2BI3A

Radiation damage of the schiff base in phosphoserine aminotransferase (structure d)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
360
structure length
360
Chain Sequence
VKQVFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLRELLQIPNDYQILFLQGGASLQFTMLPMNLLTKGTIGNYVLTGSWSEKALKEAKLLGETHIAASTKANSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQNFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQVPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTIDESNGFYVGHAEKGSRSLMNVTFNLRNEELNQQFLAKAKEQGFVGLNGHRSVGGCRASIYNAVPIDACIALRELMIQFKENA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHOSERINE AMINOTRANSFERASE
publication title Strain Relief at the Active Site of Phosphoserine Aminotransferase Induced by Radiation Damage.
pubmed doi rcsb
source organism Bacillus alcalophilus
molecule tags Transferase
total genus 126
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2005-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2bi3A01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2bi3A02
3VP6A 4PVFA 4WXGA 5M46A 2VMTA 3HDOA 4LNMA 1BKGA 2VGZA 1C0NA 4ZDPA 4Q6RA 4W91A 3VK4A 5JAYA 1O61A 2ZYJA 4K2MA 5FT4A 1ARIA 3JWBA 4DGTA 2BIGA 2NMPA 3EI5A 1ZODA 2Z61A 1AMSA 1O62A 2E7IA 3ZZJA 2EZ1A 4KXKA 1S07A 2BI1A 1AY5A 1ZC9A 2DGKA 2Z1ZA 3FKDA 4WBTA 5EIGA 7AATA 3QN6A 1ECXA 3NNKA 1YNUA 5G0AA 3B1DA 3WGBA 3AEOA 3QHXA 4GDYA 1J32A 4Q76A 2CJHA 2CJGA 3AENA 3NYUA 3TCMA 1VP4A 4M2JA 1ASBA 1SVVA 2CSTA 2VMZA 1ASNA 3KGWA 3MAFB 3USFA 3E2ZB 4GE4A 4O6ZA 3PD6B 4F5IA 2BHXA 1KL2A 1MAPA 3VAXA 4XQ2A 3OP7A 1WYVA 2AY4A 4AOAA 1CQ6A 4EMYA 4H51A 4A6UA 1XEYA 1JF9A 1VJOA 1N31A 1S06A 3DC1A 1CL2A 2E54A 2QB2A 3GZCA 2W7KA 4RITA 2FNUA 2ZY2A 4K2IA 3PPLA 1M6SA 4N0BA 4W1VA 1C7OA 1O4SA 2V1PA 3N75A 4F5KA 1RVYA 3DZZA 2HUIA 1YJYA 2DGMA 2FM1A 4WYDA 4DQ6A 2BKWA 2W8TA 2YCNA 5J8QA 4J5UA 4UHNA 1AJRA 3AEJC 4OBVA 3WZFA 2WK9A 4TV7A 2VGTA 3FQ8A 3ASBA 4ATQA 3PAAA 4WD2A 1BJOB 1QGNA 3II0A 4GSAA 2PB0A 1LW4A 1TOJA 2YRIA 2VIBA 3FVUA 3N5MA 2BI3A 2Z20A 2YRRA 4ZDLA 1MDOA 4F5HA 1LK9A 2JISA 1VEFA 2VMQA 3DRDA 2QB3A 1BJWA 3G0TA 2GMUA 4JEVA 2X3LA 3GETA 1M0QA 4Q31A 1D7UA 2VMUA 2R5CB 1S08A 4BMKA 2BI5A 2CB1A 4A0GA 4EB5A 2AY9A 4LNLA 2YHKA 1CZCA 1ASEA 5DB5A 3NUIA 4OCAA 5F9SA 4AO9A 1WSTA 3NDNA 1PMMA 2C81A 4F4EA 2W7MA 4F5FA 1C7GA 4GRXA 2AY3A 1H1CA 4JE5D 5TF5A 3P1TA 4LC3A 2YKYA 3DXVA 1CZEA 4WXBA 1I48A 1YIYA 4U1TA 4Y0HA 4EU1A 1BW0A 1GBNA 2HOXA 5I92A 2V0YA 2W7FA 3FFRA 3FDDA 1XI9A 3BC8A 3W1HA 3F0HA 1G4XA 1V2DA 1LC7A 3ZRRA 1RV3A 3LY1A 1C7NA 1ARSA 2BWOA 3FVXA 5HXXA 3PGYA 2W7HA 1JS3A 1WYTA 2X8UA 3EI7A 3NRAA 4RLGA 4RJYA 1IVRA 3BN1A 1AIAA 2VMOA 3A9XA 3CQ6A 2ZP7A 4WB0B 5D95A 1OXOA 3DR7A 3RBFA 2RFVA 2PB2A 4R5ZA 3D6KA 1TATA 3E2FA 2JJEA 1YOOA 2EO5A 4WYAA 1LKCA 3FD0A 1D7VA 3FFHA 3LV2A 5IWQA 3ATHA 2EZ2A 2WK8A 1AY8A 3LWSA 2ZY5A 3COGA 3GZDA 4W5KA 4BA4A 3BS8A 3MAUA 1MAQA 5EAVA 2YCPA 2BWNA 3W1IA 2R5EA 3H14A 1G7WA 1OHWA 3MBBA 1N2TA 4JF0A 2G6WA 4HVKA 5BJ4A 1ASGA 4ITGA 4MQPA 4B98A 3DODA 1QZ9A 4W1WA 3RI6A 4GE7A 1FG7A 4RAEA 4Y0DA 1IJIA 3WCNA 2AY7A 1B8GA 1YJSA 2JJFA 1ASFA 3RCHA 3DYDA 1AIBA 1V72A 4EB7A 2HZPA 5AX8A 4E3RA 2R2NA 2BI2A 3E6GA 2VMPA 5E5IA 3I5TA 2C44A 2VGVA 2JGTA 2ZY4A 4JEZA 1AJSB 3BV0A 1AAWA 3QGUA 2ZSMA 5DJ1A 2GQNA 1V2FA 4CBRA 2AY1A 4JEYA 1ARGA 