBN A;  2OGA A;  1ARG A;  1IX8 A;  1AY5 A;  1SFF A;  3WX9 A;  3KE3 A;  3E2F A;  2BYJ A;  1IAX A;  2AY2 A;  3WCN A;  2FNU A;  2EGY A;  5G4I A;  1AMQ A;  3FD0 A;  1MGV A;  4RLG A;  1Z3Z A;  3K28 A;  5E4Z A;  1AJS A;  4WB0 B;  4WLH A;  2VMN A;  1QGN A;  1CQ6 A;  2QBT A;  1QJ3 A;  2ZJG A;  4EMY A;  2X5D A;  1AJS B;  2JG2 A;  1X28 A;  4WB0 A;  3A2B A;  5DX5 A;  3AOV A;  3W1J A;  2VMZ A;  4ZSW A;  4PIW A;  5BJ3 A;  2R0T A;  3AEL A;  3P1T A;  4A00 A;  4WP0 A;  1V2D A;  1QZ9 A;  2RFV A;  3MAD A;  4F5L A;  1AHG A;  2EPJ A;  4ISY A;  1JS6 A;  3PPL A;  2JGT A;  2VMX A;  4GEB A;  2YCT A;  3GR9 A;  3PGY A;  4JF0 A;  3EZ1 A;  3E2Y A;  4RIT A;  3FFR A;  4ITG A;  4K2I A;  4DGT A;  2D61 A;  3FFH A;  4ADE A;  1Z7D A;  1VJO A;  4WYF A;  2VMU A;  4B98 A;  1O62 A;  1G4X A;  3MAU A;  3TFT A;  2AEU A;  3BS8 A;  1PG8 A;  2BWO A;  1CJ0 A;  4M2K A;  1EG5 A;  3BCA A;  4A6R A;  4F4E A;  4F5H A;  3AAT A;  1DTY A;  3HBX A;  4DQ6 A;  1ZC9 A;  1YIZ A;  1TOE A;  1U08 A;  2ZSL A;  5IWQ A;  1TOK A;  2V0Y A;  3BB8 A;  1TAR A;  1UU1 A;  1X29 A;  3LVM A;  4F5J A;  3USF A;  4AOA A;  4UHM A;  5M49 A;  4M2J A;  1RVY A;  1VEF A;  2EH6 A;  3E2Z A;  4MY5 A;  5FT5 A;  1MLY A;  1DGD A;  4HF8 A;  4A72 A;  1BJN A;  1MDZ A;  2VGW A;  4Q76 A;  3DC1 A;  1GCK A;  3BCB A;  4XK1 A;  5BJ4 A;  4ZM3 A;  1TOJ A;  4UOY A;  1BQD A;  2C7T A;  8AAT A;  2CST A;  5EAA A;  3VK4 A;  1CQ8 A;  3AEO A;  1OHV A;  1LS3 A;  1LC7 A;  2VMV A;  1BQA A;  2HOX A;  4J8L A;  2O1B A;  1PMM A;  2VGS A;  1I41 A;  1ELQ A;  1KMK A;  4W1W A;  1TAT A;  1V2E A;  2D7Z A;  5TF5 A;  4OMA A;  1J04 A;  2ZP7 A;  3FQA A;  4BA5 A;  1BJW A;  2W8W A;  3G0T A;  1I43 A;  5M46 A;  3D6K A;  1IUG A;  4IX8 A;  1GEX A;  3ISL A;  1WYV A;  4JEW A;  1MAP A;  1JF9 A;  2D63 A;  4HVK A;  3KKI A;  3DYD A;  1KKP A;  1IAY A;  1B9I A;  1WYT B;  1FC4 A;  1AHF A;  1ZOD A;  3TAT A;  1RV4 A;  2HUU A;  2PB0 A;  2TPL A;  3GZD C;  3N5M A;  1CQ7 A;  1LW4 A;  4WXG A;  4CVQ A;  3L8A A;  1C7G A;  3FKD A;  4XJO A;  2AY9 A;  2HUF A;  3PA9 A;  4E3Q A;  2BI9 A;  2ZC0 A;  3GZD A;  1M0O A;  5EIG A;  4W5K A;  2W7E A;  3TCM A;  1G7W A;  3LVL B;  3FVS A;  3NYU A;  5LHA A;  1AMS A;  2VLF A;  4OTL A;  2EO5 A;  5F8V A;  3AEJ A;  4WD2 A;  2BIG A;  1S0A A;  2G6W A;  3JW9 A;  2ZY4 A;  1WYT A;  5EAV A;  4ZDP A;  3R4T A;  4A6T A;  2YKV A;  4A0F A;  2R5C A;  4KAM A;  5FT6 A;  2FM1 A;  3DXW A;  1D2F A;  3FTB A;  3FDB A;  4ZAH A;  4WYG A;  3ECD A;  5DJ1 A;  1AAM A;  3JTX A;  3LG0 A;  3AEJ C;  3M5U A;  3PDX A;  4GE7 A;  3GWP A;  3RBF A;  1DKA A;  4IXO A;  4MQQ A;  1S06 A;  1AHE A;  3NU8 A;  2VYC A;  3ELP A;  4U2H A;  3BWN A;  1ARH A;  3BC8 A;  3HLM A;  1BJ4 A;  1ASN A;  1AY4 A;  4W91 A;  3RUY A;  1OHW A;  2YKU A;  2HOZ A;  3A9X A;  1UU0 A;  3QN6 A;  1YAA A;  1GC3 A;  4ZLV A;  3G8M A;  4JEV A;  1O69 A;  3VOM A;  4OYT A;  3VP6 A;  2W8U A;  1O4S A;  1ASC A;  2PO3 A;  1YJZ A;  4GE9 A;  1SPA A;  4LNJ A;  3DXV A;  1ORD A;  1UKJ A;  1ASA A;  2VMW A;  1SF2 A;  1TOG A;  4RM1 A;  1C7O A;  3LV2 A;  3OKS A;  1ASD A;  2W8J A;  2E7I A;  1ARS A;  1KL1 A;  1AKB A;  5HXX A;  4IXZ A;  4ZWM A;  3NUB A;  1QIR A;  1M4N A;  2C81 A;  3GZC A;  4GSA A;  4JEZ A;  1XEY A;  3MAF A;  2BWP A;  2D7Y A;  1G4V A;  3DOD A;  3AEN A;  1AIA A;  4P3M A;  3TQX A;  3WGB A;  4F5K A;  