2BI3A

Radiation damage of the schiff base in phosphoserine aminotransferase (structure d)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
360
structure length
360
Chain Sequence
VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
total genus 126
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2bi3A01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2bi3A02
5G2PA 1ASNA 3AV7A 1FC4A 2OATA 4WXBA 2C44A 3PD6B 5M46A 4XJPA 1X28A 5JAYA 4E1OA 1ARGA 3PA9A 5F9SA 3HMUA 3KGWA 4CBRA 2F8JA 5G4IA 2QMAA 3BCXA 2O0RA 3DC1A 4A6RA 2BWNA 1BJWA 1KKJA 1UU2A 4Y0IA 4ZDLA 4ZSWA 4JE5A 8AATA 2VMSA 4IY7A 1GC0A 3JW9A 2AEVA 4OT8A 1B8GA 1IBJA 1V2DA 1Z3ZA 2HZPA 3AEJA 2YCPA 4PFFA 1MLYA 2AY1A 2TPLA 1WYTB 3COGA 4F5LA 4M2MA 1CQ7A 3EUCA 4WLJA 2EPJA 4F5MA 4ZM4A 1LKCA 1W7LA 1T3IA 3P1TA 1DGEA 3F6TA 1EQBA 1M4NA 1V72A 4RITA 1SF2A 3TATA 1GC2A 2VI9A 3B1DA 1C7GA 4Y0HA 4CVQA 1TOIA 3E2ZB 3F9TA 3E2FA 3L8AA 4J8LA 1QISA 1B5OA 4OYTA 1CZCA 2VI8A 4AO4A 5M4BA 3QN6A 2GMSA 2VIAA 4RLGA 2VLHA 3PDXA 2X5DA 4R5ZA 3VK3A 3NYSA 4W1VA 4W8IA 4OBUA 2Z9UA 1AY4A 1WSTA 3WCOA 5D5SA 5BJ3A 3FZ8A 5LH9A 4XK1A 4ZASA 1GD9A 5F8VA 1WYUA 1I43A 3B1EA 4WYCA 2E7JA 2ZUKA 1IX8A 4BA5A 1ECXA 4KXKA 1BKGA 3JWAA 1LC7A 2FNUA 2X3LA 3BWNA 2YCNA 3GWPA 1LS3A 4A0FA 1AJSA 2YRIA 3PGYA 2Z9XA 2AY5A 2FYFA 2D63A 1XI9A 3KE3A 1ASEA 1AMRA 1DTYA 3ISLA 1ASCA 3NDNA 3T32A 3ZRRA 2BIEA 1AJRA 2CH1A 4XQ2A 3AELA 1AICA 4E77A 4WB0A 3GETA 1WKHA 1AMSA 2DGMA 2PB2A 4K2MA 1IAYA 4XJOA 2BI1A 4OCAA 1GC3A 2VGUA 4AOAA 1M0NA 3KKIA 4BA4A 1VEFA 1WYUB 3PDBB 5BJ4A 3TFUA 3JU7A 3QI6A 2EGYA 3GBXA 1E5FA 3FTBA 3K28A 1ARSA 1O61A 5EIGA 2BI2A 3KGXA 1AJSB 2PB0A 1LW5A 2Z1ZA 1AHEA 4WYAA 3NRAA 3MAUA 3E6GA 3BCBA 4F5GA 3H14A 5IWQA 2FN6A 3W1HA 1ASFA 1W7NA 3BCAA 4MGRA 4RM1A 2VMQA 2OGEA 3EI5A 1LC8A 5DX5A 3NYTA 4WB0B 2VGTA 3FFHA 4IXZA 2D65A 1AKCA 3CQ6A 3QPGA 3OKSA 4IYOB 5E5IA 3JZLA 4A0HA 1YIZA 2D7YA 2OKJA 2W7LA 4A0GA 2O7CA 4ITGA 2CANA 3DXVA 1KKPA 1ZC9A 3WGCA 1OXPA 4RJYA 3OP7A 4WD2A 3BWNC 5FT4A 2Z20A 4WP0A 5D95A 2JJEA 2AY3A 1ASBA 3IHJA 3W1JA 3DR4A 1TARA 2DKBA 2W8TA 3F0HA 4ADBA 2WK9A 2BIAA 1TASA 3RCHA 1ARTA 4WYGA 1IVRA 3P6KA 2ZY2A 1AKAA 1PG8A 4EU1A 1ORDA 3MKJA 4WXFA 1OATA 4F5IA 1AMAA 2XBNA 3FRKA 3AOVA 3A9ZA 1X29A 1OHWA 4XJMA 2ZC0A 1BJNA 2CJDA 1MLZA 2YCTA 1LK9A 1JS3A 4K2BA 1MAQA 1RV3A 3AEPA 3BWOA 3EZ1A 1IX7A 2X5FA 1D7RA 3NU8A 1RVYA 1S09A 4N0BA 3Q8NA 4M2KA 5K8BA 1B5PA 2VYCA 4I8AA 1SFFA 1V2FA 3ASBA 3DZZA 1BQDA 5AX8A 2ORDA 4R8DA 7AATA 1W3UA 2W8JA 3WGBA 1QGNA 3GZCA 1ELUA 4A6UA 3FDDA 4MQRA 1AHXA 2D5YA 1N31A 3FDBA 3TFTA 2EH6A 5J8QA 3RCHB 1AX4A 3EIAA 2OGAA 3JTXA 5EAAA 1MGVA 5LHAA 3EI8A 4JEWA 2AY7A 2BKWA 4LNJA 1MDXA 2NMPA 2XH1A 4MY5A 1MAPA 3TCMA 3ZZKA 2JJFA 4A6TA 2AY4A 2YKYA 3AOWA 1G4VA 3DU4A 2VIBA 5DB5A 2W7IA 5M4DA 4B9BA 1B9IA 1BQAA 4LC3A 4A72A 4AZJA 2Z9VA 2OKKA 3QBOA 1BW0A 3HDOA 1OHVA 1PFFA 1XEYA 1Y4IA 1E5EA 2YKVA 3VK4A 1AMQA 2VLFA 2G6WA 3HQTA 1JG8A 2YHKA 1GCKA 2CY8A 1YJZA 2VGWA 2HUFA 2YRRA 1QJ5A 2E7IA 2W7KA 2GQNA 4GE9A 4WYEA 4UHMA 2BWPA 1SZUA 3CBFA 4MQQA 3EI7A 2CTZA 4GDYA 1DFOA 2R5CA 2VGZA 2W8WA 3I5TA 3MAFA 2VMNA 2C7TA 3G8MA 1C0NA 1PMMA 1AAWA 4B98A 4F5FA 1I48A 1TATA 4DQ6A 2Z67A 4H51A 1J32A 3CAIA 1CL2A 2HUUA 4JE5D 4Y0DA 5E4ZA 2DKJA 3CQ5A 4ZAHA 2QB2A 2V1PA 3ZZJA 3UWCA 1WYVA 1GEXA 1WKGA 3VAXA 1M32A 1AAMA 4OBVA 1M7YA 1LW4A 4XJLA 4ZDPA 3B8XA 3EI6A 1ZODA 1D7VA 4AZKA 1YIYA 3FD0A 2DGLA 1EJIA 4GE4A 3VK2A 2ZP7A 4ATPA 3VP6A 5DJ9A 3ZRQA 4ATQA 1ASMA 2RFVA 1I29A 3G7QA 4A00A 4DGTA 1DJUA 4ZSYA 2W8UA 4EMYA 1SZSA 2JISA 1BS0A 2R5CB 3NTJA 3A9XA 3MAFB 1ARIA 3LVJA 2HP1A 1IUGA 4UHOA 2ZY5A 3QGUA 4ZLVA 1H0CA 4JEYA 4OTLA 4U2HA 3FFRA 2AY6A 1ASDA 3LV2A 1S06A 4RKDA 1QJ3A 1C7OA 4HF8A 2ZY4A 2CB1A 3HT4A 4O6ZA 3LVMA 1WYVB 2VGVA 3GJUA 5HXXA 4WYFA 3L44A 1QIRA 2CJGA 4BMKA 2D66A 2HOZA 1G7WA 4ISYA 4EB7A 4OC9A 2D64A 2GB3A 4WLHA 4PIWA 3A9YA 4UQVA 1CS1A 1FG7A 2PO3A 4IW7A 3ECDA 2AATA 4PVFA 1KL2A 3R4TA 1DGDA 4CXQA 2CFBA 3NX3A 5EFSA 1O62A 2R2NA 3WCNA 1AHGA 2EZ1A 2VMUA 2X8UA 3LVLB 4LNMA 5EQCA 5EUNA 3UAKA 1N8PA 4F4EA 1AHFA 4JEVA 4JF1A 3NYUA 1KL1A 5EIGB 5G0AA 2R0TA 2BIGA 1ELQA 1YJYA 2EZ2A 2QLRA 4LW4A 4WXGA 5FT5A 4CXRA 5EAVA 3FVUA 5E3KA 2VMTA 3EI9A 1YOOA 2CJHA 1C9CA 3FZ6A 1AKBA 3H7FA 4ZM3A 4W1WA 4R5FA 1RV4A 5M49A 1UKJA 3ZRPA 3PIUA 4EB5A 2W7FA 1S0AA 3FQAA 2VMXA 3GZDA 1CJ0A 2E54A 2Z1YA 3MC6A 4XAUA 2ZJGA 2VGSA 2QB3A 1AY5A 1JF9A 4BQ0A 1X0MA 2VMYA 3NU7A 4RIZA 1W23A 1FG3A 1M0OA 2C0RA 3N0LA 3RUYA 1AHYA 1TOKA 3BB8A 4U1TA 2VMRA 3DYDA 3I4JA 1D7UA 1YAAA 4FL0A 3ATHA 2FNIA 2JGTA 2CH2A 3UE8A 3B46A 3PPLA 3DODA 1PMOA 1S08A 3BN1A 4W5KA 2HOXA 1IAXA 3MADA 1I41A 4NOGA 2CINA 4UHNA 1QZ9A 2D7ZA 1CL1A 3HLMA 1YJSA 3QM2A 3AATA 2W7GA 2JJGA 4GEBA 2BI9A 3WKSA 2ZYJA 3G0TA 3A2BA 4F5JA 4EFFA 4QGRA 5FT8A 4K2IA 3E9KA 3HBXA 3USFA 2WK7A 3HVYA 3LWSA 1UU1A 5G2QA 4W91A 1VP4A 1TOEA 1ASAA 3FVXA 4FFCA 3RBFA 3NUIA 3BV0A 2WK8A 3N5MA 4TV7A 1JS6A 3CQ4A 4AO9A 2BYJA 4F5KA 1OHYA 3FKDA 4ITXA 1ASGA 3BC8A 1Z7DA 4KAMA 1M6SA 4GRXA 2DGKA 1MDOA 3WY7A 1C4KA 3N75A 1C7NA 4ZWVA 1GC4A 1G7XA 4ZWMA 1B9HA 4DBCA 3A8UX 3D6KA 3PJ0A 4Q6RA 1U08A 1DKAA 3GZDC 2BHXA 3WLXA 1GBNA 2O1BA 2W7MA 4A0RA 3MC6C 3WZFA 1DJEA 3RI6A 4W1XA 5C6UA 4LW2A 4LNLA 3RBLA 1X2AA 2BYLA 3PDBA 4P7YA 3ELPA 1ZOBA 1J04A 3BS8A 3K7YA 1MDZA 3ACZA 4OMAA 1AIBA 1O4SA 3FSLA 2AY8A 3AEMA 2FQ6A 2BI5A 1O69A 3DXWA 3I16A 1H1CA 2VMOA 3EZSA 2QBTA 1GEWA 2HUIA 3W1IA 4RJ0A 4Q75A 4ADEA 1IJIA 2OQXA 3IF2A 4XEWA 3E77A 2D61A 5DJ1A 4JF0A 2HORA 2VMVA 2W7HA 4IXSA 3R9AA 2EO5A 4TMRA 1OXOA 1B4XA 3AEJC 3LVKA 4IYOA 2Z61A 2GMUA 3DRDA 5HDMA 3NNKA 3RQ1A 1CQ6A 2YKXA 1CQ8A 2W8VA 4J5UA 4WYDA 4N0WA 2C81A 1CZEA 4JEZA 4E3QA 4BHDA 2R5EA 4JEXA 4TN4A 3VOMA 1AIAA 1BT4A 3GSBA 1P3WA 1LC5A 4PFNA 4Q31A 1ASLA 2FM1A 4L0OA 3AENA 3JWBA 3MBBA 1V2EA 1S07A 1M0PA 2VMWA 4MQPA 4MSOA 1D7SA 1RVUA 2W7JA 3ASAA 4UOYA 1YNUA 2JG2A 2W7DA 3NUBA 2HOYA 3FZ7A 2VMZA 3ELEA 4R2NA 2CSTA 3AEOA 5I92A 3WX9A 1BJOA 1ARHA 3EIBA 1AY8A 4RKCA 3TQXA 4CBSA 2BI3A 4KYOA 5FT6A 2ZY3A 1N2TA 4RAEA 1QITA 2W7EA 1KMJA 2DOUA 1BJ4A 3LY1A 1G4XA 2WKAA 3M5UA 5EUDA 1EG5A 1W7MA 2QA3A 2AEUA 5TF5A 1DJ9A 3FQ7A 3PD6A 3QHXA 4MKKA 1UU0A 1VJOA 4P3MA 4WBTA 4F5HA 1KMKA 3LG0A 4E3RA 3MEBA 4ZDOA 3DR7A 2YKUA 2VMPA 5G09A 2ZSLA 4ADDA 1TOJA 3AEMC 4IXOA 4ADCA 5G4JA 4MKJA 2E7UA 1TPLA 3E2YA 3II0A 4AH3A 1M0QA 1TOGA 2Q7WA 3AENB 3HL2A 2JJHA 3B1CA 4IX8A 4Q76A 2ZSMA 3WKRA 1WYTA 5HHYA 3GR9A 2GSAA 2HP2A 3FCRA 4GE7A 4GSAA 2V0YA 4HVKA 1GEYA 2AY9A 5EUEA 3FVSA 3K40A 3PAAA 1SZKA 1BJOB 1SPAA 2AY2A 9AATA 1GDEA 2BWOA 2YOBA 2DR1A 4M2JA 3E2ZA 1IX6A 1SVVA 1D2FA 2Z9WA 3FQ8A