4JF1A 2HP1A 5EAAA 1YAAA 5FT6A 3OKSA 4CVQA 1KL1A 1BQDA 1D7SA 1M0OA 3F6TA 4CBSA 4ZWVA 1E5FA 2QBTA 1DKAA 4WYEA 2DOUA 3TATA 3CAIA 4GEBA 3FZ6A 1GEYA 1IX8A 4AH3A 5DJ9A 3PDXA 2BYJA 1M0PA 3BCAA 1IAYA 1W7MA 1D7RA 2VGUA 3JZLA 3WLXA 3L44A 3DXWA 3PA9A 3MC6C 3EIAA 2CH2A 1Y4IA 3FZ8A 1OHYA 1SZUA 2R0TA 4N0WA 1M7YA 2WK7A 2W8UA 1JG8A 2VMXA 2VI8A 1WKGA 4F5GA 3UE8A 1RV4A 4ZLVA 3CQ5A 4OTLA 1SZKA 1WYUB 4RIZA 2Z9XA 3AATA 1FC4A 2VLHA 4A72A 1SFFA 1LC5A 2AATA 1KKJA 4PFNA 1SPAA 2CH1A 4L0OA 3TFTA 4FL0A 1SF2A 4A0RA 3T32A 1KKPA 3WKSA 4CXQA 2OQXA 4DBCA 4RM1A 3GSBA 2GB3A 2D65A 4WXFA 4QGRA 1MLYA 4R2NA 1CQ8A 3LVJA 3I4JA 3LVMA 1MGVA 1QJ3A 4MKJA 3NU7A 4UHOA 1S0AA 2E7UA 4ZAHA 2W7DA 2HUUA 4IX8A 3WY7A 1X29A 1W7LA 2BI9A 1CJ0A 1TOGA 2DGLA 3HBXA 3M5UA 4IYOA 1GEXA 3FRKA 5EUDA 1AHGA 2VMYA 4M2KA 2QMAA 4P7YA 4HF8A 4XEWA 1AHFA 3EIBA 2BYLA 3PDBA 5HDMA 1AHYA 1EQBA 1IAXA 4R8DA 1DGDA 1H0CA 3L8AA 4CXRA 5FT8A 1AMQA 3RQ1A 2AY6A 1GC2A 2W7IA 4WLHA 1JS6A 2Q7WA 3BCXA 3BCBA 4P3MA 2Z9WA 4Q75A 4ADCA 3E77A 3E9KA 4E77A 4LNJA 4ZM3A 4A6TA 2CJDA 1S09A 1AHEA 3ELEA 3JU7A 2HOZA 1E5EA 1O69A 2D64A 1IX7A 1AX4A 3AEJA 1GD9A 3AELA 2BIEA 3EZ1A 4OBUA 1DGEA 3RUYA 4BA5A 1MDZA 3NX3A 4XJOA 1AHXA 3KE3A 9AATA 2ORDA 2F8JA 3LG0A 1UU2A 1ASLA 1BQAA 5EUEA 2D63A 3AEMC 3JWAA 1YIZA 1B5PA 2O7CA 2VMWA 3FQ7A 1UKJA 5EUNA 3AV7A 4ZM4A 1LS3A 2JG2A 1MDXA 4KAMA 2YKUA 3AOVA 2VGSA 2VMSA 1G7XA 1BJNA 2CTZA 4EFFA 2C0RA 4UOYA 2DKBA 3VK3A 3FSLA 4FFCA 1B4XA 3K40A 3FVSA 1C9CA 4OC9A 3MAFA 4IXOA 3E2ZA 4RKCA 3PD6A 2OKKA 4MY5A 4UHMA 3P6KA 2CFBA 3EI8A 1ARTA 1WYVB 2Z9VA 3ACZA 2C7TA 3QM2A 2E7JA 4JEXA 3TQXA 1TOIA 5M49A 4A6RA 2AY5A 4MKKA 1WYUA 4ISYA 4XAUA 3ZRPA 2JJHA 4PIWA 1BT4A 5F8VA 1DTYA 2EGYA 2FYFA 3CQ4A 3Q8NA 2W7GA 3R9AA 4W8IA 4A0HA 1GCKA 3ELPA 3ISLA 2OGEA 3FTBA 1EJIA 5G2QA 2VMRA 3NUBA 4WLJA 4E3QA 1U08A 3WCOA 3ZZKA 1I41A 1AKCA 1GC4A 1CL1A 3LVLB 1BJOA 2D7ZA 4ZWMA 4ADEA 1UU0A 3VK2A 3K7YA 5LH9A 2GMSA 3PIUA 3JTXA 2FQ6A 2OATA 2X5DA 2W7JA 3BWNC 3I16A 3QBOA 4XJLA 3RBLA 2HORA 1T3IA 1BS0A 1C4KA 3NYTA 3G8MA 1I43A 3MADA 1V2EA 1WKHA 1CS1A 2R5CA 1SZSA 2YCTA 5EQCA 4NOGA 3QI6A 3B1EA 3PJ0A 5EFSA 3N0LA 1ASCA 1GEWA 1D2FA 2CANA 2D5YA 4ZASA 1ZOBA 3EI9A 2WKAA 1UU1A 3FZ7A 1AKBA 2EPJA 2OGAA 1X2AA 1AAMA 3ZRQA 4TMRA 3FDBA 1MLZA 4UQVA 4BHDA 2CY8A 3JW9A 3R4TA 1ORDA 3H7FA 1IBJA 5G4IA 3UWCA 3QPGA 4U2HA 2Z1YA 3WKRA 3NYSA 1PMOA 2D7YA 3BWNA 3FQAA 3A8UX 2QLRA 2O0RA 5E4ZA 4IXZA 4F5MA 4E1OA 3HQTA 1WYTB 4A00A 5LHAA 4MQQA 5G09A 4IW7A 1ARHA 4JE5A 4LW4A 4XJMA 3LVKA 1DJEA 4RJ0A 5M4DA 1X0MA 1TARA 2HUFA 4I8AA 4WB0A 2YKXA 4PFFA 1X28A 1AMRA 2W8VA 4OYTA 2W8JA 2Z67A 1BJ4A 3EZSA 1KMJA 5DX5A 3MC6A 3HL2A 1YJZA 1TOEA 2VMNA 5HHYA 2CINA 2FNIA 3HT4A 3VOMA 1IX6A 2D61A 5M4BA 3NU8A 2ZSLA 1TOKA 1ASMA 1GC3A 5G4JA 2AY2A 4AZJA 4ZDOA 3NTJA 2ZUKA 3GJUA 2VI9A 4ADBA 4Y0IA 5FT5A 1QISA 1DJ9A 3RCHB 3BB8A 4ATPA 1QITA 5E3KA 2D66A 3HVYA 1EG5A 2QA3A 3ECDA 4WYFA 4B9BA 5C6UA 2DR1A 3GBXA 1P3WA 1AJSA 1G4VA 3B8XA 3TFUA 2AEUA 3GR9A 3W1JA 3UAKA 2PO3A 4MQRA 4IXSA 3HLMA 4WYGA 1I29A 3IF2A 1OXPA 3DR4A 2ZJGA 5EIGB 3G7QA 4RKDA 1DFOA 2FN6A 2AEVA 3A9YA 1GC0A 4XJPA 2VMVA 4WYCA 3HMUA 2YOBA 3GWPA 1Z3ZA 1IUGA 3ASAA 1M4NA 2HP2A 1W23A 3AENB 2BWPA 3MEBA 3KKIA 1LW5A 4JEWA 3AEPA 8AATA 1N8PA 3GZDC 3E2YA 5G2PA 5K8BA 1B9HA 1KMKA 2VYCA 4OMAA 4WP0A 4AO4A 1QJ5A 3DU4A 2BIAA 