3UE8 A;  1B8G A;  1SZK A;  1YJS A;  4RKD A;  2AY1 A;  4MGR A;  3DZZ A;  4ATQ A;  2E7J A;  2E7U A;  2CB1 A;  2QB3 A;  1N31 A;  2OQX A;  2X3L A;  1CL1 A;  1GC4 A;  1RVU A;  4GDY A;  3RCH B;  3BWO A;  3FZ8 A;  3QI6 A;  3PD6 B;  2C0R A;  1W7M A;  5G09 A;  3JU7 A;  2VI8 A;  2Z9U A;  4Q6R A;  5G4J A;  3G7Q A;  2GSA A;  2W7G A;  3I5T A;  3W1H A;  3ZZJ A;  2QMA A;  2W7F A;  2DGL A;  2VIA A;  2VMO A;  4ZDL A;  1ASL A;  2VLH A;  4ADD A;  4EFF A;  3LWS A;  1AHY A;  2YRI A;  1TOI A;  1WYV B;  3CAI A;  4R2N A;  4F5I A;  4CXQ A;  4N0W A;  3BV0 A;  4O6Z A;  4CBS A;  1P3W A;  1X2A A;  2OAT A;  3MBB A;  4A0G A;  4BHD A;  1B5P A;  3PDB B;  4TMR A;  2VGZ A;  3GET A;  3TFU A;  1MAQ A;  1BKG A;  3WZF A;  1D7R A;  2AY4 A;  4XJL A;  4K2M A;  1PFF A;  1CS1 A;  3VK3 A;  1CZC A;  1H1C A;  1J32 A;  2W7L A;  3EI9 A;  3F6T A;  4XAU A;  3F9T A;  3DR4 A;  4MSO A;  2Z1Z A;  1YJY A;  3WGC A;  4F5M A;  4JEX A;  3FZ7 A;  4EB7 A;  2VGU A;  2HP1 A;  5DB5 A;  1S08 A;  2O7C A;  2PB2 A;  5E3K A;  5M4B A;  4E77 A;  3ACZ A;  2VIB A;  1SZS A;  3NNK A;  1GBN A;  4TN4 A;  4CXR A;  4ZM4 A;  1M32 A;  1SVV A;  3AEP A;  1DJ9 A;  3WY7 A;  5D5S A;  4MKK A;  1E5E A;  1O61 A;  3MC6 C;  7AAT A;  2ZY2 A;  1MDO A;  1LKC A;  2ZYJ A;  3GJU A;  3RBL A;  1AHX A;  9AAT A;  3DRD A;  4WXF A;  5HDM A;  2DKB A;  2JJE A;  2QA3 A;  3F0H A;  3WLX A;  4W1X A;  4OT8 A;  1QIS A;  1C0N A;  4F5F A;  1OAT A;  3AV7 A;  1S09 A;  2Z1Y A;  4LW2 A;  1GC2 A;  4E1O A;  2AAT A;  3HL2 A;  3ZRQ A;  3E77 A;  1AIB A;  2AEV A;  4ITX A;  1C7N A;  4MKJ A;  2WK9 A;  3EIB A;  2W7J A;  4JEY A;  5EIG B;  1OXP A;  3HDO A;  4IYO A;  2OKK A;  4OCA A;  3EUC A;  1LK9 A;  1ASG A;  1KKJ A;  4U1T A;  3QGU A;  5FT8 A;  4BA4 A;  1ASM A;  4R8D A;  1QJ5 A;  4B9B A;  3LVK A;  1M0Q A;  3B8X A;  5LH9 A;  2JJF A;  4AO9 A;  1M6S A;  5F9S A;  2R5C B;  2VGV A;  2W7M A;  3PIU A;  2R2N A;  3FVU A;  2BI1 A;  1AMR A;  3P6K A;  2EZ1 A;  2CTZ A;  2BYL A;  3RCH A;  3K40 A;  2DGM A;  3QPG A;  5G2Q A;  5I92 A;  1AKC A;  2O0R A;  1B4X A;  3HT4 A;  1I29 A;  3WKR A;  1ASE A;  1AX4 A;  2YOB A;  4M2M A;  3R9A A;  2QB2 A;  4L0O A;  3AEM A;  3MEB A;  3ZRP A;  2W8T A;  3QHX A;  2HP2 A;  2Z9X A;  3LVJ A;  1AY8 A;  2JJG A;  3GSB A;  4Q75 A;  5E5I A;  2GQN A;  2CIN A;  2DR1 A;  2Z61 A;  3VK2 A;  3NRA A;  1W3U A;  1M7Y A;  1M0N A;  4JE5 D;  3PDB A;  1G7X A;  3FZ6 A;  4EB5 A;  4QGR A;  1AKA A;  5G0A A;  2YHK A;  1C4K A;  3NYS A;  4PFN A;  1IBJ A;  2YRR A;  4R5F A;  5D95 A;  3CQ6 A;  4LC3 A;  1DJU A;  4LNL A;  2R5E A;  5HHY A;  3WKS A;  4WLJ A;  4WYD A;  2CJD A;  2AY8 A;  1BS0 A;  4GRX A;  4ZSY A;  1C9C A;  3ASA A;  1ASF A;  4EU1 A;  4BMK A;  2FN6 A;  4J5U A;  1B9H A;  4A0H A;  4TV7 A;  4AO4 A;  1E5F A;  2HOY A;  2W7D A;  1CZE A;  2BIA A;  2VI9 A;  3LY1 A;  3NX3 A;  4W1V A;  2W7H A;  2VMP A;  3B1E A;  3CQ4 A;  3H14 A;  4JF1 A;  1YIY A;  3PAA A;  3EI8 A;  1FG7 A;  4RKC A;  4UHN A;  4K2B A;  5DJ9 A;  1IX6 A;  1OXO A;  4KXK A;  2FYF A;  1LW5 A;  1ELU A;  1MDX A;  5G2P A;  2F8J A;  3H7F A;  4KYO A;  4JE5 A;  1W23 A;  2GB3 A;  2WK7 A;  3NDN A;  4LW4 A;  4E3R A;  1WYU A;  3FCR A;  1UU2 A;  1ZOB A;  2VMT A;  1DFO A;  1N2T A;  1KMJ A;  3VAX A;  4RJY A;  1SZU A;  3AOW A;  3NYT A;  2HUI A;  3A9Y A;  2JIS A;  2WK8 A;  2C44 A;  2AY6 A;  4ZDO