chains in the Genus database with same CATH superfamily
5G2PA 1ASNA 3AV7A 1FC4A 2OATA 4WXBA 2C44A 3PD6B 5M46A 4XJPA 1X28A 5JAYA 4E1OA 1ARGA 3PA9A 5F9SA 3HMUA 3KGWA 4CBRA 2F8JA 5G4IA 2QMAA 3BCXA 2O0RA 3DC1A 4A6RA 2BWNA 1BJWA 1KKJA 1UU2A 4Y0IA 4ZDLA 4ZSWA 4JE5A 8AATA 2VMSA 4IY7A 1GC0A 3JW9A 2AEVA 4OT8A 1B8GA 1IBJA 1V2DA 1Z3ZA 2HZPA 3AEJA 2YCPA 4PFFA 1MLYA 2AY1A 2TPLA 4K05A 1WYTB 3COGA 4F5LA 4M2MA 1CQ7A 3EUCA 4WLJA 2EPJA 4F5MA 4ZM4A 1LKCA 1W7LA 1T3IA 3P1TA 1DGEA 3F6TA 1EQBA 1M4NA 1V72A 4RITA 1SF2A 3TATA 1GC2A 2VI9A 3B1DA 1C7GA 4Y0HA 4CVQA 1TOIA 3E2ZB 3F9TA 3E2FA 3L8AA 4J8LA 1QISA 1B5OA 4OYTA 1CZCA 2VI8A 4AO4A 5M4BA 3QN6A 2GMSA 2VIAA 4RLGA 2VLHA 3PDXA 2X5DA 4R5ZA 3VK3A 3NYSA 4W1VA 4W8IA 4OBUA 2Z9UA 1AY4A 1WSTA 3WCOA 5D5SA 5BJ3A 3FZ8A 5LH9A 4XK1A 4ZASA 1GD9A 5F8VA 3N4RA 1WYUA 1I43A 3B1EA 4WYCA 2E7JA 2ZUKA 1IX8A 4BA5A 1ECXA 4KXKA 1BKGA 3JWAA 1LC7A 2FNUA 2X3LA 3BWNA 2YCNA 3GWPA 1LS3A 4A0FA 1AJSA 2YRIA 3PGYA 2Z9XA 2AY5A 2FYFA 2D63A 1XI9A 3KE3A 1ASEA 1AMRA 1DTYA 3ISLA 1ASCA 3NDNA 2A1VA 3T32A 3ZRRA 2BIEA 1AJRA 2CH1A 4XQ2A 3AELA 1AICA 4E77A 4WB0A 3GETA 1WKHA 1AMSA 2DGMA 2PB2A 4K2MA 1IAYA 4XJOA 2BI1A 4OCAA 1GC3A 2VGUA 4AOAA 1M0NA 3KKIA 4BA4A 1VEFA 1WYUB 3PDBB 5BJ4A 3TFUA 3JU7A 3QI6A 2EGYA 3GBXA 1E5FA 3FTBA 3K28A 1ARSA 1O61A 5EIGA 2BI2A 3KGXA 1AJSB 2PB0A 1LW5A 2Z1ZA 1AHEA 4WYAA 3NRAA 3MAUA 3E6GA 3BCBA 4F5GA 3H14A 5IWQA 2FN6A 3W1HA 1ASFA 1W7NA 3BCAA 4MGRA 4RM1A 2VMQA 2OGEA 3EI5A 1LC8A 5DX5A 3NYTA 4WB0B 2VGTA 3FFHA 4IXZA 2D65A 1AKCA 3CQ6A 3QPGA 3OKSA 4IYOB 5E5IA 3JZLA 4A0HA 1YIZA 2D7YA 2OKJA 2W7LA 4A0GA 2O7CA 4ITGA 2CANA 3DXVA 1KKPA 1ZC9A 3WGCA 1OXPA 4RJYA 3OP7A 4WD2A 3BWNC 5FT4A 2Z20A 4WP0A 5D95A 2JJEA 2AY3A 1ASBA 3IHJA 3W1JA 3DR4A 1TARA 2DKBA 2W8TA 3F0HA 4ADBA 2WK9A 2BIAA 1TASA 3RCHA 1ARTA 4WYGA 1IVRA 3P6KA 2ZY2A 1AKAA 1PG8A 4EU1A 1ORDA 3MKJA 4WXFA 1OATA 4F5IA 1AMAA 2XBNA 3FRKA 3AOVA 2WB6A 3A9ZA 1X29A 1OHWA 4XJMA 2ZC0A 1BJNA 2CJDA 1MLZA 2YCTA 1LK9A 1JS3A 4K2BA 1MAQA 1RV3A 3AEPA 3BWOA 3EZ1A 1IX7A 2X5FA 1D7RA 3NU8A 1RVYA 1S09A 4N0BA 3Q8NA 4M2KA 5K8BA 1B5PA 2VYCA 4I8AA 1SFFA 1V2FA 3ASBA 3DZZA 1BQDA 5AX8A 2ORDA 4R8DA 7AATA 1W3UA 2W8JA 3WGBA 1QGNA 3GZCA 1ELUA 4A6UA 3FDDA 4MQRA 1AHXA 2D5YA 1N31A 3FDBA 3TFTA 2EH6A 5J8QA 3RCHB 1AX4A 3EIAA 2OGAA 3JTXA 5EAAA 1MGVA 5LHAA 3EI8A 4JEWA 2AY7A 2BKWA 4LNJA 1MDXA 2NMPA 2XH1A 4MY5A 1MAPA 3TCMA 3ZZKA 2JJFA 4A6TA 2AY4A 2YKYA 3AOWA 1G4VA 3DU4A 2KFPA 2VIBA 5DB5A 2W7IA 5M4DA 3N4XA 4B9BA 1B9IA 1BQAA 4LC3A 4A72A 4AZJA 2Z9VA 2OKKA 3QBOA 1BW0A 3HDOA 1OHVA 1PFFA 1XEYA 1Y4IA 1E5EA 2YKVA 3VK4A 1AMQA 2VLFA 2G6WA 3HQTA 1JG8A 2YHKA 1GCKA 2CY8A 1YJZA 2VGWA 2HUFA 2YRRA 1QJ5A 2E7IA 2W7KA 3H9XA 2GQNA 4GE9A 4WYEA 4UHMA 2BWPA 1SZUA 3CBFA 4MQQA 3EI7A 2CTZA 4GDYA 1DFOA 2R5CA 2VGZA 2W8WA 3I5TA 3MAFA 2VMNA 2C7TA 3G8MA 1C0NA 1PMMA 1AAWA 4B98A 4F5FA 1I48A 1TATA 4DQ6A 2Z67A 4H51A 1J32A 3CAIA 1CL2A 2HUUA 4JE5D 4Y0DA 5E4ZA 2DKJA 3CQ5A 4ZAHA 2QB2A 2V1PA 3ZZJA 3UWCA 1WYVA 1GEXA 1WKGA 3VAXA 1M32A 5KTBA 1AAMA 4OBVA 2G7JA 1M7YA 1LW4A 4XJLA 4ZDPA 3B8XA 3EI6A 1ZODA 1D7VA 4AZKA 1YIYA 3FD0A 2DGLA 1EJIA 4GE4A 3VK2A 2ZP7A 4ATPA 3VP6A 5DJ9A 3ZRQA 4ATQA 1ASMA 2RFVA 1I29A 3G7QA 4A00A 4DGTA 1DJUA 4ZSYA 2W8UA 4EMYA 1SZSA 2JISA 1BS0A 2R5CB 3NTJA 3A9XA 3MAFB 1ARIA 3LVJA 2HP1A 1IUGA 4UHOA 2EYQA 2ZY5A 3QGUA 4ZLVA 1H0CA 4JEYA 4OTLA 4U2HA 3FFRA 2AY6A 1ASDA 3LV2A 1S06A 4RKDA 1QJ3A 1C7OA 4HF8A 2ZY4A 2CB1A 3HT4A 4O6ZA 3LVMA 1WYVB 2VGVA 3GJUA 5HXXA 4WYFA 3L44A 1QIRA 2CJGA 4BMKA 2D66A 2HOZA 1G7WA 4ISYA 4EB7A 4OC9A 2D64A 2GB3A 4WLHA 4PIWA 4H63Q 3A9YA 4UQVA 1CS1A 1FG7A 2PO3A 4IW7A 3ECDA 2AATA 4PVFA 1KL2A 3R4TA 1DGDA 4CXQA 2CFBA 3NX3A 5EFSA 1O62A 2R2NA 3WCNA 1AHGA 2EZ1A 2VMUA 2X8UA 3LVLB 4LNMA 5EQCA 5EUNA 3UAKA 1N8PA 4F4EA 1AHFA 4JEVA 4JF1A 3NYUA 1KL1A 5EIGB 5G0AA 2R0TA 2BIGA 1ELQA 1YJYA 2EZ2A 2QLRA 4LW4A 4WXGA 5FT5A 4CXRA 5EAVA 3FVUA 5E3KA 2VMTA 3EI9A 1YOOA 2CJHA 1C9CA 3FZ6A 1AKBA 3H7FA 3N4SA 4ZM3A 4W1WA 4R5FA 1RV4A 5M49A 1UKJA 3ZRPA 3PIUA 4EB5A 2W7FA 1S0AA 3FQAA 2VMXA 3GZDA 1CJ0A 2E54A 2Z1YA 3MC6A 4XAUA 2ZJGA 2VGSA 2QB3A 1AY5A 1JF9A 4BQ0A 1X0MA 2VMYA 3NU7A 4RIZA 1W23A 1FG3A 1M0OA 2C0RA 3N0LA 3RUYA 1KAFA 1AHYA 1TOKA 3BB8A 4U1TA 2VMRA 3DYDA 3I4JA 1D7UA 1YAAA 4FL0A 3ATHA 2FNIA 2JGTA 2CH2A 3UE8A 3B46A 3PPLA 3DODA 1PMOA 1S08A 3BN1A 4W5KA 2HOXA 1IAXA 3MADA 1I41A 4NOGA 2CINA 4UHNA 1QZ9A 2D7ZA 1CL1A 3HLMA 1YJSA 3QM2A 3AATA 2W7GA 2JJGA 4GEBA 2BI9A 3WKSA 2ZYJA 3G0TA 3A2BA 4F5JA 4EFFA 4QGRA 5FT8A 4K2IA 3E9KA 3HBXA 3USFA 2WK7A 3HVYA 3LWSA 1UU1A 5G2QA 4W91A 1VP4A 1TOEA 1ASAA 3FVXA 4FFCA 3RBFA 3NUIA 3BV0A 2WK8A 3N5MA 4TV7A 1JS6A 3CQ4A 4AO9A 2BYJA 4F5KA 1OHYA 3FKDA 4ITXA 1ASGA 3BC8A 1Z7DA 4KAMA 1M6SA 3N7NA 4GRXA 2DGKA 1MDOA 3WY7A 1C4KA 3N75A 1C7NA 4ZWVA 1GC4A 1G7XA 4ZWMA 1B9HA 4DBCA 3A8UX 3D6KA 3PJ0A 4Q6RA 1U08A 1DKAA 3GZDC 2BHXA 3WLXA 1GBNA 2O1BA 2W7MA 4A0RA 3MC6C 3WZFA 1DJEA 3RI6A 4W1XA 5C6UA 4LW2A 4LNLA 3RBLA 1X2AA 2BYLA 3PDBA 4P7YA 3ELPA 1ZOBA 1J04A 3BS8A 3K7YA 1MDZA 3ACZA 4OMAA 1AIBA 1O4SA 3FSLA 2AY8A 3AEMA 2FQ6A 2BI5A 1O69A 3DXWA 3I16A 1H1CA 2VMOA 3EZSA 2FKIA 2QBTA 1GEWA 2HUIA 3W1IA 4RJ0A 4Q75A 4ADEA 1IJIA 2OQXA 3IF2A 4XEWA 3E77A 2D61A 5DJ1A 4JF0A 2HORA 2VMVA 2W7HA 4IXSA 3R9AA 2EO5A 4TMRA 1OXOA 1B4XA 3AEJC 3LVKA 4IYOA 2Z61A 2GMUA 3DRDA 