2EH6A 3WX9A 4AZKA 4ZSWA 2DKJA 2ZY3A 4M2MA 4J8LA 3A9ZA 2W7LA 3WGCA 3F9TA 4OT8A 3IHJA 4BQ0A 1LC8A 2HOYA 2OKJA 3B1CA 3BWOA 3EI6A 1OHVA 4LW2A 1ELUA 2GSAA 1OATA 1TPLA 3A2BA 4MGRA 4A0FA 2YKVA 4ADDA 1ELQA 4KYOA 4MSOA 2XH1A 4R5FA 3FCRA 2VGWA 4F5JA 3K28A 2XBNA 1CQ7A 3CBFA 2VIAA 2W7EA 3AEMA 1B9IA 1AICA 1AMAA 1ASDA 1W7NA 1PFFA 2TPLA 2AY8A 3AOWA 1PG8A 1RVUA 1AY4A 2X5FA 4ITXA 5BJ3A 1ASAA 1J04A 4ZSYA 4GE9A 3EUCA 4IY7A 1DJUA 2O1BA 1QIRA 1FG3A 1TASA 3KGXA 4F5LA 4IYOB 1AKAA 2VLFA 4K2BA 1Z7DA 1W3UA 1B5OA 3B46A 5D5SA 1GDEA 4XK1A 1M0NA 4W1XA 2W8WA 3MKJA 2ZC0A 4TN4A 2Z9UA 3PDBB 2JJGA 1M32A
chains in the Genus database with same CATH superfamily
3VP6A 4PVFA 4WXGA 5M46A 2VMTA 3HDOA 4LNMA 1BKGA 2VGZA 1C0NA 4ZDPA 4Q6RA 4W91A 3VK4A 5JAYA 1O61A 2ZYJA 4K2MA 5FT4A 2A1VA 1ARIA 3JWBA 4DGTA 2BIGA 2NMPA 3EI5A 1ZODA 2Z61A 1AMSA 1O62A 2E7IA 3ZZJA 2EZ1A 4KXKA 1S07A 2BI1A 1AY5A 1ZC9A 2DGKA 2Z1ZA 3FKDA 4WBTA 5EIGA 7AATA 3QN6A 1ECXA 3NNKA 1YNUA 5G0AA 3B1DA 3WGBA 3AEOA 3QHXA 4GDYA 1J32A 4Q76A 2CJHA 2CJGA 3AENA 3NYUA 3TCMA 1VP4A 4M2JA 1ASBA 1SVVA 2FKIA 2CSTA 2VMZA 1ASNA 3KGWA 3MAFB 3USFA 3E2ZB 4GE4A 4O6ZA 3PD6B 4F5IA 2BHXA 1KL2A 1MAPA 3VAXA 4XQ2A 3OP7A 1WYVA 2AY4A 4AOAA 1CQ6A 4EMYA 4H51A 4A6UA 1XEYA 1JF9A 1VJOA 1N31A 1S06A 3DC1A 1CL2A 2E54A 2QB2A 3GZCA 2W7KA 4RITA 2FNUA 2ZY2A 4K2IA 3PPLA 1M6SA 4N0BA 4W1VA 1C7OA 1O4SA 2V1PA 3N75A 4F5KA 1RVYA 3DZZA 2HUIA 1YJYA 2DGMA 2FM1A 4WYDA 4DQ6A 2BKWA 2W8TA 2YCNA 5J8QA 4J5UA 4UHNA 1AJRA 3AEJC 4OBVA 3WZFA 2WK9A 4TV7A 2VGTA 3FQ8A 3ASBA 4ATQA 3PAAA 4WD2A 1BJOB 1QGNA 3II0A 4GSAA 2PB0A 1LW4A 1TOJA 2YRIA 2VIBA 3FVUA 3N5MA 2BI3A 2Z20A 2YRRA 4ZDLA 1MDOA 4F5HA 1LK9A 2JISA 1VEFA 2VMQA 3DRDA 2QB3A 1BJWA 3G0TA 2GMUA 4JEVA 2X3LA 3GETA 1M0QA 4Q31A 1D7UA 2VMUA 2R5CB 1S08A 4BMKA 2BI5A 2CB1A 4A0GA 4EB5A 2AY9A 4LNLA 2YHKA 1CZCA 1ASEA 5DB5A 3N7NA 3NUIA 4OCAA 5F9SA 4AO9A 1WSTA 3NDNA 1PMMA 2C81A 4F4EA 2W7MA 4F5FA 1C7GA 4GRXA 2AY3A 1H1CA 4JE5D 5TF5A 3P1TA 4LC3A 2YKYA 3DXVA 1CZEA 4WXBA 1I48A 1YIYA 4U1TA 4Y0HA 4EU1A 1BW0A 1GBNA 2HOXA 5I92A 2V0YA 2W7FA 3FFRA 3N4RA 3FDDA 1XI9A 3BC8A 3W1HA 3F0HA 1G4XA 1V2DA 1LC7A 3ZRRA 1RV3A 3LY1A 1C7NA 1ARSA 2BWOA 3FVXA 5HXXA 3PGYA 2W7HA 1JS3A 1WYTA 2X8UA 3EI7A 3NRAA 4RLGA 4RJYA 1IVRA 3BN1A 1AIAA 2VMOA 3A9XA 3CQ6A 2ZP7A 4WB0B 5D95A 1OXOA 3DR7A 3RBFA 2RFVA 2PB2A 4R5ZA 3D6KA 1TATA 3E2FA 2JJEA 1YOOA 2EO5A 4WYAA 1LKCA 3FD0A 1D7VA 3FFHA 3LV2A 5IWQA 3ATHA 2EZ2A 2WK8A 1AY8A 3LWSA 2ZY5A 3COGA 3GZDA 4W5KA 4BA4A 3BS8A 3MAUA 1MAQA 5EAVA 2YCPA 2BWNA 3W1IA 2R5EA 3H14A 1G7WA 1OHWA 3MBBA 1N2TA 4JF0A 2G6WA 4HVKA 5BJ4A 1ASGA 4ITGA 4MQPA 4B98A 3DODA 1QZ9A 4W1WA 3RI6A 4GE7A 1FG7A 4RAEA 4Y0DA 1IJIA 3WCNA 2AY7A 1B8GA 1YJSA 2JJFA 1ASFA 3RCHA 3DYDA 1AIBA 1V72A 4EB7A 2HZPA 5AX8A 4E3RA 2R2NA 2BI2A 3E6GA 2VMPA 5E5IA 3I5TA 2C44A 2VGVA 2JGTA 2ZY4A 4JEZA 1AJSB 3BV0A 1AAWA 3QGUA 2ZSMA 5DJ1A 2GQNA 1V2FA 4CBRA 2AY1A 4JEYA 1ARGA 4JF1A 2HP1A 5EAAA 1YAAA 5FT6A 3OKSA 4CVQA 1KL1A 1BQDA 1D7SA 1M0OA 3F6TA 4CBSA 4ZWVA 1E5FA 2QBTA 1DKAA 4WYEA 2DOUA 3TATA 3CAIA 4GEBA 3FZ6A 1GEYA 1IX8A 4AH3A 5DJ9A 3PDXA 2BYJA 1M0PA 3BCAA 1IAYA 1W7MA 1D7RA 2VGUA 3JZLA 3WLXA 3L44A 3DXWA 3PA9A 3MC6C 3EIAA 2CH2A 1Y4IA 3FZ8A 1OHYA 1SZUA 2R0TA 4N0WA 1M7YA 2WK7A 2W8UA 1JG8A 2VMXA 2VI8A 1WKGA 4F5GA 3UE8A 1RV4A 4ZLVA 3CQ5A 4OTLA 