A;  1QIT A;  2AY7 A;  4RIZ A;  1M0P A;  1W7L A;  3ELE A;  4WYA A;  1IJI A;  3WCO A;  2XH1 A;  3FRK A;  1AJR A;  4Q31 A;  1H0C A;  1JS3 A;  2VMR A;  3EI6 A;  1I48 A;  1AAW A;  2YKX A;  3OP7 A;  3KGW A;  4LNM A;  4Y0H A;  2DKJ A;  2ZY5 A;  1WYU B;  2V1P A;  1XI9 A;  2FQ6 A;  2W7I A;  2JJH A;  2BI5 A;  3E6G A;  5FT4 A;  1WKG A;  3DR7 A;  4WYE A;  4Y0D A;  1VP4 A;  2AY5 A;  1WST A;  4R5Z A;  3I4J A;  1FG3 A;  1TPL A;  3QBO A;  1BJO A;  3RI6 A;  2EZ2 A;  4RJ0 A;  2GMU A;  3COG A;  3BN1 A;  3A8U X;  1B5O A;  1D7V A;  2BIE A;  2BWN A;  4ADC A;  4OC9 A;  2D64 A;  4A0R A;  1PMO A;  1KL2 A;  3ATH A;  2BI3 A;  3ZRR A;  2HZP A;  4H51 A;  3NTJ A;  2DOU A;  4N0B A;  3K7Y A;  2FNI A;  4I8A A;  3MKJ A;  1Y4I A;  5EUE A;  3B46 A;  3NU7 A;  2Z9W A;  4IY7 A;  2YCN A;  1EQB A;  4PFF A;  4ZWV A;  3BCX A;  4AZK A;  3KGX A;  3JWA A;  2CH1 A;  1EJI A;  1GD9 A;  4OBV A;  3UAK A;  2Z67 A;  3L44 A;  1GEY A;  1MLZ A;  3CBF A;  4GE4 A;  2W8V A;  1ASB A;  1D7S A;  2YCP A;  3IF2 A;  2QLR A;  4OBU A;  4FL0 A;  4AH3 A;  1BW0 A;  5EUN A;  5M4D A;  4P7Y A;  3B1C A;  4XJM A;  2VMY A;  1T3I A;  1BT4 A;  4ATP A;  3FSL A;  2CH2 A;  1TAS A;  1DJE A; 
#chains in the Genus database with same CATH topology
 3CQ5 A;  4NOG A;  4WXB A;  1CL2 A;  2VGT A;  3MAF B;  2Z9V A;  3B1D A;  1W7N A;  4IW7 A;  3AEN B;  3EI5 A;  1JG8 A;  3W1I A;  2OGE A;  4XEW A;  3II0 A;  3PJ0 A;  3UWC A;  4F5G A;  1ECX A;  3E2Z B;  4Y0I A;  4FFC A;  2W7K A;  3N75 A;  3HMU A;  1GEW A;  3PD6 A;  4RAE A;  4MQP A;  2ZUK A;  5JAY A;  2D66 A;  2CJG A;  3EI7 A;  4XJP A;  4A6U A;  3IHJ A;  3FVX A;  4BQ0 A;  2CJH A;  1N8P A;  2ORD A;  3BWN C;  1AIC A;  3EIA A;  3Q8N A;  2D5Y A;  1IVR A;  3AEM C;  5EFS A;  3FQ7 A;  1ART A;  4H63 Q;  2CFB A;  2ZSM A;  3NUI A;  3FDD A;  2D65 A;  3ZZK A;  2CY8 A;  2X8U A;  3RQ1 A;  5C6U A;  4UQV A;  1X0M A;  1LC8 A;  5K8B A;  2OKJ A;  2VMS A;  3E9K A;  3MC6 A;  2CAN A;  2GMS A;  3A9Z A;  3DU4 A;  1GDE A;  2AY3 A;  1V72 A;  2ZY3 A;  4AZJ A;  2BI2 A;  2DGK A;  2HOR A;  1YNU A;  3ASB A;  1GC0 A;  1ARI A;  1LC5 A;  1IX7 A;  3HVY A;  3N0L A;  3T32 A;  1BJO B;  3EZS A;  4W8I A;  3JWB A;  4UHO A;  1YOO A;  4PVF A;  1V2F A;  4ADB A;  4DBC A;  3HQT A;  3JZL A;  2E54 A;  4WBT A;  3I16 A;  1KAF A;  4IXS A;  4CBR A;  4IYO B;  4WYC A;  2WKA A;  1RV3 A;  2YKY A;  3QM2 A;  1D7U A;  2Z20 A;  3GBX A;  2VMQ A;  1WKH A;  1DGE A;  5EUD A;  4XQ2 A;  2BKW A;  5EQC A;  2NMP A;  1AMA A;  4MQR A;  1S07 A;  5J8Q A;  3FQ8 A;  5AX8 A;  1OHY A;  4ZAS A;  2Q7W A;  2BHX A;  2X5F A;  2XBN A;  2OGA A;  1ARG A;  1IX8 A;  1AY5 A;  1SFF A;  3WX9 A;  3KE3 A;  3E2F A;  2BYJ A;  1IAX A;  2AY2 A;  3WCN A;  2FNU A;  2EGY A;  5G4I A;  1AMQ A;  3FD0 A;  1MGV A;  4RLG A;  1Z3Z A;  3K28 A;  5E4Z A;  1AJS A;  4WB0 B;  4WLH A;  2VMN A;  1QGN A;  1CQ6 A;  2QBT A;  1QJ3 A;  2ZJG A;  4EMY A;  2X5D A;  1AJS B;  2JG2 A;  1X28 A;  4WB0 A;  3A2B A;  5DX5 A;  3AOV A;  3W1J A;  2VMZ A;  4ZSW A;  4PIW A;  5BJ3 A;  2R0T A;  3AEL A;  3P1T A;  4A00 A;  4WP0 A;  1V2D A;  1QZ9 A;  2RFV A;  3MAD A;  4F5L A;  1AHG A;  2EPJ A;  2FKI A;  4ISY A;  1JS6 A;  3PPL A;  2JGT A;  2VMX A;  4GEB A;  2YCT A;  3GR9 A;  3PGY A;  2KFP A;  4JF0 A;  3EZ1 A;  3E2Y A;  4RIT A;  3FFR A;  4ITG A;  4K2I A;  4DGT A;  2D61 A;  3FFH A;  