5HDMA 3NNKA 3RQ1A 1CQ6A 2YKXA 1CQ8A 2W8VA 4J5UA 4WYDA 4N0WA 2C81A 1CZEA 4JEZA 4E3QA 4BHDA 2R5EA 4JEXA 4TN4A 3VOMA 1AIAA 1BT4A 3GSBA 1P3WA 1LC5A 4PFNA 4Q31A 1ASLA 2FM1A 4L0OA 3AENA 3JWBA 3MBBA 1V2EA 1S07A 1M0PA 2VMWA 4MQPA 4MSOA 1D7SA 1RVUA 2W7JA 3ASAA 4UOYA 1YNUA 2JG2A 2W7DA 3NUBA 2HOYA 3FZ7A 2VMZA 3ELEA 4R2NA 2CSTA 3AEOA 5I92A 3WX9A 1BJOA 1ARHA 3EIBA 1AY8A 4RKCA 3TQXA 4CBSA 2BI3A 4KYOA 5FT6A 2ZY3A 1N2TA 4RAEA 1QITA 2W7EA 1KMJA 2DOUA 1BJ4A 3LY1A 1G4XA 2WKAA 3M5UA 5EUDA 1EG5A 1W7MA 2QA3A 2AEUA 5TF5A 1DJ9A 3FQ7A 3PD6A 3QHXA 4MKKA 1UU0A 1VJOA 4P3MA 4WBTA 4F5HA 2QSRA 1KMKA 3LG0A 4E3RA 3MEBA 4ZDOA 3DR7A 2YKUA 2VMPA 5G09A 2ZSLA 4ADDA 1TOJA 3AEMC 4IXOA 4ADCA 5G4JA 4MKJA 2E7UA 1TPLA 3E2YA 3II0A 4AH3A 1M0QA 1TOGA 2Q7WA 3AENB 3HL2A 2JJHA 3B1CA 4IX8A 4Q76A 2ZSMA 3WKRA 1WYTA 5HHYA 3GR9A 2GSAA 2HP2A 3FCRA 4GE7A 4GSAA 2V0YA 4HVKA 1GEYA 2AY9A 5EUEA 3FVSA 3K40A 3PAAA 1SZKA 1BJOB 1SPAA 2AY2A 9AATA 1GDEA 2BWOA 2YOBA 2DR1A 4M2JA 3E2ZA 1IX6A 1SVVA 1D2FA 2Z9WA 3FQ8A
chains in the Genus database with same CATH topology
5G2PA 1ASNA 3AV7A 1FC4A 2OATA 4WXBA 2C44A 3PD6B 5M46A 4XJPA 1X28A 5JAYA 4E1OA 1ARGA 3PA9A 5F9SA 3HMUA 3KGWA 4CBRA 2F8JA 5G4IA 2QMAA 3BCXA 2O0RA 3DC1A 4A6RA 2BWNA 1BJWA 1KKJA 1UU2A 4Y0IA 4ZDLA 4ZSWA 4JE5A 8AATA 2VMSA 4IY7A 1GC0A 3JW9A 2AEVA 4OT8A 1B8GA 1IBJA 1V2DA 1Z3ZA 2HZPA 3AEJA 2YCPA 4PFFA 1MLYA 2AY1A 2TPLA 4K05A 1WYTB 3COGA 4F5LA 4M2MA 1CQ7A 3EUCA 4WLJA 2EPJA 4F5MA 4ZM4A 1LKCA 1W7LA 1T3IA 3P1TA 1DGEA 3F6TA 1EQBA 1M4NA 1V72A 4RITA 1SF2A 3TATA 1GC2A 2VI9A 3B1DA 1C7GA 4Y0HA 4CVQA 1TOIA 3E2ZB 3F9TA 3E2FA 3L8AA 4J8LA 1QISA 1B5OA 4OYTA 1CZCA 2VI8A 4AO4A 5M4BA 3QN6A 2GMSA 2VIAA 4RLGA 2VLHA 3PDXA 2X5DA 4R5ZA 3VK3A 3NYSA 4W1VA 4W8IA 4OBUA 2Z9UA 1AY4A 1WSTA 3WCOA 5D5SA 5BJ3A 3FZ8A 5LH9A 4XK1A 4ZASA 1GD9A 5F8VA 3N4RA 1WYUA 1I43A 3B1EA 4WYCA 2E7JA 2ZUKA 1IX8A 4BA5A 1ECXA 4KXKA 1BKGA 3JWAA 1LC7A 2FNUA 2X3LA 3BWNA 2YCNA 3GWPA 1LS3A 4A0FA 1AJSA 2YRIA 3PGYA 2Z9XA 2AY5A 2FYFA 2D63A 1XI9A 3KE3A 1ASEA 1AMRA 1DTYA 3ISLA 1ASCA 3NDNA 2A1VA 3T32A 3ZRRA 2BIEA 1AJRA 2CH1A 4XQ2A 3AELA 1AICA 4E77A 4WB0A 3GETA 1WKHA 1AMSA 2DGMA 2PB2A 4K2MA 1IAYA 4XJOA 2BI1A 4OCAA 1GC3A 2VGUA 4AOAA 1M0NA 3KKIA 4BA4A 1VEFA 1WYUB 3PDBB 5BJ4A 3TFUA 3JU7A 3QI6A 2EGYA 3GBXA 1E5FA 3FTBA 3K28A 1ARSA 1O61A 5EIGA 2BI2A 3KGXA 1AJSB 2PB0A 1LW5A 2Z1ZA 1AHEA 4WYAA 3NRAA 3MAUA 3E6GA 3BCBA 4F5GA 3H14A 5IWQA 2FN6A 3W1HA 1ASFA 1W7NA 3BCAA 4MGRA 4RM1A 2VMQA 2OGEA 3EI5A 1LC8A 5DX5A 3NYTA 4WB0B 2VGTA 3FFHA 4IXZA 2D65A 1AKCA 3CQ6A 3QPGA 3OKSA 4IYOB 5E5IA 3JZLA 4A0HA 1YIZA 2D7YA 2OKJA 2W7LA 4A0GA 2O7CA 4ITGA 2CANA 3DXVA 1KKPA 1ZC9A 3WGCA 1OXPA 4RJYA 3OP7A 4WD2A 3BWNC 5FT4A 2Z20A 4WP0A 5D95A 2JJEA 2AY3A 1ASBA 3IHJA 3W1JA 3DR4A 1TARA 2DKBA 2W8TA 3F0HA 4ADBA 2WK9A 2BIAA 1TASA 3RCHA 1ARTA 4WYGA 1IVRA 3P6KA 2ZY2A 1AKAA 1PG8A 4EU1A 1ORDA 3MKJA 4WXFA 1OATA 4F5IA 1AMAA 2XBNA 3FRKA 3AOVA 2WB6A 3A9ZA 1X29A 1OHWA 4XJMA 2ZC0A 1BJNA 2CJDA 1MLZA 2YCTA 1LK9A 1JS3A 4K2BA 1MAQA 1RV3A 3AEPA 3BWOA 3EZ1A 1IX7A 2X5FA 1D7RA 3NU8A 1RVYA 1S09A 4N0BA 3Q8NA 4M2KA 5K8BA 1B5PA 2VYCA 4I8AA 1SFFA 1V2FA 3ASBA 3DZZA 1BQDA 5AX8A 2ORDA 4R8DA 7AATA 1W3UA 2W8JA 3WGBA 1QGNA 3GZCA 1ELUA 4A6UA 3FDDA 4MQRA 1AHXA 2D5YA 1N31A 3FDBA 3TFTA 2EH6A 5J8QA 3RCHB 1AX4A 3EIAA 2OGAA 3JTXA 5EAAA 1MGVA 5LHAA 3EI8A 4JEWA 2AY7A 2BKWA 4LNJA 1MDXA 2NMPA 2XH1A 4MY5A 1MAPA 3TCMA 3ZZKA 2JJFA 4A6TA 2AY4A 2YKYA 3AOWA 1G4VA 3DU4A 2KFPA 2VIBA 5DB5A 2W7IA 5M4DA 3N4XA 4B9BA 1B9IA 1BQAA 4LC3A 4A72A 4AZJA 2Z9VA 2OKKA 3QBOA 1BW0A 3HDOA 1OHVA 1PFFA 1XEYA 1Y4IA 1E5EA 2YKVA 3VK4A 1AMQA 2VLFA 2G6WA 3HQTA 1JG8A 2YHKA 1GCKA 2CY8A 1YJZA 2VGWA 2HUFA 2YRRA 1QJ5A 2E7IA 2W7KA 3H9XA 2GQNA 4GE9A 4WYEA 4UHMA 2BWPA 1SZUA 3CBFA 4MQQA 3EI7A 2CTZA 4GDYA 1DFOA 2R5CA 2VGZA 2W8WA 3I5TA 3MAFA 2VMNA 2C7TA 3G8MA 1C0NA 1PMMA 1AAWA 4B98A 4F5FA 1I48A 1TATA 4DQ6A 2Z67A 4H51A 1J32A 3CAIA 1CL2A 2HUUA 4JE5D 4Y0DA 5E4ZA 2DKJA 3CQ5A 4ZAHA 2QB2A 2V1PA 3ZZJA 3UWCA 1WYVA 1GEXA 1WKGA 3VAXA 1M32A 5KTBA 1AAMA 4OBVA 2G7JA 1M7YA 1LW4A 4XJLA 4ZDPA 3B8XA 3EI6A 1ZODA 1D7VA 4AZKA 1YIYA 3FD0A 2DGLA 1EJIA 4GE4A 3VK2A 2ZP7A 4ATPA 3VP6A 5DJ9A 3ZRQA 4ATQA 1ASMA 2RFVA 1I29A 3G7QA 4A00A 4DGTA 1DJUA 4ZSYA 2W8UA 4EMYA 1SZSA 2JISA 1BS0A 2R5CB 3NTJA 3A9XA 3MAFB 1ARIA 3LVJA 2HP1A 1IUGA 4UHOA 2EYQA 2ZY5A 3QGUA 4ZLVA 1H0CA 4JEYA 4OTLA 4U2HA 3FFRA 2AY6A 1ASDA 3LV2A 1S06A 4RKDA 1QJ3A 1C7OA 4HF8A 2ZY4A 2CB1A 3HT4A 4O6ZA 3LVMA 1WYVB 2VGVA 3GJUA 5HXXA 4WYFA 3L44A 1QIRA 2CJGA 4BMKA 2D66A 2HOZA 1G7WA 4ISYA 4EB7A 4OC9A 2D64A 2GB3A 4WLHA 4PIWA 4H63Q 3A9YA 4UQVA 1CS1A 1FG7A 2PO3A 4IW7A 3ECDA 2AATA 4PVFA 1KL2A 3R4TA 1DGDA 4CXQA 2CFBA 3NX3A 5EFSA 1O62A 2R2NA 3WCNA 1AHGA 2EZ1A 2VMUA 2X8UA 3LVLB 4LNMA 5EQCA 5EUNA 3UAKA 1N8PA 4F4EA 1AHFA 4JEVA 4JF1A 3NYUA 1KL1A 5EIGB 5G0AA 2R0TA 2BIGA 1ELQA 1YJYA 2EZ2A 2QLRA 4LW4A 4WXGA 5FT5A 4CXRA 5EAVA 3FVUA 5E3KA 2VMTA 3EI9A 1YOOA 2CJHA 1C9CA 3FZ6A 1AKBA 3H7FA 3N4SA 4ZM3A 4W1WA 4R5FA 1RV4A 5M49A 1UKJA 3ZRPA 3PIUA 4EB5A 2W7FA 1S0AA 3FQAA 2VMXA 3GZDA 1CJ0A 2E54A 2Z1YA 3MC6A 4XAUA 2ZJGA 2VGSA 2QB3A 1AY5A 1JF9A 4BQ0A 1X0MA 2VMYA 3NU7A 4RIZA 1W23A 1FG3A 1M0OA 2C0RA 3N0LA 3RUYA 1AHYA 1TOKA 3BB8A 4U1TA 2VMRA 3DYDA 3I4JA 1D7UA 1YAAA 4FL0A 3ATHA 2FNIA 2JGTA 2CH2A 3UE8A 3B46A 3PPLA 3DODA 1PMOA 1S08A 3BN1A 4W5KA 2HOXA 1IAXA 3MADA 1I41A 4NOGA 2CINA 4UHNA 1QZ9A 2D7ZA 1CL1A 3HLMA 1YJSA 3QM2A 3AATA 2W7GA 2JJGA 4GEBA 2BI9A 3WKSA 2ZYJA 3G0TA 3A2BA 4F5JA 4EFFA 4QGRA 5FT8A 4K2IA 3E9KA 3HBXA 3USFA 2WK7A 3HVYA 3LWSA 1UU1A 5G2QA 4W91A 1VP4A 1TOEA 1ASAA 3FVXA 4FFCA 3RBFA 3NUIA 3BV0A 2WK8A 3N5MA 4TV7A 1JS6A 3CQ4A 4AO9A 2BYJA 4F5KA 1OHYA 3FKDA 4ITXA 1ASGA 3BC8A 1Z7DA 4KAMA 1M6SA 3N7NA 4GRXA 2DGKA 1MDOA 3WY7A 1C4KA 3N75A 1C7NA 4ZWVA 1GC4A 1G7XA 4ZWMA 1B9HA 4DBCA 3A8UX 3D6KA 3PJ0A 4Q6RA 1U08A 1DKAA 3GZDC 2BHXA 3WLXA 1GBNA 2O1BA 2W7MA 4A0RA 3MC6C 3WZFA 1DJEA 3RI6A 4W1XA 