1SZKA 1WYUB 4RIZA 2Z9XA 3AATA 1FC4A 2VLHA 4A72A 5KTBA 1SFFA 1LC5A 2AATA 1KKJA 4PFNA 1SPAA 2CH1A 4L0OA 3TFTA 4FL0A 1SF2A 4A0RA 3T32A 3H9XA 1KKPA 3WKSA 4CXQA 2OQXA 4DBCA 4RM1A 3GSBA 2GB3A 2D65A 4WXFA 4QGRA 2QSRA 1MLYA 4R2NA 1CQ8A 3LVJA 3I4JA 3LVMA 1MGVA 1QJ3A 4MKJA 3NU7A 4UHOA 1S0AA 2E7UA 4ZAHA 2W7DA 2HUUA 4IX8A 3WY7A 1X29A 1W7LA 2BI9A 1CJ0A 1TOGA 2DGLA 3HBXA 3M5UA 4IYOA 1GEXA 3FRKA 5EUDA 1AHGA 2VMYA 4M2KA 2QMAA 4P7YA 4HF8A 4XEWA 1AHFA 3EIBA 2BYLA 3PDBA 5HDMA 1AHYA 1EQBA 1IAXA 4R8DA 1DGDA 1H0CA 3L8AA 4CXRA 5FT8A 1AMQA 3RQ1A 2AY6A 1GC2A 2W7IA 4WLHA 1JS6A 2Q7WA 3BCXA 3BCBA 4P3MA 2Z9WA 4Q75A 4ADCA 3E77A 3E9KA 4E77A 4LNJA 4ZM3A 4A6TA 2CJDA 1S09A 1AHEA 3ELEA 3JU7A 2HOZA 1E5EA 1O69A 2D64A 1IX7A 1AX4A 3AEJA 1GD9A 3AELA 2BIEA 3EZ1A 4OBUA 1DGEA 3RUYA 4BA5A 1MDZA 3NX3A 4XJOA 1AHXA 3KE3A 9AATA 2ORDA 2F8JA 3LG0A 1UU2A 1ASLA 1BQAA 5EUEA 2D63A 3AEMC 3JWAA 1YIZA 1B5PA 2O7CA 2VMWA 3FQ7A 1UKJA 5EUNA 3AV7A 4ZM4A 1LS3A 2JG2A 1MDXA 4KAMA 2YKUA 3AOVA 2VGSA 2VMSA 1G7XA 1BJNA 2CTZA 4EFFA 2C0RA 4UOYA 2DKBA 3VK3A 3N4XA 3FSLA 4FFCA 1B4XA 3K40A 3FVSA 1C9CA 4OC9A 3MAFA 4IXOA 3E2ZA 4RKCA 3PD6A 2OKKA 4MY5A 4UHMA 3P6KA 2CFBA 3EI8A 1ARTA 1WYVB 2Z9VA 3ACZA 2C7TA 3QM2A 2E7JA 4JEXA 3TQXA 1TOIA 5M49A 4A6RA 2AY5A 4MKKA 1WYUA 4ISYA 4XAUA 3ZRPA 2JJHA 4PIWA 1BT4A 5F8VA 1DTYA 2EGYA 2FYFA 3CQ4A 3Q8NA 2W7GA 3R9AA 4W8IA 4A0HA 2WB6A 1GCKA 3ELPA 3ISLA 2OGEA 3FTBA 1EJIA 5G2QA 2VMRA 3NUBA 4WLJA 4E3QA 1U08A 3WCOA 3ZZKA 1I41A 1AKCA 1GC4A 1CL1A 1KAFA 3LVLB 1BJOA 2D7ZA 4ZWMA 4ADEA 1UU0A 3VK2A 3K7YA 5LH9A 2GMSA 3PIUA 3JTXA 2FQ6A 2OATA 2X5DA 2W7JA 3BWNC 3I16A 3QBOA 4XJLA 3RBLA 2HORA 1T3IA 1BS0A 1C4KA 3NYTA 3G8MA 1I43A 3MADA 1V2EA 1WKHA 2G7JA 1CS1A 2R5CA 1SZSA 2YCTA 5EQCA 4NOGA 3QI6A 3B1EA 3PJ0A 5EFSA 3N0LA 1ASCA 1GEWA 1D2FA 2CANA 2D5YA 4ZASA 1ZOBA 3EI9A 2WKAA 1UU1A 3FZ7A 1AKBA 2EPJA 2OGAA 1X2AA 1AAMA 3ZRQA 4TMRA 3FDBA 4H63Q 1MLZA 4UQVA 4BHDA 2CY8A 3JW9A 3R4TA 1ORDA 3H7FA 1IBJA 5G4IA 3UWCA 3QPGA 4U2HA 2Z1YA 3WKRA 3NYSA 1PMOA 2D7YA 3BWNA 3FQAA 3A8UX 2QLRA 2O0RA 5E4ZA 4IXZA 4F5MA 4E1OA 3HQTA 1WYTB 4A00A 5LHAA 4MQQA 5G09A 4IW7A 1ARHA 4JE5A 4LW4A 4XJMA 3LVKA 4K05A 1DJEA 4RJ0A 5M4DA 1X0MA 1TARA 2HUFA 4I8AA 4WB0A 2YKXA 4PFFA 1X28A 1AMRA 2W8VA 4OYTA 2W8JA 2Z67A 1BJ4A 3EZSA 1KMJA 5DX5A 3MC6A 3HL2A 1YJZA 1TOEA 2VMNA 5HHYA 2KFPA 2CINA 2FNIA 3HT4A 3VOMA 1IX6A 2D61A 5M4BA 3NU8A 2ZSLA 1TOKA 1ASMA 1GC3A 5G4JA 2AY2A 4AZJA 4ZDOA 3NTJA 2ZUKA 3GJUA 2VI9A 4ADBA 4Y0IA 5FT5A 1QISA 1DJ9A 3RCHB 3BB8A 4ATPA 1QITA 5E3KA 2D66A 3HVYA 1EG5A 2QA3A 3ECDA 4WYFA 4B9BA 5C6UA 2DR1A 3GBXA 1P3WA 1AJSA 1G4VA 3B8XA 3TFUA 2AEUA 3GR9A 3W1JA 3UAKA 2PO3A 4MQRA 4IXSA 3HLMA 4WYGA 1I29A 3IF2A 1OXPA 3DR4A 2ZJGA 5EIGB 3G7QA 4RKDA 1DFOA 2FN6A 2AEVA 3A9YA 1GC0A 4XJPA 2VMVA 4WYCA 3HMUA 2YOBA 3GWPA 1Z3ZA 1IUGA 3ASAA 1M4NA 2HP2A 1W23A 3AENB 2BWPA 3MEBA 3KKIA 1LW5A 4JEWA 3AEPA 8AATA 1N8PA 3GZDC 3E2YA 5G2PA 5K8BA 1B9HA 1KMKA 2VYCA 4OMAA 4WP0A 4AO4A 1QJ5A 3DU4A 2BIAA 2EH6A 3WX9A 4AZKA 4ZSWA 2DKJA 2ZY3A 4M2MA 4J8LA 3A9ZA 2W7LA 3WGCA 3F9TA 4OT8A 3IHJA 4BQ0A 1LC8A 2HOYA 2OKJA 3B1CA 3BWOA 3EI6A 1OHVA 4LW2A 1ELUA 2GSAA 1OATA 1TPLA 3A2BA 4MGRA 4A0FA 2YKVA 4ADDA 1ELQA 4KYOA 4MSOA 2XH1A 4R5FA 3FCRA 2VGWA 4F5JA 3K28A 2XBNA 1CQ7A 3CBFA 2VIAA 2W7EA 3AEMA 1B9IA 1AICA 1AMAA 1ASDA 1W7NA 1PFFA 2TPLA 2AY8A 3AOWA 1PG8A 1RVUA 1AY4A 2X5FA 4ITXA 5BJ3A 1ASAA 1J04A 4ZSYA 4GE9A 3EUCA 3N4SA 4IY7A 1DJUA 2O1BA 1QIRA 1FG3A 1TASA 3KGXA 4F5LA 4IYOB 1AKAA 2VLFA 4K2BA 2EYQA 1Z7DA 1W3UA 1B5OA 3B46A 5D5SA 1GDEA 4XK1A 1M0NA 4W1XA 2W8WA 3MKJA 2ZC0A 4TN4A 2Z9UA 3PDBB 2JJGA 1M32A