4ADE A;  1Z7D A;  1VJO A;  4WYF A;  2VMU A;  4B98 A;  1O62 A;  1G4X A;  3MAU A;  3TFT A;  2AEU A;  3BS8 A;  1PG8 A;  2BWO A;  1CJ0 A;  4M2K A;  1EG5 A;  3BCA A;  4A6R A;  4F4E A;  4F5H A;  3AAT A;  1DTY A;  3HBX A;  4DQ6 A;  1ZC9 A;  1YIZ A;  1TOE A;  1U08 A;  2ZSL A;  5IWQ A;  1TOK A;  2V0Y A;  3BB8 A;  1TAR A;  1UU1 A;  1X29 A;  3LVM A;  4F5J A;  3USF A;  4AOA A;  4UHM A;  5M49 A;  4M2J A;  1RVY A;  1VEF A;  2EH6 A;  3E2Z A;  4MY5 A;  5FT5 A;  1MLY A;  1DGD A;  4HF8 A;  4A72 A;  1BJN A;  1MDZ A;  2VGW A;  4Q76 A;  3DC1 A;  1GCK A;  3BCB A;  4XK1 A;  5BJ4 A;  4ZM3 A;  2A1V A;  1TOJ A;  4UOY A;  1BQD A;  2C7T A;  8AAT A;  2CST A;  5EAA A;  3VK4 A;  1CQ8 A;  3AEO A;  1OHV A;  1LS3 A;  1LC7 A;  2VMV A;  1BQA A;  2HOX A;  4J8L A;  2O1B A;  1PMM A;  2VGS A;  1I41 A;  1ELQ A;  1KMK A;  4W1W A;  1TAT A;  1V2E A;  2D7Z A;  5TF5 A;  4OMA A;  1J04 A;  2ZP7 A;  3FQA A;  4BA5 A;  1BJW A;  2W8W A;  3G0T A;  1I43 A;  5M46 A;  3D6K A;  1IUG A;  4IX8 A;  1GEX A;  3ISL A;  1WYV A;  4JEW A;  1MAP A;  1JF9 A;  2D63 A;  4HVK A;  3KKI A;  3DYD A;  1KKP A;  1IAY A;  1B9I A;  1WYT B;  1FC4 A;  1AHF A;  1ZOD A;  3TAT A;  1RV4 A;  2HUU A;  2PB0 A;  2TPL A;  3GZD C;  2WB6 A;  3N5M A;  1CQ7 A;  1LW4 A;  4WXG A;  4CVQ A;  3L8A A;  1C7G A;  3FKD A;  4XJO A;  2AY9 A;  2HUF A;  3PA9 A;  4E3Q A;  2BI9 A;  2ZC0 A;  3GZD A;  1M0O A;  5EIG A;  4W5K A;  2W7E A;  3TCM A;  1G7W A;  3LVL B;  3FVS A;  3NYU A;  5LHA A;  1AMS A;  2VLF A;  4OTL A;  2EO5 A;  5F8V A;  3AEJ A;  4WD2 A;  2BIG A;  1S0A A;  2G6W A;  3JW9 A;  2ZY4 A;  1WYT A;  5EAV A;  4ZDP A;  3R4T A;  4A6T A;  2YKV A;  4A0F A;  2R5C A;  4KAM A;  5FT6 A;  2FM1 A;  3DXW A;  1D2F A;  3FTB A;  3FDB A;  4ZAH A;  4WYG A;  3ECD A;  5DJ1 A;  1AAM A;  3JTX A;  3LG0 A;  3AEJ C;  3M5U A;  3PDX A;  4GE7 A;  3GWP A;  3RBF A;  1DKA A;  4IXO A;  4MQQ A;  1S06 A;  1AHE A;  3NU8 A;  2VYC A;  3ELP A;  4U2H A;  3BWN A;  1ARH A;  3BC8 A;  3HLM A;  1BJ4 A;  1ASN A;  1AY4 A;  4W91 A;  3RUY A;  1OHW A;  2YKU A;  2HOZ A;  3A9X A;  1UU0 A;  3QN6 A;  1YAA A;  1GC3 A;  4ZLV A;  3G8M A;  4JEV A;  1O69 A;  3VOM A;  4OYT A;  3VP6 A;  2W8U A;  1O4S A;  1ASC A;  2PO3 A;  1YJZ A;  4GE9 A;  1SPA A;  4LNJ A;  3DXV A;  1ORD A;  1UKJ A;  1ASA A;  2VMW A;  1SF2 A;  1TOG A;  4RM1 A;  1C7O A;  3LV2 A;  4K05 A;  3OKS A;  1ASD A;  2W8J A;  2E7I A;  1ARS A;  1KL1 A;  1AKB A;  5HXX A;  4IXZ A;  4ZWM A;  3NUB A;  1QIR A;  1M4N A;  2C81 A;  3GZC A;  4GSA A;  4JEZ A;  1XEY A;  3MAF A;  2BWP A;  2D7Y A;  1G4V A;  3DOD A;  3AEN A;  1AIA A;  4P3M A;  3TQX A;  3WGB A;  4F5K A;  3UE8 A;  1B8G A;  1SZK A;  1YJS A;  4RKD A;  2AY1 A;  4MGR A;  3DZZ A;  4ATQ A;  2E7J A;  2E7U A;  2CB1 A;  2QB3 A;  1N31 A;  2OQX A;  2X3L A;  1CL1 A;  1GC4 A;  1RVU A;  4GDY A;  3RCH B;  5KTB A;  3BWO A;  3FZ8 A;  3QI6 A;  3PD6 B;  2C0R A;  1W7M A;  5G09 A;  3JU7 A;  2VI8 A;  2Z9U A;  4Q6R A;  5G4J A;  3G7Q A;  2GSA A;  2W7G A;  3I5T A;  3W1H A;  3ZZJ A;  2QMA A;  2W7F A;  2DGL A;  2VIA A;  2VMO A;  4ZDL A;  1ASL A;  2VLH A;  4ADD A;  4EFF A;  3LWS A;  1AHY A;  2YRI A;  1TOI A;  1WYV B;  3CAI A;  4R2N A;  4F5I A;  4CXQ A;  4N0W A;  3BV0 A;  4O6Z A;  3N7N A;  4CBS A;  1P3W A;  1X2A A;  2OAT A;  3MBB A;  4A0G A;  4BHD A;  1B5P A;  3PDB B;  4TMR A;  2VGZ A;  