5C6UA 4LW2A 4LNLA 3RBLA 1X2AA 2BYLA 3PDBA 4P7YA 3ELPA 1ZOBA 1J04A 3BS8A 3K7YA 1MDZA 3ACZA 4OMAA 1AIBA 1O4SA 3FSLA 2AY8A 3AEMA 2FQ6A 2BI5A 1O69A 3DXWA 3I16A 1H1CA 2VMOA 3EZSA 2FKIA 2QBTA 1GEWA 2HUIA 3W1IA 4RJ0A 4Q75A 4ADEA 1IJIA 2OQXA 3IF2A 4XEWA 3E77A 2D61A 5DJ1A 4JF0A 2HORA 2VMVA 2W7HA 4IXSA 3R9AA 2EO5A 4TMRA 1OXOA 1B4XA 3AEJC 3LVKA 4IYOA 2Z61A 2GMUA 3DRDA 5HDMA 3NNKA 3RQ1A 1CQ6A 2YKXA 1CQ8A 2W8VA 4J5UA 4WYDA 4N0WA 2C81A 1CZEA 4JEZA 4E3QA 4BHDA 2R5EA 4JEXA 4TN4A 3VOMA 1AIAA 1BT4A 3GSBA 1P3WA 1LC5A 4PFNA 4Q31A 1ASLA 2FM1A 4L0OA 3AENA 3JWBA 3MBBA 1V2EA 1S07A 1M0PA 2VMWA 4MQPA 4MSOA 1D7SA 1RVUA 2W7JA 3ASAA 4UOYA 1YNUA 2JG2A 2W7DA 3NUBA 2HOYA 3FZ7A 2VMZA 3ELEA 4R2NA 2CSTA 3AEOA 5I92A 3WX9A 1BJOA 1ARHA 3EIBA 1AY8A 4RKCA 3TQXA 4CBSA 2BI3A 4KYOA 5FT6A 2ZY3A 1N2TA 4RAEA 1QITA 2W7EA 1KMJA 2DOUA 1BJ4A 3LY1A 1G4XA 2WKAA 3M5UA 5EUDA 1EG5A 1W7MA 2QA3A 2AEUA 5TF5A 1DJ9A 3FQ7A 3PD6A 3QHXA 4MKKA 1UU0A 1VJOA 4P3MA 4WBTA 4F5HA 2QSRA 1KMKA 3LG0A 4E3RA 3MEBA 4ZDOA 3DR7A 2YKUA 2VMPA 5G09A 2ZSLA 4ADDA 1TOJA 3AEMC 4IXOA 4ADCA 5G4JA 4MKJA 2E7UA 1TPLA 3E2YA 3II0A 4AH3A 1M0QA 1TOGA 2Q7WA 3AENB 3HL2A 2JJHA 3B1CA 4IX8A 4Q76A 2ZSMA 3WKRA 1WYTA 5HHYA 3GR9A 2GSAA 2HP2A 3FCRA 4GE7A 4GSAA 2V0YA 4HVKA 1GEYA 2AY9A 5EUEA 3FVSA 3K40A 3PAAA 1SZKA 1BJOB 1SPAA 2AY2A 9AATA 1GDEA 2BWOA 2YOBA 2DR1A 4M2JA 3E2ZA 1IX6A 1SVVA 1D2FA 2Z9WA 3FQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G2P A;  1ASN A;  3AV7 A;  1FC4 A;  2OAT A;  4WXB A;  2C44 A;  3PD6 B;  5M46 A;  4XJP A;  1X28 A;  5JAY A;  4E1O A;  1ARG A;  3PA9 A;  5F9S A;  3HMU A;  3KGW A;  4CBR A;  2F8J A;  5G4I A;  2QMA A;  3BCX A;  2O0R A;  3DC1 A;  4A6R A;  2BWN A;  1BJW A;  1KKJ A;  1UU2 A;  4Y0I A;  4ZDL A;  4ZSW A;  4JE5 A;  8AAT A;  2VMS A;  4IY7 A;  1GC0 A;  3JW9 A;  2AEV A;  4OT8 A;  1B8G A;  1IBJ A;  1V2D A;  1Z3Z A;  2HZP A;  3AEJ A;  2YCP A;  4PFF A;  1MLY A;  2AY1 A;  2TPL A;  1WYT B;  3COG A;  4F5L A;  4M2M A;  1CQ7 A;  3EUC A;  4WLJ A;  2EPJ A;  4F5M A;  4ZM4 A;  1LKC A;  1W7L A;  1T3I A;  3P1T A;  1DGE A;  3F6T A;  1EQB A;  1M4N A;  1V72 A;  4RIT A;  1SF2 A;  3TAT A;  1GC2 A;  2VI9 A;  3B1D A;  1C7G A;  4Y0H A;  4CVQ A;  1TOI A;  3E2Z B;  3F9T A;  3E2F A;  3L8A A;  4J8L A;  1QIS A;  1B5O A;  4OYT A;  1CZC A;  2VI8 A;  4AO4 A;  5M4B A;  3QN6 A;  2GMS A;  2VIA A;  4RLG A;  2VLH A;  3PDX A;  2X5D A;  4R5Z A;  3VK3 A;  3NYS A;  4W1V A;  4W8I A;  4OBU A;  2Z9U A;  1AY4 A;  1WST A;  3WCO A;  5D5S A;  5BJ3 A;  3FZ8 A;  5LH9 A;  4XK1 A;  4ZAS A;  1GD9 A;  5F8V A;  1WYU A;  1I43 A;  3B1E A;  4WYC A;  2E7J A;  2ZUK A;  1IX8 A;  4BA5 A;  1ECX A;  4KXK A;  1BKG A;  3JWA A;  1LC7 A;  2FNU A;  2X3L A;  3BWN A;  2YCN A;  3GWP A;  1LS3 A;  4A0F A;  1AJS A;  2YRI A;  3PGY A;  2Z9X A;  2AY5 A;  2FYF A;  2D63 A;  1XI9 A;  3KE3 A;  1ASE A;  1AMR A;  1DTY A;  3ISL A;  1ASC A;  3NDN A;  3T32 A;  3ZRR A;  2BIE A;  1AJR A;  2CH1 A;  4XQ2 A;  3AEL A;  1AIC A;  4E77 A;  4WB0 A;  3GET A;  1WKH A;  1AMS A;  2DGM A;  2PB2 A;  4K2M A;  1IAY A;  4XJO A;  2BI1 A;  4OCA A;  1GC3 A;  2VGU A;  4AOA A;  1M0N A;  3KKI A;  4BA4 A;  1VEF A;  1WYU B;  3PDB B;  5BJ4 A;  3TFU A;  3JU7 A;  3QI6 A;  2EGY A;  3GBX A;  1E5F A;  3FTB A;  3K28 A;  1ARS A;  1O61 A;  5EIG A;  2BI2 A;  3KGX A;  1AJS B;  2PB0 A;  1LW5 A;  2Z1Z A;  1AHE A;  4WYA A;  3NRA A;  3MAU A;  3E6G A;  3BCB A;  4F5G A;  3H14 A;  5IWQ A;  2FN6 A;  3W1H A;  1ASF A;  1W7N A;  3BCA A;  4MGR A;  4RM1 A;  2VMQ A;  2OGE A;  3EI5 A;  1LC8 A;  5DX5 A;  3NYT A;  4WB0 B;  2VGT A;  3FFH A;  4IXZ A;  2D65 A;  1AKC A;  3CQ6 A;  3QPG A;  3OKS A;  4IYO B;  5E5I A;  3JZL A;  4A0H A;  1YIZ A;  2D7Y A;  2OKJ A;  2W7L A;  4A0G A;  2O7C A;  4ITG A;  2CAN A;  3DXV A;  1KKP A;  1ZC9 A;  3WGC A;  1OXP A;  4RJY A;  3OP7 A;  4WD2 A;  3BWN C;  5FT4 A;  2Z20 A;  4WP0 A;  5D95 A;  2JJE A;  2AY3 A;  1ASB A;  3IHJ A;  3W1J A;  3DR4 A;  1TAR A;  2DKB A;  2W8T A;  3F0H A;  4ADB A;  2WK9 A;  2BIA A;  1TAS A;  3RCH A;  1ART A;  4WYG A;  1IVR A;  3P6K A;  2ZY2 A;  1AKA A;  1PG8 A;  4EU1 A;  1ORD A;  3MKJ A;  4WXF A;  1OAT A;  4F5I A;  1AMA A;  2XBN A;  3FRK A;  3AOV A;  3A9Z A;  1X29 A;  1OHW A;  4XJM A;  2ZC0 A;  1BJN A;  2CJD A;  1MLZ A;  2YCT A;  1LK9 A;  1JS3 A;  4K2B A;  1MAQ A;  1RV3 A;  3AEP A;  3BWO A;  3EZ1 A;  1IX7 A;  2X5F A;  1D7R A;  3NU8 A;  1RVY A;  1S09 A;  4N0B A;  3Q8N A;  4M2K A;  5K8B A;  1B5P A;  2VYC A;  4I8A A;  1SFF A;  1V2F A;  3ASB A;  3DZZ A;  1BQD A;  5AX8 A;  2ORD A;  4R8D A;  7AAT A;  1W3U A;  2W8J A;  3WGB A;  1QGN A;  3GZC A;  1ELU A;  4A6U A;  3FDD A;  4MQR A;  1AHX A;  2D5Y A;  1N31 A;  3FDB A;  3TFT A;  2EH6 A;  5J8Q A;  3RCH B;  1AX4 A;  3EIA A;  2OGA A;  3JTX A;  5EAA A;  1MGV A;  5LHA A;  3EI8 A;  4JEW A;  2AY7 A;  2BKW A;  4LNJ A;  1MDX A;  2NMP A;  2XH1 A;  4MY5 A;  1MAP A;  3TCM A;  3ZZK A;  2JJF A;  4A6T A;  2AY4 A;  2YKY A;  3AOW A;  1G4V A;  3DU4 A;  2VIB A;  5DB5 A;  2W7I A;  5M4D A;  4B9B A;  1B9I A;  1BQA A;  4LC3 A;  4A72 A;  4AZJ A;  2Z9V A;  2OKK A;  3QBO A;  1BW0 A;  3HDO A;  1OHV A;  1PFF A;  1XEY A;  1Y4I A;  1E5E A;  2YKV A;  3VK4 A;  1AMQ A;  2VLF A;  2G6W A;  3HQT A;  1JG8 A;  2YHK A;  1GCK A;  2CY8 A;  1YJZ A;  2VGW A;  2HUF A;  2YRR A;  1QJ5 A;  2E7I A;  2W7K A;  2GQN A;  4GE9 A;  4WYE A;  4UHM A;  2BWP A;  1SZU A;  3CBF A;  4MQQ A;  3EI7 A;  2CTZ A;  4GDY A;  1DFO A;  2R5C A;  2VGZ A;  2W8W A;  3I5T A;  3MAF A;  2VMN A;  2C7T A;  3G8M A;  1C0N A;  1PMM A;  1AAW A;  4B98 A;  4F5F A;  1I48 A;  1TAT A;  4DQ6 A;  2Z67 A;  4H51 A;  1J32 A;  3CAI A;  1CL2 A;  2HUU A;  4JE5 D;  4Y0D A;  5E4Z A;  2DKJ A;  3CQ5 A;  4ZAH A;  2QB2 A;  2V1P A;  3ZZJ A;  3UWC A;  1WYV A;  1GEX A;  1WKG A;  3VAX A;  1M32 A;  1AAM A;  4OBV A;  1M7Y A;  1LW4 A;  4XJL A;  4ZDP A;  3B8X A;  3EI6 A;  1ZOD A;  1D7V A;  4AZK A;  