chains in the Genus database with same CATH topology
3VP6A 4PVFA 4WXGA 5M46A 2VMTA 3HDOA 4LNMA 1BKGA 2VGZA 1C0NA 4ZDPA 4Q6RA 4W91A 3VK4A 5JAYA 1O61A 2ZYJA 4K2MA 5FT4A 2A1VA 1ARIA 3JWBA 4DGTA 2BIGA 2NMPA 3EI5A 1ZODA 2Z61A 1AMSA 1O62A 2E7IA 3ZZJA 2EZ1A 4KXKA 1S07A 2BI1A 1AY5A 1ZC9A 2DGKA 2Z1ZA 3FKDA 4WBTA 5EIGA 7AATA 3QN6A 1ECXA 3NNKA 1YNUA 5G0AA 3B1DA 3WGBA 3AEOA 3QHXA 4GDYA 1J32A 4Q76A 2CJHA 2CJGA 3AENA 3NYUA 3TCMA 1VP4A 4M2JA 1ASBA 1SVVA 2FKIA 2CSTA 2VMZA 1ASNA 3KGWA 3MAFB 3USFA 3E2ZB 4GE4A 4O6ZA 3PD6B 4F5IA 2BHXA 1KL2A 1MAPA 3VAXA 4XQ2A 3OP7A 1WYVA 2AY4A 4AOAA 1CQ6A 4EMYA 4H51A 4A6UA 1XEYA 1JF9A 1VJOA 1N31A 1S06A 3DC1A 1CL2A 2E54A 2QB2A 3GZCA 2W7KA 4RITA 2FNUA 2ZY2A 4K2IA 3PPLA 1M6SA 4N0BA 4W1VA 1C7OA 1O4SA 2V1PA 3N75A 4F5KA 1RVYA 3DZZA 2HUIA 1YJYA 2DGMA 2FM1A 4WYDA 4DQ6A 2BKWA 2W8TA 2YCNA 5J8QA 4J5UA 4UHNA 1AJRA 3AEJC 4OBVA 3WZFA 2WK9A 4TV7A 2VGTA 3FQ8A 3ASBA 4ATQA 3PAAA 4WD2A 1BJOB 1QGNA 3II0A 4GSAA 2PB0A 1LW4A 1TOJA 2YRIA 2VIBA 3FVUA 3N5MA 2BI3A 2Z20A 2YRRA 4ZDLA 1MDOA 4F5HA 1LK9A 2JISA 1VEFA 2VMQA 3DRDA 2QB3A 1BJWA 3G0TA 2GMUA 4JEVA 2X3LA 3GETA 1M0QA 4Q31A 1D7UA 2VMUA 2R5CB 1S08A 4BMKA 2BI5A 2CB1A 4A0GA 4EB5A 2AY9A 4LNLA 2YHKA 1CZCA 1ASEA 5DB5A 3N7NA 3NUIA 4OCAA 5F9SA 4AO9A 1WSTA 3NDNA 1PMMA 2C81A 4F4EA 2W7MA 4F5FA 1C7GA 4GRXA 2AY3A 1H1CA 4JE5D 5TF5A 3P1TA 4LC3A 2YKYA 3DXVA 1CZEA 4WXBA 1I48A 1YIYA 4U1TA 4Y0HA 4EU1A 1BW0A 1GBNA 2HOXA 5I92A 2V0YA 2W7FA 3FFRA 3N4RA 3FDDA 1XI9A 3BC8A 3W1HA 3F0HA 1G4XA 1V2DA 1LC7A 3ZRRA 1RV3A 3LY1A 1C7NA 1ARSA 2BWOA 3FVXA 5HXXA 3PGYA 2W7HA 1JS3A 1WYTA 2X8UA 3EI7A 3NRAA 4RLGA 4RJYA 1IVRA 3BN1A 1AIAA 2VMOA 3A9XA 3CQ6A 2ZP7A 4WB0B 5D95A 1OXOA 3DR7A 3RBFA 2RFVA 2PB2A 4R5ZA 3D6KA 1TATA 3E2FA 2JJEA 1YOOA 2EO5A 4WYAA 1LKCA 3FD0A 1D7VA 3FFHA 3LV2A 5IWQA 3ATHA 2EZ2A 2WK8A 1AY8A 3LWSA 2ZY5A 3COGA 3GZDA 4W5KA 4BA4A 3BS8A 3MAUA 1MAQA 5EAVA 2YCPA 2BWNA 3W1IA 2R5EA 3H14A 1G7WA 1OHWA 3MBBA 1N2TA 4JF0A 2G6WA 4HVKA 5BJ4A 1ASGA 4ITGA 4MQPA 4B98A 3DODA 1QZ9A 4W1WA 3RI6A 4GE7A 1FG7A 4RAEA 4Y0DA 1IJIA 3WCNA 2AY7A 1B8GA 1YJSA 2JJFA 1ASFA 3RCHA 3DYDA 1AIBA 1V72A 4EB7A 2HZPA 5AX8A 4E3RA 2R2NA 2BI2A 3E6GA 2VMPA 5E5IA 3I5TA 2C44A 2VGVA 2JGTA 2ZY4A 4JEZA 1AJSB 3BV0A 1AAWA 3QGUA 2ZSMA 5DJ1A 2GQNA 1V2FA 4CBRA 2AY1A 4JEYA 1ARGA 4JF1A 2HP1A 5EAAA 1YAAA 5FT6A 3OKSA 4CVQA 1KL1A 1BQDA 1D7SA 1M0OA 3F6TA 4CBSA 4ZWVA 1E5FA 2QBTA 1DKAA 4WYEA 2DOUA 3TATA 3CAIA 4GEBA 3FZ6A 1GEYA 1IX8A 4AH3A 5DJ9A 3PDXA 2BYJA 1M0PA 3BCAA 1IAYA 1W7MA 1D7RA 2VGUA 3JZLA 3WLXA 3L44A 3DXWA 3PA9A 3MC6C 3EIAA 2CH2A 1Y4IA 3FZ8A 1OHYA 1SZUA 2R0TA 4N0WA 1M7YA 2WK7A 2W8UA 1JG8A 2VMXA 2VI8A 1WKGA 4F5GA 3UE8A 1RV4A 4ZLVA 3CQ5A 4OTLA 1SZKA 1WYUB 4RIZA 2Z9XA 3AATA 1FC4A 2VLHA 4A72A 5KTBA 1SFFA 1LC5A 2AATA 1KKJA 4PFNA 1SPAA 2CH1A 4L0OA 3TFTA 4FL0A 1SF2A 4A0RA 3T32A 3H9XA 1KKPA 3WKSA 4CXQA 2OQXA 4DBCA 4RM1A 3GSBA 2GB3A 2D65A 4WXFA 4QGRA 2QSRA 1MLYA 4R2NA 1CQ8A 3LVJA 3I4JA 3LVMA 1MGVA 1QJ3A 4MKJA 3NU7A 4UHOA 1S0AA 2E7UA 4ZAHA 2W7DA 2HUUA 