3GET A;  3H9X A;  3TFU A;  1MAQ A;  1BKG A;  3WZF A;  1D7R A;  2AY4 A;  4XJL A;  4K2M A;  1PFF A;  1CS1 A;  3VK3 A;  1CZC A;  1H1C A;  1J32 A;  2W7L A;  3EI9 A;  3F6T A;  4XAU A;  3F9T A;  3DR4 A;  4MSO A;  2Z1Z A;  1YJY A;  3WGC A;  4F5M A;  4JEX A;  3FZ7 A;  4EB7 A;  2VGU A;  2HP1 A;  5DB5 A;  1S08 A;  2O7C A;  2PB2 A;  5E3K A;  5M4B A;  4E77 A;  3ACZ A;  2VIB A;  1SZS A;  3NNK A;  1GBN A;  4TN4 A;  4CXR A;  4ZM4 A;  1M32 A;  1SVV A;  3AEP A;  1DJ9 A;  3WY7 A;  5D5S A;  4MKK A;  1E5E A;  1O61 A;  3MC6 C;  7AAT A;  2ZY2 A;  1MDO A;  1LKC A;  2ZYJ A;  3GJU A;  3RBL A;  1AHX A;  9AAT A;  3DRD A;  4WXF A;  5HDM A;  2DKB A;  2JJE A;  2QA3 A;  3F0H A;  3WLX A;  4W1X A;  4OT8 A;  1QIS A;  1C0N A;  4F5F A;  1OAT A;  3AV7 A;  1S09 A;  2Z1Y A;  4LW2 A;  1GC2 A;  4E1O A;  2AAT A;  3HL2 A;  3ZRQ A;  3E77 A;  1AIB A;  2AEV A;  4ITX A;  1C7N A;  4MKJ A;  2EYQ A;  2WK9 A;  3EIB A;  2W7J A;  4JEY A;  5EIG B;  1OXP A;  3HDO A;  4IYO A;  2OKK A;  4OCA A;  3EUC A;  1LK9 A;  1ASG A;  1KKJ A;  4U1T A;  3QGU A;  5FT8 A;  4BA4 A;  1ASM A;  4R8D A;  1QJ5 A;  4B9B A;  3LVK A;  1M0Q A;  3B8X A;  5LH9 A;  2JJF A;  4AO9 A;  1M6S A;  5F9S A;  2R5C B;  2VGV A;  2W7M A;  3PIU A;  2R2N A;  3FVU A;  2BI1 A;  1AMR A;  3P6K A;  2EZ1 A;  2CTZ A;  2BYL A;  3RCH A;  3K40 A;  2DGM A;  3QPG A;  5G2Q A;  5I92 A;  1AKC A;  2O0R A;  1B4X A;  3HT4 A;  1I29 A;  3WKR A;  1ASE A;  1AX4 A;  2YOB A;  4M2M A;  3R9A A;  2QB2 A;  4L0O A;  3AEM A;  3MEB A;  3ZRP A;  2W8T A;  3QHX A;  2HP2 A;  2Z9X A;  3LVJ A;  1AY8 A;  2JJG A;  3GSB A;  4Q75 A;  5E5I A;  2GQN A;  2CIN A;  2DR1 A;  2Z61 A;  3VK2 A;  3NRA A;  1W3U A;  1M7Y A;  1M0N A;  4JE5 D;  3PDB A;  1G7X A;  3FZ6 A;  4EB5 A;  4QGR A;  1AKA A;  5G0A A;  2YHK A;  1C4K A;  3NYS A;  4PFN A;  1IBJ A;  2YRR A;  4R5F A;  5D95 A;  3CQ6 A;  4LC3 A;  1DJU A;  4LNL A;  2R5E A;  5HHY A;  3WKS A;  4WLJ A;  4WYD A;  2CJD A;  2AY8 A;  2G7J A;  1BS0 A;  4GRX A;  4ZSY A;  1C9C A;  3ASA A;  1ASF A;  4EU1 A;  4BMK A;  2FN6 A;  4J5U A;  1B9H A;  4A0H A;  4TV7 A;  4AO4 A;  2QSR A;  1E5F A;  2HOY A;  2W7D A;  1CZE A;  2BIA A;  2VI9 A;  3LY1 A;  3NX3 A;  4W1V A;  2W7H A;  2VMP A;  3B1E A;  3CQ4 A;  3H14 A;  4JF1 A;  1YIY A;  3PAA A;  3EI8 A;  1FG7 A;  4RKC A;  4UHN A;  4K2B A;  5DJ9 A;  1IX6 A;  1OXO A;  4KXK A;  2FYF A;  1LW5 A;  1ELU A;  1MDX A;  5G2P A;  2F8J A;  3H7F A;  4KYO A;  4JE5 A;  1W23 A;  2GB3 A;  2WK7 A;  3NDN A;  4LW4 A;  4E3R A;  1WYU A;  3FCR A;  1UU2 A;  1ZOB A;  2VMT A;  1DFO A;  1N2T A;  1KMJ A;  3VAX A;  4RJY A;  1SZU A;  3AOW A;  3NYT A;  2HUI A;  3A9Y A;  3N4S A;  2JIS A;  2WK8 A;  2C44 A;  2AY6 A;  4ZDO A;  1QIT A;  2AY7 A;  4RIZ A;  1M0P A;  1W7L A;  3ELE A;  4WYA A;  1IJI A;  3WCO A;  2XH1 A;  3FRK A;  1AJR A;  3N4X A;  4Q31 A;  1H0C A;  1JS3 A;  2VMR A;  3EI6 A;  1I48 A;  1AAW A;  2YKX A;  3OP7 A;  3KGW A;  4LNM A;  4Y0H A;  2DKJ A;  2ZY5 A;  1WYU B;  2V1P A;  1XI9 A;  2FQ6 A;  2W7I A;  2JJH A;  2BI5 A;  3E6G A;  5FT4 A;  1WKG A;  3DR7 A;  4WYE A;  4Y0D A;  1VP4 A;  2AY5 A;  1WST A;  4R5Z A;  3I4J A;  1FG3 A;  1TPL A;  3QBO A;  1BJO A;  3RI6 A;  2EZ2 A;  4RJ0 A;  2GMU A;  3COG A;  3BN1 A;  3A8U X;  1B5O A;  1D7V A;  2BIE A;  2BWN A;  4ADC A;  4OC9 A;  2D64 A;  4A0R A;  1PMO A;  1KL2 A;  3ATH