1YIY A;  3FD0 A;  2DGL A;  1EJI A;  4GE4 A;  3VK2 A;  2ZP7 A;  4ATP A;  3VP6 A;  5DJ9 A;  3ZRQ A;  4ATQ A;  1ASM A;  2RFV A;  1I29 A;  3G7Q A;  4A00 A;  4DGT A;  1DJU A;  4ZSY A;  2W8U A;  4EMY A;  1SZS A;  2JIS A;  1BS0 A;  2R5C B;  3NTJ A;  3A9X A;  3MAF B;  1ARI A;  3LVJ A;  2HP1 A;  1IUG A;  4UHO A;  2ZY5 A;  3QGU A;  4ZLV A;  1H0C A;  4JEY A;  4OTL A;  4U2H A;  3FFR A;  2AY6 A;  1ASD A;  3LV2 A;  1S06 A;  4RKD A;  1QJ3 A;  1C7O A;  4HF8 A;  2ZY4 A;  2CB1 A;  3HT4 A;  4O6Z A;  3LVM A;  1WYV B;  2VGV A;  3GJU A;  5HXX A;  4WYF A;  3L44 A;  1QIR A;  2CJG A;  4BMK A;  2D66 A;  2HOZ A;  1G7W A;  4ISY A;  4EB7 A;  4OC9 A;  2D64 A;  2GB3 A;  4WLH A;  4PIW A;  3A9Y A;  4UQV A;  1CS1 A;  1FG7 A;  2PO3 A;  4IW7 A;  3ECD A;  2AAT A;  4PVF A;  1KL2 A;  3R4T A;  1DGD A;  4CXQ A;  2CFB A;  3NX3 A;  5EFS A;  1O62 A;  2R2N A;  3WCN A;  1AHG A;  2EZ1 A;  2VMU A;  2X8U A;  3LVL B;  4LNM A;  5EQC A;  5EUN A;  3UAK A;  1N8P A;  4F4E A;  1AHF A;  4JEV A;  4JF1 A;  3NYU A;  1KL1 A;  5EIG B;  5G0A A;  2R0T A;  2BIG A;  1ELQ A;  1YJY A;  2EZ2 A;  2QLR A;  4LW4 A;  4WXG A;  5FT5 A;  4CXR A;  5EAV A;  3FVU A;  5E3K A;  2VMT A;  3EI9 A;  1YOO A;  2CJH A;  1C9C A;  3FZ6 A;  1AKB A;  3H7F A;  4ZM3 A;  4W1W A;  4R5F A;  1RV4 A;  5M49 A;  1UKJ A;  3ZRP A;  3PIU A;  4EB5 A;  2W7F A;  1S0A A;  3FQA A;  2VMX A;  3GZD A;  1CJ0 A;  2E54 A;  2Z1Y A;  3MC6 A;  4XAU A;  2ZJG A;  2VGS A;  2QB3 A;  1AY5 A;  1JF9 A;  4BQ0 A;  1X0M A;  2VMY A;  3NU7 A;  4RIZ A;  1W23 A;  1FG3 A;  1M0O A;  2C0R A;  3N0L A;  3RUY A;  1AHY A;  1TOK A;  3BB8 A;  4U1T A;  2VMR A;  3DYD A;  3I4J A;  1D7U A;  1YAA A;  4FL0 A;  3ATH A;  2FNI A;  2JGT A;  2CH2 A;  3UE8 A;  3B46 A;  3PPL A;  3DOD A;  1PMO A;  1S08 A;  3BN1 A;  4W5K A;  2HOX A;  1IAX A;  3MAD A;  1I41 A;  4NOG A;  2CIN A;  4UHN A;  1QZ9 A;  2D7Z A;  1CL1 A;  3HLM A;  1YJS A;  3QM2 A;  3AAT A;  2W7G A;  2JJG A;  4GEB A;  2BI9 A;  3WKS A;  2ZYJ A;  3G0T A;  3A2B A;  4F5J A;  4EFF A;  4QGR A;  5FT8 A;  4K2I A;  3E9K A;  3HBX A;  3USF A;  2WK7 A;  3HVY A;  3LWS A;  1UU1 A;  5G2Q A;  4W91 A;  1VP4 A;  1TOE A;  1ASA A;  3FVX A;  4FFC A;  3RBF A;  3NUI A;  3BV0 A;  2WK8 A;  3N5M A;  4TV7 A;  1JS6 A;  3CQ4 A;  4AO9 A;  2BYJ A;  4F5K A;  1OHY A;  3FKD A;  4ITX A;  1ASG A;  3BC8 A;  1Z7D A;  4KAM A;  1M6S A;  4GRX A;  2DGK A;  1MDO A;  3WY7 A;  1C4K A;  3N75 A;  1C7N A;  4ZWV A;  1GC4 A;  1G7X A;  4ZWM A;  1B9H A;  4DBC A;  3A8U X;  3D6K A;  3PJ0 A;  4Q6R A;  1U08 A;  1DKA A;  3GZD C;  2BHX A;  3WLX A;  1GBN A;  2O1B A;  2W7M A;  4A0R A;  3MC6 C;  3WZF A;  1DJE A;  3RI6 A;  4W1X A;  5C6U A;  4LW2 A;  4LNL A;  3RBL A;  1X2A A;  2BYL A;  3PDB A;  4P7Y A;  3ELP A;  1ZOB A;  1J04 A;  3BS8 A;  3K7Y A;  1MDZ A;  3ACZ A;  4OMA A;  1AIB A;  1O4S A;  3FSL A;  2AY8 A;  3AEM A;  2FQ6 A;  2BI5 A;  1O69 A;  3DXW A;  3I16 A;  1H1C A;  2VMO A;  3EZS A;  2QBT A;  1GEW A;  2HUI A;  3W1I A;  4RJ0 A;  4Q75 A;  4ADE A;  1IJI A;  2OQX A;  3IF2 A;  4XEW A;  3E77 A;  2D61 A;  5DJ1 A;  4JF0 A;  2HOR A;  2VMV A;  2W7H A;  4IXS A;  3R9A A;  2EO5 A;  4TMR A;  1OXO A;  1B4X A;  3AEJ C;  3LVK A;  4IYO A;  2Z61 A;  2GMU A;  3DRD A;  5HDM A;  3NNK A;  3RQ1 A;  1CQ6 A;  2YKX A;  1CQ8 A;  2W8V A;  4J5U A;  4WYD A;  4N0W A;  2C81 A;  1CZE A;  4JEZ A;  4E3Q A;  4BHD A;  2R5E A;  4JEX A;  4TN4 A;  3VOM A;  1AIA A;  1BT4 A;  3GSB A;  1P3W A;  1LC5 A;  4PFN A;  4Q31 A;  1ASL A;  2FM1 A;  4L0O A;  3AEN A;  3JWB A;  3MBB A;  1V2E A;  1S07 A;  1M0P A;  2VMW A;  4MQP A;  4MSO A;  1D7S A;  1RVU A;  2W7J A;  3ASA A;  4UOY A;  1YNU A;  2JG2 A;  2W7D A;  3NUB A;  2HOY A;  3FZ7 A;  2VMZ A;  3ELE A;  4R2N A;  2CST A;  3AEO A;  5I92 A;  3WX9 A;  1BJO A;  1ARH A;  3EIB A;  1AY8 A;  4RKC A;  3TQX A;  4CBS A;  2BI3 A;  4KYO A;  5FT6 A;  2ZY3 A;  1N2T A;  4RAE A;  1QIT A;  2W7E A;  1KMJ A;  2DOU A;  1BJ4 A;  3LY1 A;  1G4X A;  2WKA A;  3M5U A;  5EUD A;  1EG5 A;  1W7M A;  2QA3 A;  2AEU A;  5TF5 A;  1DJ9 A;  3FQ7 A;  3PD6 A;  3QHX A;  4MKK A;  1UU0 A;  1VJO A;  4P3M A;  4WBT A;  4F5H A;  1KMK A;  3LG0 A;  4E3R A;  3MEB A;  4ZDO A;  3DR7 A;  2YKU A;  2VMP A;  5G09 A;  2ZSL A;  4ADD A;  1TOJ A;  3AEM C;  4IXO A;  4ADC A;  5G4J A;  4MKJ A;  2E7U A;  1TPL A;  3E2Y A;  3II0 A;  4AH3 A;  1M0Q A;  1TOG A;  2Q7W A;  3AEN B;  3HL2 A;  2JJH A;  3B1C A;  4IX8 A;  4Q76 A;  2ZSM A;  3WKR A;  1WYT A;  5HHY A;  3GR9 A;  2GSA A;  2HP2 A;  3FCR A;  4GE7 A;  4GSA A;  2V0Y A;  4HVK A;  1GEY A;  2AY9 A;  5EUE A;  3FVS A;  3K40 A;  3PAA A;  1SZK A;  1BJO B;  1SPA A;  2AY2 A;  9AAT A;  1GDE A;  2BWO A;  2YOB A;  2DR1 A;  4M2J A;  3E2Z A;  1IX6 A;  1SVV A;  1D2F A;  2Z9W A;  3FQ8 A; 
#chains in the Genus database with same CATH topology
 5G2P A;  1ASN A;  3AV7 A;  1FC4 A;  2OAT A;  4WXB A;  2C44 A;  3PD6 B;  5M46 A;  4XJP A;  1X28 A;  5JAY A;  4E1O A;  1ARG A;  3PA9 A;  5F9S A;  3HMU A;  3KGW A;  4CBR A;  2F8J A;  5G4I A;  2QMA A;  3BCX A;  2O0R A;  3DC1 A;  4A6R A;  2BWN A;  1BJW A;  1KKJ A;  1UU2 A;  4Y0I A;  4ZDL A;  4ZSW A;  4JE5 A;  8AAT A;  2VMS A;  4IY7 A;  1GC0 A;  3JW9 A;  2AEV A;  4OT8 A;  1B8G A;  1IBJ A;  1V2D A;  1Z3Z A;  2HZP A;  3AEJ A;  2YCP A;  4PFF A;  1MLY A;  2AY1 A;  2TPL A;  4K05 A;  1WYT B;  3COG A;  4F5L A;  4M2M A;  1CQ7 A;  3EUC A;  4WLJ A;  2EPJ A;  4F5M A;  4ZM4 A;  1LKC A;  1W7L A;  1T3I A;  3P1T A;  1DGE A;  3F6T A;  1EQB A;  1M4N A;  1V72 A;  4RIT A;  1SF2 A;  3TAT A;  1GC2 A;  2VI9 A;  3B1D A;  1C7G A;  4Y0H A;  4CVQ A;  1TOI A;  3E2Z B;  3F9T A;  3E2F A;  3L8A A;  4J8L A;  1QIS A;  1B5O A;  4OYT A;  1CZC A;  2VI8 A;  4AO4 A;  5M4B A;  3QN6 A;  2GMS A;  2VIA A;  4RLG A;  2VLH A;  3PDX A;  2X5D A;  4R5Z A;  3VK3 A;  3NYS A;  4W1V A;  4W8I A;  4OBU A;  2Z9U A;  1AY4 A;  1WST A;  3WCO A;  5D5S A;  5BJ3 A;  3FZ8 A;  5LH9 A;  