4IX8A 3WY7A 1X29A 1W7LA 2BI9A 1CJ0A 1TOGA 2DGLA 3HBXA 3M5UA 4IYOA 1GEXA 3FRKA 5EUDA 1AHGA 2VMYA 4M2KA 2QMAA 4P7YA 4HF8A 4XEWA 1AHFA 3EIBA 2BYLA 3PDBA 5HDMA 1AHYA 1EQBA 1IAXA 4R8DA 1DGDA 1H0CA 3L8AA 4CXRA 5FT8A 1AMQA 3RQ1A 2AY6A 1GC2A 2W7IA 4WLHA 1JS6A 2Q7WA 3BCXA 3BCBA 4P3MA 2Z9WA 4Q75A 4ADCA 3E77A 3E9KA 4E77A 4LNJA 4ZM3A 4A6TA 2CJDA 1S09A 1AHEA 3ELEA 3JU7A 2HOZA 1E5EA 1O69A 2D64A 1IX7A 1AX4A 3AEJA 1GD9A 3AELA 2BIEA 3EZ1A 4OBUA 1DGEA 3RUYA 4BA5A 1MDZA 3NX3A 4XJOA 1AHXA 3KE3A 9AATA 2ORDA 2F8JA 3LG0A 1UU2A 1ASLA 1BQAA 5EUEA 2D63A 3AEMC 3JWAA 1YIZA 1B5PA 2O7CA 2VMWA 3FQ7A 1UKJA 5EUNA 3AV7A 4ZM4A 1LS3A 2JG2A 1MDXA 4KAMA 2YKUA 3AOVA 2VGSA 2VMSA 1G7XA 1BJNA 2CTZA 4EFFA 2C0RA 4UOYA 2DKBA 3VK3A 3N4XA 3FSLA 4FFCA 1B4XA 3K40A 3FVSA 1C9CA 4OC9A 3MAFA 4IXOA 3E2ZA 4RKCA 3PD6A 2OKKA 4MY5A 4UHMA 3P6KA 2CFBA 3EI8A 1ARTA 1WYVB 2Z9VA 3ACZA 2C7TA 3QM2A 2E7JA 4JEXA 3TQXA 1TOIA 5M49A 4A6RA 2AY5A 4MKKA 1WYUA 4ISYA 4XAUA 3ZRPA 2JJHA 4PIWA 1BT4A 5F8VA 1DTYA 2EGYA 2FYFA 3CQ4A 3Q8NA 2W7GA 3R9AA 4W8IA 4A0HA 2WB6A 1GCKA 3ELPA 3ISLA 2OGEA 3FTBA 1EJIA 5G2QA 2VMRA 3NUBA 4WLJA 4E3QA 1U08A 3WCOA 3ZZKA 1I41A 1AKCA 1GC4A 1CL1A 3LVLB 1BJOA 2D7ZA 4ZWMA 4ADEA 1UU0A 3VK2A 3K7YA 5LH9A 2GMSA 3PIUA 3JTXA 2FQ6A 2OATA 2X5DA 2W7JA 3BWNC 3I16A 3QBOA 4XJLA 3RBLA 2HORA 1T3IA 1BS0A 1C4KA 3NYTA 3G8MA 1I43A 3MADA 1V2EA 1WKHA 2G7JA 1CS1A 2R5CA 1SZSA 2YCTA 5EQCA 4NOGA 3QI6A 3B1EA 3PJ0A 5EFSA 3N0LA 1ASCA 1GEWA 1D2FA 2CANA 2D5YA 4ZASA 1ZOBA 3EI9A 2WKAA 1UU1A 3FZ7A 1AKBA 2EPJA 2OGAA 1X2AA 1AAMA 3ZRQA 4TMRA 3FDBA 4H63Q 1MLZA 4UQVA 4BHDA 2CY8A 3JW9A 3R4TA 1ORDA 3H7FA 1IBJA 5G4IA 3UWCA 3QPGA 4U2HA 2Z1YA 3WKRA 3NYSA 1PMOA 2D7YA 3BWNA 3FQAA 3A8UX 2QLRA 2O0RA 5E4ZA 4IXZA 4F5MA 4E1OA 3HQTA 1WYTB 4A00A 5LHAA 4MQQA 5G09A 4IW7A 1ARHA 4JE5A 4LW4A 4XJMA 3LVKA 4K05A 1DJEA 4RJ0A 5M4DA 1X0MA 1TARA 2HUFA 4I8AA 4WB0A 2YKXA 4PFFA 1X28A 1AMRA 2W8VA 4OYTA 2W8JA 2Z67A 1BJ4A 3EZSA 1KMJA 5DX5A 3MC6A 3HL2A 1YJZA 1TOEA 2VMNA 5HHYA 2KFPA 2CINA 2FNIA 3HT4A 3VOMA 1IX6A 2D61A 5M4BA 3NU8A 2ZSLA 1TOKA 1ASMA 1GC3A 5G4JA 2AY2A 4AZJA 4ZDOA 3NTJA 2ZUKA 3GJUA 2VI9A 4ADBA 4Y0IA 5FT5A 1QISA 1DJ9A 3RCHB 3BB8A 4ATPA 1QITA 5E3KA 2D66A 3HVYA 1EG5A 2QA3A 3ECDA 4WYFA 4B9BA 5C6UA 2DR1A 3GBXA 1P3WA 1AJSA 1G4VA 3B8XA 3TFUA 2AEUA 3GR9A 3W1JA 3UAKA 2PO3A 4MQRA 4IXSA 3HLMA 4WYGA 1I29A 3IF2A 1OXPA 3DR4A 2ZJGA 5EIGB 3G7QA 4RKDA 1DFOA 2FN6A 2AEVA 3A9YA 1GC0A 4XJPA 2VMVA 4WYCA 3HMUA 2YOBA 3GWPA 1Z3ZA 1IUGA 3ASAA 1M4NA 2HP2A 1W23A 3AENB 2BWPA 3MEBA 3KKIA 1LW5A 4JEWA 3AEPA 8AATA 1N8PA 3GZDC 3E2YA 5G2PA 5K8BA 1B9HA 1KMKA 2VYCA 4OMAA 4WP0A 4AO4A 1QJ5A 3DU4A 2BIAA 2EH6A 3WX9A 4AZKA 4ZSWA 2DKJA 2ZY3A 4M2MA 4J8LA 3A9ZA 2W7LA 3WGCA 3F9TA 4OT8A 3IHJA 4BQ0A 1LC8A 2HOYA 2OKJA 3B1CA 3BWOA 3EI6A 1OHVA 4LW2A 1ELUA 2GSAA 1OATA 1TPLA 3A2BA 4MGRA 4A0FA 2YKVA 4ADDA 1ELQA 4KYOA 4MSOA 2XH1A 4R5FA 3FCRA 2VGWA 4F5JA 3K28A 2XBNA 1CQ7A 3CBFA 2VIAA 2W7EA 3AEMA 1B9IA 1AICA 1AMAA 1ASDA 1W7NA 1PFFA 2TPLA 2AY8A 3AOWA 1PG8A 1RVUA 1AY4A 2X5FA 4ITXA 5BJ3A 1ASAA 1J04A 4ZSYA 4GE9A 3EUCA 3N4SA 4IY7A 1DJUA 2O1BA 1QIRA 1FG3A 1TASA 3KGXA 4F5LA 4IYOB 1AKAA 2VLFA 4K2BA 2EYQA 1Z7DA 1W3UA 1B5OA 3B46A 5D5SA 1GDEA 4XK1A 1M0NA 4W1XA 2W8WA 3MKJA 2ZC0A 4TN4A 2Z9UA 3PDBB 2JJGA 1M32A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP6 