A;  2BI3 A;  3ZRR A;  2HZP A;  4H51 A;  3NTJ A;  2DOU A;  4N0B A;  3K7Y A;  2FNI A;  4I8A A;  3MKJ A;  1Y4I A;  5EUE A;  3B46 A;  3NU7 A;  2Z9W A;  4IY7 A;  2YCN A;  1EQB A;  4PFF A;  4ZWV A;  3BCX A;  4AZK A;  3KGX A;  3JWA A;  2CH1 A;  1EJI A;  1GD9 A;  4OBV A;  3UAK A;  2Z67 A;  3L44 A;  1GEY A;  1MLZ A;  3CBF A;  4GE4 A;  2W8V A;  1ASB A;  1D7S A;  2YCP A;  3IF2 A;  2QLR A;  4OBU A;  4FL0 A;  4AH3 A;  1BW0 A;  5EUN A;  5M4D A;  3N4R A;  4P7Y A;  3B1C A;  4XJM A;  2VMY A;  1T3I A;  1BT4 A;  4ATP A;  3FSL A;  2CH2 A;  1TAS A;  1DJE A; 
#chains in the Genus database with same CATH homology
 3CQ5 A;  4NOG A;  4WXB A;  1CL2 A;  2VGT A;  3MAF B;  2Z9V A;  3B1D A;  1W7N A;  4IW7 A;  3AEN B;  3EI5 A;  1JG8 A;  3W1I A;  2OGE A;  4XEW A;  3II0 A;  3PJ0 A;  3UWC A;  4F5G A;  1ECX A;  3E2Z B;  4Y0I A;  4FFC A;  2W7K A;  3N75 A;  3HMU A;  1GEW A;  3PD6 A;  4RAE A;  4MQP A;  2ZUK A;  5JAY A;  2D66 A;  2CJG A;  3EI7 A;  4XJP A;  4A6U A;  3IHJ A;  3FVX A;  4BQ0 A;  2CJH A;  1N8P A;  2ORD A;  3BWN C;  1AIC A;  3EIA A;  3Q8N A;  2D5Y A;  1IVR A;  3AEM C;  5EFS A;  3FQ7 A;  1ART A;  4H63 Q;  2CFB A;  2ZSM A;  3NUI A;  3FDD A;  2D65 A;  3ZZK A;  2CY8 A;  2X8U A;  3RQ1 A;  5C6U A;  4UQV A;  1X0M A;  1LC8 A;  5K8B A;  2OKJ A;  2VMS A;  3E9K A;  3MC6 A;  2CAN A;  2GMS A;  3A9Z A;  3DU4 A;  1GDE A;  2AY3 A;  1V72 A;  2ZY3 A;  4AZJ A;  2BI2 A;  2DGK A;  2HOR A;  1YNU A;  3ASB A;  1GC0 A;  1ARI A;  1LC5 A;  1IX7 A;  3HVY A;  3N0L A;  3T32 A;  1BJO B;  3EZS A;  4W8I A;  3JWB A;  4UHO A;  1YOO A;  4PVF A;  1V2F A;  4ADB A;  4DBC A;  3HQT A;  3JZL A;  2E54 A;  4WBT A;  3I16 A;  4IXS A;  4CBR A;  4IYO B;  4WYC A;  2WKA A;  1RV3 A;  2YKY A;  3QM2 A;  1D7U A;  2Z20 A;  3GBX A;  2VMQ A;  1WKH A;  1DGE A;  5EUD A;  4XQ2 A;  2BKW A;  5EQC A;  2NMP A;  1AMA A;  4MQR A;  1S07 A;  5J8Q A;  3FQ8 A;  5AX8 A;  1OHY A;  4ZAS A;  2Q7W A;  2BHX A;  2X5F A;  2XBN A;  2OGA A;  1ARG A;  1IX8 A;  1AY5 A;  1SFF A;  3WX9 A;  3KE3 A;  3E2F A;  2BYJ A;  1IAX A;  2AY2 A;  3WCN A;  2FNU A;  2EGY A;  5G4I A;  1AMQ A;  3FD0 A;  1MGV A;  4RLG A;  1Z3Z A;  3K28 A;  5E4Z A;  1AJS A;  4WB0 B;  4WLH A;  2VMN A;  1QGN A;  1CQ6 A;  2QBT A;  1QJ3 A;  2ZJG A;  4EMY A;  2X5D A;  1AJS B;  2JG2 A;  1X28 A;  4WB0 A;  3A2B A;  5DX5 A;  3AOV A;  3W1J A;  2VMZ A;  4ZSW A;  4PIW A;  5BJ3 A;  2R0T A;  3AEL A;  3P1T A;  4A00 A;  4WP0 A;  1V2D A;  1QZ9 A;  2RFV A;  3MAD A;  4F5L A;  1AHG A;  2EPJ A;  2FKI A;  4ISY A;  1JS6 A;  3PPL A;  2JGT A;  2VMX A;  4GEB A;  2YCT A;  3GR9 A;  3PGY A;  2KFP A;  4JF0 A;  3EZ1 A;  3E2Y A;  4RIT A;  3FFR A;  4ITG A;  4K2I A;  4DGT A;  2D61 A;  3FFH A;  4ADE A;  1Z7D A;  1VJO A;  4WYF A;  2VMU A;  4B98 A;  1O62 A;  1G4X A;  3MAU A;  3TFT A;  2AEU A;  3BS8 A;  1PG8 A;  2BWO A;  1CJ0 A;  4M2K A;  1EG5 A;  3BCA A;  4A6R A;  4F4E A;  4F5H A;  3AAT A;  1DTY A;  3HBX A;  4DQ6 A;  1ZC9 A;  1YIZ A;  1TOE A;  1U08 A;  2ZSL A;  5IWQ A;  1TOK A;  2V0Y A;  3BB8 A;  1TAR A;  1UU1 A;  1X29 A;  3LVM A;  4F5J A;  3USF A;  4AOA A;  4UHM A;  5M49 A;  4M2J A;  1RVY A;  1VEF A;  2EH6 A;  3E2Z A;  4MY5 A;  5FT5 A;  1MLY A;  1DGD A;  4HF8 A;  4A72 A;  1BJN A;  1MDZ A;  2VGW A;  4Q76 A;  3DC1 A;  1GCK A;  3BCB A;  4XK1 A;  5BJ4 A;  4ZM3 A;  2A1V A;  1TOJ A;  