4XK1 A;  4ZAS A;  1GD9 A;  5F8V A;  3N4R A;  1WYU A;  1I43 A;  3B1E A;  4WYC A;  2E7J A;  2ZUK A;  1IX8 A;  4BA5 A;  1ECX A;  4KXK A;  1BKG A;  3JWA A;  1LC7 A;  2FNU A;  2X3L A;  3BWN A;  2YCN A;  3GWP A;  1LS3 A;  4A0F A;  1AJS A;  2YRI A;  3PGY A;  2Z9X A;  2AY5 A;  2FYF A;  2D63 A;  1XI9 A;  3KE3 A;  1ASE A;  1AMR A;  1DTY A;  3ISL A;  1ASC A;  3NDN A;  2A1V A;  3T32 A;  3ZRR A;  2BIE A;  1AJR A;  2CH1 A;  4XQ2 A;  3AEL A;  1AIC A;  4E77 A;  4WB0 A;  3GET A;  1WKH A;  1AMS A;  2DGM A;  2PB2 A;  4K2M A;  1IAY A;  4XJO A;  2BI1 A;  4OCA A;  1GC3 A;  2VGU A;  4AOA A;  1M0N A;  3KKI A;  4BA4 A;  1VEF A;  1WYU B;  3PDB B;  5BJ4 A;  3TFU A;  3JU7 A;  3QI6 A;  2EGY A;  3GBX A;  1E5F A;  3FTB A;  3K28 A;  1ARS A;  1O61 A;  5EIG A;  2BI2 A;  3KGX A;  1AJS B;  2PB0 A;  1LW5 A;  2Z1Z A;  1AHE A;  4WYA A;  3NRA A;  3MAU A;  3E6G A;  3BCB A;  4F5G A;  3H14 A;  5IWQ A;  2FN6 A;  3W1H A;  1ASF A;  1W7N A;  3BCA A;  4MGR A;  4RM1 A;  2VMQ A;  2OGE A;  3EI5 A;  1LC8 A;  5DX5 A;  3NYT A;  4WB0 B;  2VGT A;  3FFH A;  4IXZ A;  2D65 A;  1AKC A;  3CQ6 A;  3QPG A;  3OKS A;  4IYO B;  5E5I A;  3JZL A;  4A0H A;  1YIZ A;  2D7Y A;  2OKJ A;  2W7L A;  4A0G A;  2O7C A;  4ITG A;  2CAN A;  3DXV A;  1KKP A;  1ZC9 A;  3WGC A;  1OXP A;  4RJY A;  3OP7 A;  4WD2 A;  3BWN C;  5FT4 A;  2Z20 A;  4WP0 A;  5D95 A;  2JJE A;  2AY3 A;  1ASB A;  3IHJ A;  3W1J A;  3DR4 A;  1TAR A;  2DKB A;  2W8T A;  3F0H A;  4ADB A;  2WK9 A;  2BIA A;  1TAS A;  3RCH A;  1ART A;  4WYG A;  1IVR A;  3P6K A;  2ZY2 A;  1AKA A;  1PG8 A;  4EU1 A;  1ORD A;  3MKJ A;  4WXF A;  1OAT A;  4F5I A;  1AMA A;  2XBN A;  3FRK A;  3AOV A;  2WB6 A;  3A9Z A;  1X29 A;  1OHW A;  4XJM A;  2ZC0 A;  1BJN A;  2CJD A;  1MLZ A;  2YCT A;  1LK9 A;  1JS3 A;  4K2B A;  1MAQ A;  1RV3 A;  3AEP A;  3BWO A;  3EZ1 A;  1IX7 A;  2X5F A;  1D7R A;  3NU8 A;  1RVY A;  1S09 A;  4N0B A;  3Q8N A;  4M2K A;  5K8B A;  1B5P A;  2VYC A;  4I8A A;  1SFF A;  1V2F A;  3ASB A;  3DZZ A;  1BQD A;  5AX8 A;  2ORD A;  4R8D A;  7AAT A;  1W3U A;  2W8J A;  3WGB A;  1QGN A;  3GZC A;  1ELU A;  4A6U A;  3FDD A;  4MQR A;  1AHX A;  2D5Y A;  1N31 A;  3FDB A;  3TFT A;  2EH6 A;  5J8Q A;  3RCH B;  1AX4 A;  3EIA A;  2OGA A;  3JTX A;  5EAA A;  1MGV A;  5LHA A;  3EI8 A;  4JEW A;  2AY7 A;  2BKW A;  4LNJ A;  1MDX A;  2NMP A;  2XH1 A;  4MY5 A;  1MAP A;  3TCM A;  3ZZK A;  2JJF A;  4A6T A;  2AY4 A;  2YKY A;  3AOW A;  1G4V A;  3DU4 A;  2KFP A;  2VIB A;  5DB5 A;  2W7I A;  5M4D A;  3N4X A;  4B9B A;  1B9I A;  1BQA A;  4LC3 A;  4A72 A;  4AZJ A;  2Z9V A;  2OKK A;  3QBO A;  1BW0 A;  3HDO A;  1OHV A;  1PFF A;  1XEY A;  1Y4I A;  1E5E A;  2YKV A;  3VK4 A;  1AMQ A;  2VLF A;  2G6W A;  3HQT A;  1JG8 A;  2YHK A;  1GCK A;  2CY8 A;  1YJZ A;  2VGW A;  2HUF A;  2YRR A;  1QJ5 A;  2E7I A;  2W7K A;  3H9X A;  2GQN A;  4GE9 A;  4WYE A;  4UHM A;  2BWP A;  1SZU A;  3CBF A;  4MQQ A;  3EI7 A;  2CTZ A;  4GDY A;  1DFO A;  2R5C A;  2VGZ A;  2W8W A;  3I5T A;  3MAF A;  2VMN A;  2C7T A;  3G8M A;  1C0N A;  1PMM A;  1AAW A;  4B98 A;  4F5F A;  1I48 A;  1TAT A;  4DQ6 A;  2Z67 A;  4H51 A;  1J32 A;  3CAI A;  1CL2 A;  2HUU A;  4JE5 D;  4Y0D A;  5E4Z A;  2DKJ A;  3CQ5 A;  4ZAH A;  2QB2 A;  2V1P A;  3ZZJ A;  3UWC A;  1WYV A;  1GEX A;  1WKG A;  3VAX A;  1M32 A;  5KTB A;  1AAM A;  4OBV A;  2G7J A;  1M7Y A;  1LW4 A;  4XJL A;  4ZDP A;  3B8X A;  3EI6 A;  1ZOD A;  1D7V A;  4AZK A;  1YIY A;  3FD0 A;  2DGL A;  1EJI A;  4GE4 A;  3VK2 A;  2ZP7 A;  4ATP A;  3VP6 A;  5DJ9 A;  3ZRQ A;  4ATQ A;  1ASM A;  2RFV A;  1I29 A;  3G7Q A;  4A00 A;  4DGT A;  1DJU A;  4ZSY A;  2W8U A;  4EMY A;  1SZS A;  2JIS A;  1BS0 A;  2R5C B;  3NTJ A;  3A9X A;  3MAF B;  1ARI A;  3LVJ A;  2HP1 A;  1IUG A;  4UHO A;  2EYQ A;  2ZY5 A;  3QGU A;  4ZLV A;  1H0C A;  4JEY A;  4OTL A;  4U2H A;  3FFR A;  2AY6 A;  1ASD A;  3LV2 A;  1S06 A;  4RKD A;  1QJ3 A;  1C7O A;  4HF8 A;  2ZY4 A;  2CB1 A;  3HT4 A;  4O6Z A;  3LVM A;  1WYV B;  2VGV A;  3GJU A;  5HXX A;  4WYF A;  3L44 A;  1QIR A;  2CJG A;  4BMK A;  2D66 A;  2HOZ A;  1G7W A;  4ISY A;  4EB7 A;  4OC9 A;  2D64 A;  2GB3 A;  4WLH A;  4PIW A;  4H63 Q;  3A9Y A;  4UQV A;  1CS1 A;  1FG7 A;  2PO3 A;  4IW7 A;  3ECD A;  2AAT A;  4PVF A;  1KL2 A;  3R4T A;  1DGD A;  4CXQ A;  2CFB A;  3NX3 A;  5EFS A;  1O62 A;  2R2N A;  3WCN A;  1AHG A;  2EZ1 A;  2VMU A;  2X8U A;  3LVL B;  4LNM A;  5EQC A;  5EUN A;  3UAK A;  1N8P A;  4F4E A;  1AHF A;  4JEV A;  4JF1 A;  3NYU A;  1KL1 A;  5EIG B;  5G0A A;  2R0T A;  2BIG A;  1ELQ A;  1YJY A;  2EZ2 A;  2QLR A;  4LW4 A;  4WXG A;  5FT5 A;  4CXR A;  5EAV A;  3FVU A;  5E3K A;  2VMT A;  3EI9 A;  1YOO A;  2CJH A;  1C9C A;  3FZ6 A;  1AKB A;  3H7F A;  3N4S A;  4ZM3 A;  4W1W A;  4R5F A;  1RV4 A;  5M49 A;  1UKJ A;  3ZRP A;  3PIU A;  4EB5 A;  2W7F A;  1S0A A;  3FQA A;  2VMX A;  3GZD A;  1CJ0 A;  2E54 A;  2Z1Y A;  3MC6 A;  4XAU A;  2ZJG A;  2VGS A;  2QB3 A;  1AY5 A;  1JF9 A;  4BQ0 A;  1X0M A;  2VMY A;  3NU7 A;  4RIZ A;  1W23 A;  1FG3 A;  1M0O A;  2C0R A;  3N0L A;  3RUY A;  1KAF A;  1AHY A;  1TOK A;  3BB8 A;  4U1T A;  2VMR A;  3DYD A;  3I4J A;  1D7U A;  1YAA A;  4FL0 A;  3ATH A;  2FNI A;  2JGT A;  2CH2 A;  3UE8 A;  3B46 A;  3PPL A;  3DOD A;  1PMO A;  1S08 A;  3BN1 A;  4W5K A;  2HOX A;  1IAX A;  3MAD A;  1I41 A;  4NOG A;  2CIN A;  4UHN A;  1QZ9 A;  2D7Z A;  1CL1 A;  3HLM A;  1YJS A;  3QM2 A;  3AAT A;  2W7G A;  2JJG A;  4GEB A;  2BI9 A;  3WKS A;  2ZYJ A;  3G0T A;  3A2B A;  4F5J A;  4EFF A;  4QGR A;  5FT8 A;  4K2I A;  3E9K A;  3HBX A;  3USF A;  2WK7 A;  3HVY A;  3LWS A;  1UU1 A;  5G2Q A;  4W91 A;  1VP4 A;  1TOE A;  1ASA A;  3FVX A;  4FFC A;  3RBF A;  3NUI A;  3BV0 A;  2WK8 A;  3N5M A;  4TV7 A;  1JS6 A;  3CQ4 A;  4AO9 A;  2BYJ A;  4F5K A;  1OHY A;  3FKD A;  4ITX A;  1ASG A;  3BC8 A;  1Z7D A;  4KAM A;  1M6S A;  3N7N A;  4GRX A;  2DGK A;  1MDO A;  3WY7 A;  