A;  4PVF A;  4WXG A;  5M46 A;  2VMT A;  3HDO A;  4LNM A;  1BKG A;  2VGZ A;  1C0N A;  4ZDP A;  4Q6R A;  4W91 A;  3VK4 A;  5JAY A;  1O61 A;  2ZYJ A;  4K2M A;  5FT4 A;  1ARI A;  3JWB A;  4DGT A;  2BIG A;  2NMP A;  3EI5 A;  1ZOD A;  2Z61 A;  1AMS A;  1O62 A;  2E7I A;  3ZZJ A;  2EZ1 A;  4KXK A;  1S07 A;  2BI1 A;  1AY5 A;  1ZC9 A;  2DGK A;  2Z1Z A;  3FKD A;  4WBT A;  5EIG A;  7AAT A;  3QN6 A;  1ECX A;  3NNK A;  1YNU A;  5G0A A;  3B1D A;  3WGB A;  3AEO A;  3QHX A;  4GDY A;  1J32 A;  4Q76 A;  2CJH A;  2CJG A;  3AEN A;  3NYU A;  3TCM A;  1VP4 A;  4M2J A;  1ASB A;  1SVV A;  2CST A;  2VMZ A;  1ASN A;  3KGW A;  3MAF B;  3USF A;  3E2Z B;  4GE4 A;  4O6Z A;  3PD6 B;  4F5I A;  2BHX A;  1KL2 A;  1MAP A;  3VAX A;  4XQ2 A;  3OP7 A;  1WYV A;  2AY4 A;  4AOA A;  1CQ6 A;  4EMY A;  4H51 A;  4A6U A;  1XEY A;  1JF9 A;  1VJO A;  1N31 A;  1S06 A;  3DC1 A;  1CL2 A;  2E54 A;  2QB2 A;  3GZC A;  2W7K A;  4RIT A;  2FNU A;  2ZY2 A;  4K2I A;  3PPL A;  1M6S A;  4N0B A;  4W1V A;  1C7O A;  1O4S A;  2V1P A;  3N75 A;  4F5K A;  1RVY A;  3DZZ A;  2HUI A;  1YJY A;  2DGM A;  2FM1 A;  4WYD A;  4DQ6 A;  2BKW A;  2W8T A;  2YCN A;  5J8Q A;  4J5U A;  4UHN A;  1AJR A;  3AEJ C;  4OBV A;  3WZF A;  2WK9 A;  4TV7 A;  2VGT A;  3FQ8 A;  3ASB A;  4ATQ A;  3PAA A;  4WD2 A;  1BJO B;  1QGN A;  3II0 A;  4GSA A;  2PB0 A;  1LW4 A;  1TOJ A;  2YRI A;  2VIB A;  3FVU A;  3N5M A;  2BI3 A;  2Z20 A;  2YRR A;  4ZDL A;  1MDO A;  4F5H A;  1LK9 A;  2JIS A;  1VEF A;  2VMQ A;  3DRD A;  2QB3 A;  1BJW A;  3G0T A;  2GMU A;  4JEV A;  2X3L A;  3GET A;  1M0Q A;  4Q31 A;  1D7U A;  2VMU A;  2R5C B;  1S08 A;  4BMK A;  2BI5 A;  2CB1 A;  4A0G A;  4EB5 A;  2AY9 A;  4LNL A;  2YHK A;  1CZC A;  1ASE A;  5DB5 A;  3NUI A;  4OCA A;  5F9S A;  4AO9 A;  1WST A;  3NDN A;  1PMM A;  2C81 A;  4F4E A;  2W7M A;  4F5F A;  1C7G A;  4GRX A;  2AY3 A;  1H1C A;  4JE5 D;  5TF5 A;  3P1T A;  4LC3 A;  2YKY A;  3DXV A;  1CZE A;  4WXB A;  1I48 A;  1YIY A;  4U1T A;  4Y0H A;  4EU1 A;  1BW0 A;  1GBN A;  2HOX A;  5I92 A;  2V0Y A;  2W7F A;  3FFR A;  3FDD A;  1XI9 A;  3BC8 A;  3W1H A;  3F0H A;  1G4X A;  1V2D A;  1LC7 A;  3ZRR A;  1RV3 A;  3LY1 A;  1C7N A;  1ARS A;  2BWO A;  3FVX A;  5HXX A;  3PGY A;  2W7H A;  1JS3 A;  1WYT A;  2X8U A;  3EI7 A;  3NRA A;  4RLG A;  4RJY A;  1IVR A;  3BN1 A;  1AIA A;  2VMO A;  3A9X A;  3CQ6 A;  2ZP7 A;  4WB0 B;  5D95 A;  1OXO A;  3DR7 A;  3RBF A;  2RFV A;  2PB2 A;  4R5Z A;  3D6K A;  1TAT A;  3E2F A;  2JJE A;  1YOO A;  2EO5 A;  4WYA A;  1LKC A;  3FD0 A;  1D7V A;  3FFH A;  3LV2 A;  5IWQ A;  3ATH A;  2EZ2 A;  2WK8 A;  1AY8 A;  3LWS A;  2ZY5 A;  3COG A;  3GZD A;  4W5K A;  4BA4 A;  3BS8 A;  3MAU A;  1MAQ A;  5EAV A;  2YCP A;  2BWN A;  3W1I A;  2R5E A;  3H14 A;  1G7W A;  1OHW A;  3MBB A;  1N2T A;  4JF0 A;  2G6W A;  4HVK A;  5BJ4 A;  1ASG A;  4ITG A;  4MQP A;  4B98 A;  3DOD A;  1QZ9 A;  4W1W A;  3RI6 A;  4GE7 A;  1FG7 A;  4RAE A;  4Y0D A;  1IJI A;  3WCN A;  2AY7 A;  1B8G A;  1YJS A;  2JJF A;  1ASF A;  3RCH A;  3DYD A;  1AIB A;  1V72 A;  4EB7 A;  2HZP A;  5AX8 A;  4E3R A;  2R2N A;  2BI2 A;  3E6G A;  2VMP A;  5E5I A;  3I5T A;  2C44 A;  2VGV A;  2JGT A;  2ZY4 A;  4JEZ A;  1AJS B;  3BV0 A;  1AAW A;  3QGU A;  2ZSM A;  5DJ1 A;  2GQN A;  1V2F A;  4CBR