4UOY A;  1BQD A;  2C7T A;  8AAT A;  2CST A;  5EAA A;  3VK4 A;  1CQ8 A;  3AEO A;  1OHV A;  1LS3 A;  1LC7 A;  2VMV A;  1BQA A;  2HOX A;  4J8L A;  2O1B A;  1PMM A;  2VGS A;  1I41 A;  1ELQ A;  1KMK A;  4W1W A;  1TAT A;  1V2E A;  2D7Z A;  5TF5 A;  4OMA A;  1J04 A;  2ZP7 A;  3FQA A;  4BA5 A;  1BJW A;  2W8W A;  3G0T A;  1I43 A;  5M46 A;  3D6K A;  1IUG A;  4IX8 A;  1GEX A;  3ISL A;  1WYV A;  4JEW A;  1MAP A;  1JF9 A;  2D63 A;  4HVK A;  3KKI A;  3DYD A;  1KKP A;  1IAY A;  1B9I A;  1WYT B;  1FC4 A;  1AHF A;  1ZOD A;  3TAT A;  1RV4 A;  2HUU A;  2PB0 A;  2TPL A;  3GZD C;  2WB6 A;  3N5M A;  1CQ7 A;  1LW4 A;  4WXG A;  4CVQ A;  3L8A A;  1C7G A;  3FKD A;  4XJO A;  2AY9 A;  2HUF A;  3PA9 A;  4E3Q A;  2BI9 A;  2ZC0 A;  3GZD A;  1M0O A;  5EIG A;  4W5K A;  2W7E A;  3TCM A;  1G7W A;  3LVL B;  3FVS A;  3NYU A;  5LHA A;  1AMS A;  2VLF A;  4OTL A;  2EO5 A;  5F8V A;  3AEJ A;  4WD2 A;  2BIG A;  1S0A A;  2G6W A;  3JW9 A;  2ZY4 A;  1WYT A;  5EAV A;  4ZDP A;  3R4T A;  4A6T A;  2YKV A;  4A0F A;  2R5C A;  4KAM A;  5FT6 A;  2FM1 A;  3DXW A;  1D2F A;  3FTB A;  3FDB A;  4ZAH A;  4WYG A;  3ECD A;  5DJ1 A;  1AAM A;  3JTX A;  3LG0 A;  3AEJ C;  3M5U A;  3PDX A;  4GE7 A;  3GWP A;  3RBF A;  1DKA A;  4IXO A;  4MQQ A;  1S06 A;  1AHE A;  3NU8 A;  2VYC A;  3ELP A;  4U2H A;  3BWN A;  1ARH A;  3BC8 A;  3HLM A;  1BJ4 A;  1ASN A;  1AY4 A;  4W91 A;  3RUY A;  1OHW A;  2YKU A;  2HOZ A;  3A9X A;  1UU0 A;  3QN6 A;  1YAA A;  1GC3 A;  4ZLV A;  3G8M A;  4JEV A;  1O69 A;  3VOM A;  4OYT A;  3VP6 A;  2W8U A;  1O4S A;  1ASC A;  2PO3 A;  1YJZ A;  4GE9 A;  1SPA A;  4LNJ A;  3DXV A;  1ORD A;  1UKJ A;  1ASA A;  2VMW A;  1SF2 A;  1TOG A;  4RM1 A;  1C7O A;  3LV2 A;  4K05 A;  3OKS A;  1ASD A;  2W8J A;  2E7I A;  1ARS A;  1KL1 A;  1AKB A;  5HXX A;  4IXZ A;  4ZWM A;  3NUB A;  1QIR A;  1M4N A;  2C81 A;  3GZC A;  4GSA A;  4JEZ A;  1XEY A;  3MAF A;  2BWP A;  2D7Y A;  1G4V A;  3DOD A;  3AEN A;  1AIA A;  4P3M A;  3TQX A;  3WGB A;  4F5K A;  3UE8 A;  1B8G A;  1SZK A;  1YJS A;  4RKD A;  2AY1 A;  4MGR A;  3DZZ A;  4ATQ A;  2E7J A;  2E7U A;  2CB1 A;  2QB3 A;  1N31 A;  2OQX A;  2X3L A;  1CL1 A;  1GC4 A;  1RVU A;  4GDY A;  3RCH B;  5KTB A;  3BWO A;  3FZ8 A;  3QI6 A;  3PD6 B;  2C0R A;  1W7M A;  5G09 A;  3JU7 A;  2VI8 A;  2Z9U A;  4Q6R A;  5G4J A;  3G7Q A;  2GSA A;  2W7G A;  3I5T A;  3W1H A;  3ZZJ A;  2QMA A;  2W7F A;  2DGL A;  2VIA A;  2VMO A;  4ZDL A;  1ASL A;  2VLH A;  4ADD A;  4EFF A;  3LWS A;  1AHY A;  2YRI A;  1TOI A;  1WYV B;  3CAI A;  4R2N A;  4F5I A;  4CXQ A;  4N0W A;  3BV0 A;  4O6Z A;  3N7N A;  4CBS A;  1P3W A;  1X2A A;  2OAT A;  3MBB A;  4A0G A;  4BHD A;  1B5P A;  3PDB B;  4TMR A;  2VGZ A;  3GET A;  3H9X A;  3TFU A;  1MAQ A;  1BKG A;  3WZF A;  1D7R A;  2AY4 A;  4XJL A;  4K2M A;  1PFF A;  1CS1 A;  3VK3 A;  1CZC A;  1H1C A;  1J32 A;  2W7L A;  3EI9 A;  3F6T A;  4XAU A;  3F9T A;  3DR4 A;  4MSO A;  2Z1Z A;  1YJY A;  3WGC A;  4F5M A;  4JEX A;  3FZ7 A;  4EB7 A;  2VGU A;  2HP1 A;  5DB5 A;  1S08 A;  2O7C A;  2PB2 A;  5E3K A;  5M4B A;  4E77 A;  3ACZ A;  2VIB A;  1SZS A;  3NNK A;  1GBN A;  4TN4 A;  4CXR A;  4ZM4 A;  1M32 A;  1SVV A;  3AEP A;  1DJ9 A;  3WY7 A;  5D5S A;  4MKK A;  1E5E A;  1O61 A;  3MC6 C;  7AAT A;  2ZY2 A;  1MDO A;  1LKC A;  2ZYJ A;  3GJU A;  3RBL A;  1AHX A;  9AAT A;  