1C4K A;  3N75 A;  1C7N A;  4ZWV A;  1GC4 A;  1G7X A;  4ZWM A;  1B9H A;  4DBC A;  3A8U X;  3D6K A;  3PJ0 A;  4Q6R A;  1U08 A;  1DKA A;  3GZD C;  2BHX A;  3WLX A;  1GBN A;  2O1B A;  2W7M A;  4A0R A;  3MC6 C;  3WZF A;  1DJE A;  3RI6 A;  4W1X A;  5C6U A;  4LW2 A;  4LNL A;  3RBL A;  1X2A A;  2BYL A;  3PDB A;  4P7Y A;  3ELP A;  1ZOB A;  1J04 A;  3BS8 A;  3K7Y A;  1MDZ A;  3ACZ A;  4OMA A;  1AIB A;  1O4S A;  3FSL A;  2AY8 A;  3AEM A;  2FQ6 A;  2BI5 A;  1O69 A;  3DXW A;  3I16 A;  1H1C A;  2VMO A;  3EZS A;  2FKI A;  2QBT A;  1GEW A;  2HUI A;  3W1I A;  4RJ0 A;  4Q75 A;  4ADE A;  1IJI A;  2OQX A;  3IF2 A;  4XEW A;  3E77 A;  2D61 A;  5DJ1 A;  4JF0 A;  2HOR A;  2VMV A;  2W7H A;  4IXS A;  3R9A A;  2EO5 A;  4TMR A;  1OXO A;  1B4X A;  3AEJ C;  3LVK A;  4IYO A;  2Z61 A;  2GMU A;  3DRD A;  5HDM A;  3NNK A;  3RQ1 A;  1CQ6 A;  2YKX A;  1CQ8 A;  2W8V A;  4J5U A;  4WYD A;  4N0W A;  2C81 A;  1CZE A;  4JEZ A;  4E3Q A;  4BHD A;  2R5E A;  4JEX A;  4TN4 A;  3VOM A;  1AIA A;  1BT4 A;  3GSB A;  1P3W A;  1LC5 A;  4PFN A;  4Q31 A;  1ASL A;  2FM1 A;  4L0O A;  3AEN A;  3JWB A;  3MBB A;  1V2E A;  1S07 A;  1M0P A;  2VMW A;  4MQP A;  4MSO A;  1D7S A;  1RVU A;  2W7J A;  3ASA A;  4UOY A;  1YNU A;  2JG2 A;  2W7D A;  3NUB A;  2HOY A;  3FZ7 A;  2VMZ A;  3ELE A;  4R2N A;  2CST A;  3AEO A;  5I92 A;  3WX9 A;  1BJO A;  1ARH A;  3EIB A;  1AY8 A;  4RKC A;  3TQX A;  4CBS A;  2BI3 A;  4KYO A;  5FT6 A;  2ZY3 A;  1N2T A;  4RAE A;  1QIT A;  2W7E A;  1KMJ A;  2DOU A;  1BJ4 A;  3LY1 A;  1G4X A;  2WKA A;  3M5U A;  5EUD A;  1EG5 A;  1W7M A;  2QA3 A;  2AEU A;  5TF5 A;  1DJ9 A;  3FQ7 A;  3PD6 A;  3QHX A;  4MKK A;  1UU0 A;  1VJO A;  4P3M A;  4WBT A;  4F5H A;  2QSR A;  1KMK A;  3LG0 A;  4E3R A;  3MEB A;  4ZDO A;  3DR7 A;  2YKU A;  2VMP A;  5G09 A;  2ZSL A;  4ADD A;  1TOJ A;  3AEM C;  4IXO A;  4ADC A;  5G4J A;  4MKJ A;  2E7U A;  1TPL A;  3E2Y A;  3II0 A;  4AH3 A;  1M0Q A;  1TOG A;  2Q7W A;  3AEN B;  3HL2 A;  2JJH A;  3B1C A;  4IX8 A;  4Q76 A;  2ZSM A;  3WKR A;  1WYT A;  5HHY A;  3GR9 A;  2GSA A;  2HP2 A;  3FCR A;  4GE7 A;  4GSA A;  2V0Y A;  4HVK A;  1GEY A;  2AY9 A;  5EUE A;  3FVS A;  3K40 A;  3PAA A;  1SZK A;  1BJO B;  1SPA A;  2AY2 A;  9AAT A;  1GDE A;  2BWO A;  2YOB A;  2DR1 A;  4M2J A;  3E2Z A;  1IX6 A;  1SVV A;  1D2F A;  2Z9W A;  3FQ8 A; 
#chains in the Genus database with same CATH homology
 5G2P A;  1ASN A;  3AV7 A;  1FC4 A;  2OAT A;  4WXB A;  2C44 A;  3PD6 B;  5M46 A;  4XJP A;  1X28 A;  5JAY A;  4E1O A;  1ARG A;  3PA9 A;  5F9S A;  3HMU A;  3KGW A;  4CBR A;  2F8J A;  5G4I A;  2QMA A;  3BCX A;  2O0R A;  3DC1 A;  4A6R A;  2BWN A;  1BJW A;  1KKJ A;  1UU2 A;  4Y0I A;  4ZDL A;  4ZSW A;  4JE5 A;  8AAT A;  2VMS A;  4IY7 A;  1GC0 A;  3JW9 A;  2AEV A;  4OT8 A;  1B8G A;  1IBJ A;  1V2D A;  1Z3Z A;  2HZP A;  3AEJ A;  2YCP A;  4PFF A;  1MLY A;  2AY1 A;  2TPL A;  4K05 A;  1WYT B;  3COG A;  4F5L A;  4M2M A;  1CQ7 A;  3EUC A;  4WLJ A;  2EPJ A;  4F5M A;  4ZM4 A;  1LKC A;  1W7L A;  1T3I A;  3P1T A;  1DGE A;  3F6T A;  1EQB A;  1M4N A;  1V72 A;  4RIT A;  1SF2 A;  3TAT A;  1GC2 A;  2VI9 A;  3B1D A;  1C7G A;  4Y0H A;  4CVQ A;  1TOI A;  3E2Z B;  3F9T A;  3E2F A;  3L8A A;  4J8L A;  1QIS A;  1B5O A;  4OYT A;  1CZC A;  2VI8 A;  4AO4 A;  5M4B A;  3QN6 A;  2GMS A;  2VIA A;  4RLG A;  2VLH A;  3PDX A;  2X5D A;  4R5Z A;  3VK3 A;  3NYS A;  4W1V A;  4W8I A;  4OBU A;  2Z9U A;  1AY4 A;  1WST A;  3WCO A;  5D5S A;  5BJ3 A;  3FZ8 A;  5LH9 A;  4XK1 A;  4ZAS A;  1GD9 A;  5F8V A;  3N4R A;  1WYU A;  1I43 A;  3B1E A;  4WYC A;  2E7J A;  2ZUK A;  1IX8 A;  4BA5 A;  1ECX A;  4KXK A;  1BKG A;  3JWA A;  1LC7 A;  2FNU A;  2X3L A;  3BWN A;  2YCN A;  3GWP A;  1LS3 A;  4A0F A;  1AJS A;  2YRI A;  3PGY A;  2Z9X A;  2AY5 A;  2FYF A;  2D63 A;  1XI9 A;  3KE3 A;  1ASE A;  1AMR A;  1DTY A;  3ISL A;  1ASC A;  3NDN A;  2A1V A;  3T32 A;  3ZRR A;  2BIE A;  1AJR A;  2CH1 A;  4XQ2 A;  3AEL A;  1AIC A;  4E77 A;  4WB0 A;  3GET A;  1WKH A;  1AMS A;  2DGM A;  2PB2 A;  4K2M A;  1IAY A;  4XJO A;  2BI1 A;  4OCA A;  1GC3 A;  2VGU A;  4AOA A;  1M0N A;  3KKI A;  4BA4 A;  1VEF A;  1WYU B;  3PDB B;  5BJ4 A;  3TFU A;  3JU7 A;  3QI6 A;  2EGY A;  3GBX A;  1E5F A;  3FTB A;  3K28 A;  1ARS A;  1O61 A;  5EIG A;  2BI2 A;  3KGX A;  1AJS B;  2PB0 A;  1LW5 A;  2Z1Z A;  1AHE A;  4WYA A;  3NRA A;  3MAU A;  3E6G A;  3BCB A;  4F5G A;  3H14 A;  5IWQ A;  2FN6 A;  3W1H A;  1ASF A;  1W7N A;  3BCA A;  4MGR A;  4RM1 A;  2VMQ A;  2OGE A;  3EI5 A;  1LC8 A;  5DX5 A;  3NYT A;  4WB0 B;  2VGT A;  3FFH A;  4IXZ A;  2D65 A;  1AKC A;  3CQ6 A;  3QPG A;  3OKS A;  4IYO B;  5E5I A;  3JZL A;  4A0H A;  1YIZ A;  2D7Y A;  2OKJ A;  2W7L A;  4A0G A;  2O7C A;  4ITG A;  2CAN A;  3DXV A;  1KKP A;  1ZC9 A;  3WGC A;  1OXP A;  4RJY A;  3OP7 A;  4WD2 A;  3BWN C;  5FT4 A;  2Z20 A;  4WP0 A;  5D95 A;  2JJE A;  2AY3 A;  1ASB A;  3IHJ A;  3W1J A;  3DR4 A;  1TAR A;  2DKB A;  2W8T A;  3F0H A;  4ADB A;  2WK9 A;  2BIA A;  1TAS A;  3RCH A;  1ART A;  4WYG A;  1IVR A;  3P6K A;  2ZY2 A;  1AKA A;  1PG8 A;  4EU1 A;  1ORD A;  3MKJ A;  4WXF A;  1OAT A;  4F5I A;  1AMA A;  2XBN A;  3FRK A;  3AOV A;  2WB6 A;  3A9Z A;  1X29 A;  1OHW A;  4XJM A;  2ZC0 A;  1BJN A;  2CJD A;  1MLZ A;  2YCT A;  1LK9 A;  1JS3 A;  4K2B A;  1MAQ A;  1RV3 A;  3AEP A;  3BWO A;  3EZ1 A;  1IX7 A;  2X5F A;  1D7R A;  3NU8 A;  1RVY A;  1S09 A;  4N0B A;  3Q8N A;  4M2K A;  5K8B A;  1B5P A;  2VYC A;  4I8A A;  1SFF A;  1V2F A;  3ASB A;  3DZZ A;  1BQD A;  5AX8 A;  2ORD A;  4R8D A;  7AAT A;  1W3U A;  2W8J A;  3WGB A;  1QGN A;  3GZC A;  1ELU A;  4A6U A;  3FDD A;  4MQR A;  1AHX A;  2D5Y A;  1N31 A;  3FDB A;  3TFT A;  2EH6 A;  5J8Q A;  3RCH B;  1AX4 A;  3EIA A;  2OGA A;  3JTX A;  5EAA A;  1MGV A;  5LHA A;  3EI8 A;  4JEW A;  2AY7 A;  2BKW A;  4LNJ A;  1MDX A;  2NMP A;  2XH1 A;  4MY5 A;  1MAP A;  3TCM A;  3ZZK A;  2JJF A;  4A6T A;  2AY4 A;  2YKY A;  3AOW A;  1G4V A;  3DU4 A;  2KFP A;  2VIB A;  5DB5 A;  2W7I A;  5M4D A;  3N4X A;  4B9B A;  1B9I A;  1BQA A;  4LC3 A;  4A72 A;  4AZJ A;  2Z9V A;  2OKK A;  3QBO A;  1BW0 A;  3HDO A;  1OHV A;  1PFF A;  1XEY A;  1Y4I A;  1E5E A;  2YKV A;  3VK4 A;  1AMQ A;  2VLF A;  2G6W A;  3HQT A;  1JG8 A;  2YHK A;  1GCK A;  2CY8 A;  1YJZ A;  2VGW A;  2HUF A;  2YRR A;  1QJ5 A;  2E7I A;  2W7K A;  3H9X A;  2GQN A;  4GE9 A;  4WYE A;  4UHM A;  2BWP A;  1SZU A;  3CBF A;  4MQQ A;  3EI7 A;  2CTZ A;  4GDY A;  1DFO A;  2R5C A;  2VGZ A;  2W8W A;  3I5T A;  3MAF A;  2VMN A;  2C7T A;  3G8M A;  1C0N A;  1PMM A;  1AAW A;  4B98 A;  4F5F A;  1I48 A;  1TAT A;  4DQ6 A;  2Z67 A;  4H51 A;  1J32 A;  3CAI A;  1CL2 A;  2HUU A;  4JE5 D;  4Y0D A;  5E4Z A;  2DKJ A;  3CQ5 A;  4ZAH A;  2QB2 A;  2V1P A;  3ZZJ A;  3UWC A;  1WYV A;  1GEX A;  1WKG A;  3VAX A;  1M32 A;  5KTB A;  1AAM A;  4OBV A;  2G7J A;  1M7Y A;  1LW4 A;  4XJL A;  4ZDP A;  3B8X A;  3EI6 A;  1ZOD A;  1D7V A;  4AZK A;  1YIY A;  3FD0 A;  2DGL A;  1EJI A;  4GE4 A;  3VK2 A;  2ZP7 A;  4ATP A;  3VP6 A;  5DJ9 A;  3ZRQ A;  4ATQ A;  1ASM A;  2RFV A;  1I29 A;  3G7Q A;  4A00 A;  4DGT A;  1DJU A;  4ZSY A;  2W8U A;  4EMY A;  1SZS A;  2JIS A;  1BS0 A;  2R5C B;  3NTJ A;  3A9X A;  3MAF B;  1ARI A;  3LVJ A;  2HP1 A;  1IUG A;  4UHO A;  2EYQ A;  2ZY5 A;  3QGU A;  4ZLV A;  1H0C A;  4JEY A;  4OTL A;  4U2H A;  3FFR A;  2AY6 A;  1ASD A;  3LV2 A;  1S06 A;  4RKD A;  1QJ3 A;  1C7O A;  4HF8 A;  2ZY4 A;  2CB1 A;  3HT4 A;  4O6Z A;  3LVM A;  1WYV B;  2VGV A;  3GJU A;  5HXX A;  4WYF A;  3L44 A;  1QIR A;  2CJG A;  4BMK A;  2D66 A;  2HOZ A;  1G7W A;  4ISY A;  4EB7 A;  4OC9 A;  2D64 A;  2GB3 A;  4WLH A;  4PIW A;  4H63 Q;  3A9Y A;  4UQV A;  1CS1 A;  1FG7 A;  2PO3 A;  4IW7 A;  3ECD A;  2AAT A;  4PVF A;  1KL2 A;  3R4T A;  1DGD A;  4CXQ A;  2CFB A;  3NX3 A;  5EFS A;  1O62 A;  2R2N A;  3WCN A;  1AHG A;  2EZ1 A;  2VMU A;  2X8U A;  3LVL B;  4LNM A;  5EQC A;  5EUN A;  3UAK A;  1N8P A;  4F4E A;  1AHF A;  4JEV A;  4JF1 A;  3NYU A;  1KL1 A;  5EIG B;  5G0A A;  2R0T A;  2BIG A;  1ELQ A;  1YJY A;  2EZ2 A;  2QLR A;  4LW4 A;  4WXG A;  5FT5 A;  4CXR A;  5EAV A;  3FVU A;  5E3K A;  2VMT A;  3EI9 A;  1YOO A;  2CJH A;  1C9C A;  3FZ6 A;  1AKB A;  3H7F A;  3N4S A;  4ZM3 A;  4W1W A;  4R5F A;  1RV4 A;  5M49 A;  1UKJ A;  3ZRP A;  3PIU A;  4EB5 A;  2W7F A;  1S0A A;  3FQA A;  2VMX A;  3GZD A;  1CJ0 A;  2E54 A;  2Z1Y A;  3MC6 A;  4XAU A;  2ZJG A;  2VGS A;  2QB3 A;  1AY5 A;  1JF9 A;  4BQ0 A;  1X0M A;  2VMY A;  3NU7 A;  4RIZ A;  1W23 A;  1FG3 A;  1M0O A;  2C0R A;  3N0L A;  3RUY A;  1AHY A;  1TOK A;  3BB8 A;  4U1T A;  2VMR A;  3DYD A;  3I4J A;  1D7U A;  1YAA A;  4FL0 A;  3ATH A;  2FNI A;  2JGT A;  2CH2 A;  3UE8 A;  3B46 A;  3PPL A;  3DOD A;  1PMO A;  1S08 A;  3BN1 A;  4W5K A;  2HOX A;  1IAX A;  3MAD A;  1I41 A;  4NOG A;  2CIN A;  4UHN A;  1QZ9 A;  2D7Z A;  1CL1 A;  3HLM A;  1YJS A;  3QM2 A;  3AAT A;  2W7G A;  2JJG A;  4GEB A;  2BI9 A;  3WKS A;  2ZYJ A;  3G0T A;  3A2B A;  4F5J A;  4EFF A;  4QGR A;  5FT8 A;  4K2I A;  3E9K A;  3HBX A;  3USF A;  2WK7 A;  3HVY A;  3LWS A;  1UU1 A;  5G2Q A;  4W91 A;  1VP4 A;  1TOE A;  1ASA A;  3FVX A;  4FFC A;  3RBF A;  3NUI A;  3BV0 A;  2WK8 A;  3N5M A;  4TV7 A;  1JS6 A;  3CQ4 A;  4AO9 A;  2BYJ A;  4F5K A;  1OHY A;  3FKD A;  4ITX A;  1ASG A;  3BC8 A;  1Z7D A;  4KAM A;  1M6S A;  3N7N A;  4GRX A;  2DGK A;  1MDO A;  3WY7 A;  1C4K A;  3N75 A;  1C7N A;  4ZWV A;  1GC4 A;  1G7X A;  4ZWM A;  1B9H A;  4DBC A;  3A8U X;  3D6K A;  3PJ0 A;  4Q6R A;  1U08 A;  1DKA A;  3GZD C;  2BHX A;  3WLX A;  1GBN A;  2O1B A;  2W7M A;  4A0R A;  3MC6 C;  3WZF A;  1DJE A;  3RI6 A;  4W1X A;  5C6U A;  4LW2 A;  4LNL A;  3RBL A;  1X2A A;  2BYL A;  3PDB A;  4P7Y A;  3ELP A;  1ZOB A;  1J04 A;  3BS8 A;  3K7Y A;  1MDZ A;  3ACZ A;  4OMA A;  1AIB A;  1O4S A;  3FSL A;  2AY8 A;  3AEM A;  2FQ6 A;  2BI5 A;  1O69 A;  3DXW A;  3I16 A;  1H1C A;  2VMO A;  3EZS A;  2FKI A;  2QBT A;  1GEW A;  2HUI A;  3W1I A;  4RJ0 A;  4Q75 A;  4ADE A;  1IJI A;  2OQX A;  3IF2 A;  4XEW A;  3E77 A;  2D61 A;  5DJ1 A;  4JF0 A;  2HOR A;  2VMV A;  2W7H A;  4IXS A;  3R9A A;  2EO5 A;  4TMR A;  1OXO A;  1B4X A;  3AEJ C;  3LVK A;  4IYO A;  2Z61 A;  2GMU A;  3DRD A;  5HDM A;  3NNK A;  3RQ1 A;  1CQ6 A;  2YKX A;  1CQ8 A;  2W8V A;  4J5U A;  4WYD A;  4N0W A;  2C81 A;  1CZE A;  4JEZ A;  4E3Q A;  4BHD A;  2R5E A;  4JEX A;  4TN4 A;  3VOM A;  1AIA A;  1BT4 A;  3GSB A;  1P3W A;  1LC5 A;  4PFN A;  4Q31 A;  1ASL A;  2FM1 A;  4L0O A;  3AEN A;  3JWB A;  3MBB A;  1V2E A;  1S07 A;  1M0P A;  2VMW A;  4MQP A;  4MSO A;  1D7S A;  1RVU A;  2W7J A;  3ASA A;  4UOY A;  1YNU A;  2JG2 A;  2W7D A;  3NUB A;  2HOY A;  3FZ7 A;  2VMZ A;  3ELE A;  4R2N A;  2CST A;  3AEO A;  5I92 A;  3WX9 A;  1BJO A;  1ARH A;  3EIB A;  1AY8 A;  4RKC A;  3TQX A;  4CBS A;  2BI3 A;  4KYO A;  5FT6 A;  2ZY3 A;  1N2T A;  4RAE A;  1QIT A;  2W7E A;  1KMJ A;  2DOU A;  1BJ4 A;  3LY1 A;  1G4X A;  2WKA A;  3M5U A;  5EUD A;  1EG5 A;  1W7M A;  2QA3 A;  2AEU A;  5TF5 A;  1DJ9 A;  3FQ7 A;  3PD6 A;  3QHX A;  4MKK A;  1UU0 A;  1VJO A;  4P3M A;  4WBT A;  4F5H A;  2QSR A;  1KMK A;  3LG0 A;  4E3R A;  3MEB A;  4ZDO A;  3DR7 A;  2YKU A;  2VMP A;  5G09 A;  2ZSL A;  4ADD A;  1TOJ A;  3AEM C;  4IXO A;  4ADC A;  5G4J A;  4MKJ A;  2E7U A;  1TPL A;  3E2Y A;  3II0 A;  4AH3 A;  1M0Q A;  1TOG A;  2Q7W A;  3AEN B;  3HL2 A;  2JJH A;  3B1C A;  4IX8 A;  4Q76 A;  2ZSM A;  3WKR A;  1WYT A;  5HHY A;  3GR9 A;  2GSA A;  2HP2 A;  3FCR A;  4GE7 A;  4GSA A;  2V0Y A;  4HVK A;  1GEY A;  2AY9 A;  5EUE A;  3FVS A;  3K40 A;  3PAA A;  1SZK A;  1BJO B;  1SPA A;  2AY2 A;  9AAT A;  1GDE A;  2BWO A;  2YOB A;  2DR1 A;  4M2J A;  3E2Z A;  1IX6 A;  1SVV A;  1D2F A;  2Z9W A;  3FQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...