3DRD A;  4WXF A;  5HDM A;  2DKB A;  2JJE A;  2QA3 A;  3F0H A;  3WLX A;  4W1X A;  4OT8 A;  1QIS A;  1C0N A;  4F5F A;  1OAT A;  3AV7 A;  1S09 A;  2Z1Y A;  4LW2 A;  1GC2 A;  4E1O A;  2AAT A;  3HL2 A;  3ZRQ A;  3E77 A;  1AIB A;  2AEV A;  4ITX A;  1C7N A;  4MKJ A;  2EYQ A;  2WK9 A;  3EIB A;  2W7J A;  4JEY A;  5EIG B;  1OXP A;  3HDO A;  4IYO A;  2OKK A;  4OCA A;  3EUC A;  1LK9 A;  1ASG A;  1KKJ A;  4U1T A;  3QGU A;  5FT8 A;  4BA4 A;  1ASM A;  4R8D A;  1QJ5 A;  4B9B A;  3LVK A;  1M0Q A;  3B8X A;  5LH9 A;  2JJF A;  4AO9 A;  1M6S A;  5F9S A;  2R5C B;  2VGV A;  2W7M A;  3PIU A;  2R2N A;  3FVU A;  2BI1 A;  1AMR A;  3P6K A;  2EZ1 A;  2CTZ A;  2BYL A;  3RCH A;  3K40 A;  2DGM A;  3QPG A;  5G2Q A;  5I92 A;  1AKC A;  2O0R A;  1B4X A;  3HT4 A;  1I29 A;  3WKR A;  1ASE A;  1AX4 A;  2YOB A;  4M2M A;  3R9A A;  2QB2 A;  4L0O A;  3AEM A;  3MEB A;  3ZRP A;  2W8T A;  3QHX A;  2HP2 A;  2Z9X A;  3LVJ A;  1AY8 A;  2JJG A;  3GSB A;  4Q75 A;  5E5I A;  2GQN A;  2CIN A;  2DR1 A;  2Z61 A;  3VK2 A;  3NRA A;  1W3U A;  1M7Y A;  1M0N A;  4JE5 D;  3PDB A;  1G7X A;  3FZ6 A;  4EB5 A;  4QGR A;  1AKA A;  5G0A A;  2YHK A;  1C4K A;  3NYS A;  4PFN A;  1IBJ A;  2YRR A;  4R5F A;  5D95 A;  3CQ6 A;  4LC3 A;  1DJU A;  4LNL A;  2R5E A;  5HHY A;  3WKS A;  4WLJ A;  4WYD A;  2CJD A;  2AY8 A;  2G7J A;  1BS0 A;  4GRX A;  4ZSY A;  1C9C A;  3ASA A;  1ASF A;  4EU1 A;  4BMK A;  2FN6 A;  4J5U A;  1B9H A;  4A0H A;  4TV7 A;  4AO4 A;  2QSR A;  1E5F A;  2HOY A;  2W7D A;  1CZE A;  2BIA A;  2VI9 A;  3LY1 A;  3NX3 A;  4W1V A;  2W7H A;  2VMP A;  3B1E A;  3CQ4 A;  3H14 A;  4JF1 A;  1YIY A;  3PAA A;  3EI8 A;  1FG7 A;  4RKC A;  4UHN A;  4K2B A;  5DJ9 A;  1IX6 A;  1OXO A;  4KXK A;  2FYF A;  1LW5 A;  1ELU A;  1MDX A;  5G2P A;  2F8J A;  3H7F A;  4KYO A;  4JE5 A;  1W23 A;  2GB3 A;  2WK7 A;  3NDN A;  4LW4 A;  4E3R A;  1WYU A;  3FCR A;  1UU2 A;  1ZOB A;  2VMT A;  1DFO A;  1N2T A;  1KMJ A;  3VAX A;  4RJY A;  1SZU A;  3AOW A;  3NYT A;  2HUI A;  3A9Y A;  3N4S A;  2JIS A;  2WK8 A;  2C44 A;  2AY6 A;  4ZDO A;  1QIT A;  2AY7 A;  4RIZ A;  1M0P A;  1W7L A;  3ELE A;  4WYA A;  1IJI A;  3WCO A;  2XH1 A;  3FRK A;  1AJR A;  3N4X A;  4Q31 A;  1H0C A;  1JS3 A;  2VMR A;  3EI6 A;  1I48 A;  1AAW A;  2YKX A;  3OP7 A;  3KGW A;  4LNM A;  4Y0H A;  2DKJ A;  2ZY5 A;  1WYU B;  2V1P A;  1XI9 A;  2FQ6 A;  2W7I A;  2JJH A;  2BI5 A;  3E6G A;  5FT4 A;  1WKG A;  3DR7 A;  4WYE A;  4Y0D A;  1VP4 A;  2AY5 A;  1WST A;  4R5Z A;  3I4J A;  1FG3 A;  1TPL A;  3QBO A;  1BJO A;  3RI6 A;  2EZ2 A;  4RJ0 A;  2GMU A;  3COG A;  3BN1 A;  3A8U X;  1B5O A;  1D7V A;  2BIE A;  2BWN A;  4ADC A;  4OC9 A;  2D64 A;  4A0R A;  1PMO A;  1KL2 A;  3ATH A;  2BI3 A;  3ZRR A;  2HZP A;  4H51 A;  3NTJ A;  2DOU A;  4N0B A;  3K7Y A;  2FNI A;  4I8A A;  3MKJ A;  1Y4I A;  5EUE A;  3B46 A;  3NU7 A;  2Z9W A;  4IY7 A;  2YCN A;  1EQB A;  4PFF A;  4ZWV A;  3BCX A;  4AZK A;  3KGX A;  3JWA A;  2CH1 A;  1EJI A;  1GD9 A;  4OBV A;  3UAK A;  2Z67 A;  3L44 A;  1GEY A;  1MLZ A;  3CBF A;  4GE4 A;  2W8V A;  1ASB A;  1D7S A;  2YCP A;  3IF2 A;  2QLR A;  4OBU A;  4FL0 A;  4AH3 A;  1BW0 A;  5EUN A;  5M4D A;  3N4R A;  4P7Y A;  3B1C A;  4XJM A;  2VMY A;  1T3I A;  1BT4 A;  4ATP A;  3FSL A;  2CH2 A;  1TAS A;  1DJE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...