A;  2AY1 A;  4JEY A;  1ARG A;  4JF1 A;  2HP1 A;  5EAA A;  1YAA A;  5FT6 A;  3OKS A;  4CVQ A;  1KL1 A;  1BQD A;  1D7S A;  1M0O A;  3F6T A;  4CBS A;  4ZWV A;  1E5F A;  2QBT A;  1DKA A;  4WYE A;  2DOU A;  3TAT A;  3CAI A;  4GEB A;  3FZ6 A;  1GEY A;  1IX8 A;  4AH3 A;  5DJ9 A;  3PDX A;  2BYJ A;  1M0P A;  3BCA A;  1IAY A;  1W7M A;  1D7R A;  2VGU A;  3JZL A;  3WLX A;  3L44 A;  3DXW A;  3PA9 A;  3MC6 C;  3EIA A;  2CH2 A;  1Y4I A;  3FZ8 A;  1OHY A;  1SZU A;  2R0T A;  4N0W A;  1M7Y A;  2WK7 A;  2W8U A;  1JG8 A;  2VMX A;  2VI8 A;  1WKG A;  4F5G A;  3UE8 A;  1RV4 A;  4ZLV A;  3CQ5 A;  4OTL A;  1SZK A;  1WYU B;  4RIZ A;  2Z9X A;  3AAT A;  1FC4 A;  2VLH A;  4A72 A;  1SFF A;  1LC5 A;  2AAT A;  1KKJ A;  4PFN A;  1SPA A;  2CH1 A;  4L0O A;  3TFT A;  4FL0 A;  1SF2 A;  4A0R A;  3T32 A;  1KKP A;  3WKS A;  4CXQ A;  2OQX A;  4DBC A;  4RM1 A;  3GSB A;  2GB3 A;  2D65 A;  4WXF A;  4QGR A;  1MLY A;  4R2N A;  1CQ8 A;  3LVJ A;  3I4J A;  3LVM A;  1MGV A;  1QJ3 A;  4MKJ A;  3NU7 A;  4UHO A;  1S0A A;  2E7U A;  4ZAH A;  2W7D A;  2HUU A;  4IX8 A;  3WY7 A;  1X29 A;  1W7L A;  2BI9 A;  1CJ0 A;  1TOG A;  2DGL A;  3HBX A;  3M5U A;  4IYO A;  1GEX A;  3FRK A;  5EUD A;  1AHG A;  2VMY A;  4M2K A;  2QMA A;  4P7Y A;  4HF8 A;  4XEW A;  1AHF A;  3EIB A;  2BYL A;  3PDB A;  5HDM A;  1AHY A;  1EQB A;  1IAX A;  4R8D A;  1DGD A;  1H0C A;  3L8A A;  4CXR A;  5FT8 A;  1AMQ A;  3RQ1 A;  2AY6 A;  1GC2 A;  2W7I A;  4WLH A;  1JS6 A;  2Q7W A;  3BCX A;  3BCB A;  4P3M A;  2Z9W A;  4Q75 A;  4ADC A;  3E77 A;  3E9K A;  4E77 A;  4LNJ A;  4ZM3 A;  4A6T A;  2CJD A;  1S09 A;  1AHE A;  3ELE A;  3JU7 A;  2HOZ A;  1E5E A;  1O69 A;  2D64 A;  1IX7 A;  1AX4 A;  3AEJ A;  1GD9 A;  3AEL A;  2BIE A;  3EZ1 A;  4OBU A;  1DGE A;  3RUY A;  4BA5 A;  1MDZ A;  3NX3 A;  4XJO A;  1AHX A;  3KE3 A;  9AAT A;  2ORD A;  2F8J A;  3LG0 A;  1UU2 A;  1ASL A;  1BQA A;  5EUE A;  2D63 A;  3AEM C;  3JWA A;  1YIZ A;  1B5P A;  2O7C A;  2VMW A;  3FQ7 A;  1UKJ A;  5EUN A;  3AV7 A;  4ZM4 A;  1LS3 A;  2JG2 A;  1MDX A;  4KAM A;  2YKU A;  3AOV A;  2VGS A;  2VMS A;  1G7X A;  1BJN A;  2CTZ A;  4EFF A;  2C0R A;  4UOY A;  2DKB A;  3VK3 A;  3FSL A;  4FFC A;  1B4X A;  3K40 A;  3FVS A;  1C9C A;  4OC9 A;  3MAF A;  4IXO A;  3E2Z A;  4RKC A;  3PD6 A;  2OKK A;  4MY5 A;  4UHM A;  3P6K A;  2CFB A;  3EI8 A;  1ART A;  1WYV B;  2Z9V A;  3ACZ A;  2C7T A;  3QM2 A;  2E7J A;  4JEX A;  3TQX A;  1TOI A;  5M49 A;  4A6R A;  2AY5 A;  4MKK A;  1WYU A;  4ISY A;  4XAU A;  3ZRP A;  2JJH A;  4PIW A;  1BT4 A;  5F8V A;  1DTY A;  2EGY A;  2FYF A;  3CQ4 A;  3Q8N A;  2W7G A;  3R9A A;  4W8I A;  4A0H A;  1GCK A;  3ELP A;  3ISL A;  2OGE A;  3FTB A;  1EJI A;  5G2Q A;  2VMR A;  3NUB A;  4WLJ A;  4E3Q A;  1U08 A;  3WCO A;  3ZZK A;  1I41 A;  1AKC A;  1GC4 A;  1CL1 A;  3LVL B;  1BJO A;  2D7Z A;  4ZWM A;  4ADE A;  1UU0 A;  3VK2 A;  3K7Y A;  5LH9 A;  2GMS A;  3PIU A;  3JTX A;  2FQ6 A;  2OAT A;  2X5D A;  2W7J A;  3BWN C;  3I16 A;  3QBO A;  4XJL A;  3RBL A;  2HOR A;  1T3I A;  1BS0 A;  1C4K A;  3NYT A;  3G8M A;  1I43 A;  3MAD A;  1V2E A;  1WKH A;  1CS1 A;  2R5C A;  1SZS A;  2YCT A;  5EQC A;  4NOG A;  3QI6 A;  3B1E A;  3PJ0 A;  5EFS A;  3N0L A;  1ASC A;  1GEW A;  1D2F A;  2CAN A;  2D5Y A;  4ZAS A;  1ZOB A;  3EI9 A;  2WKA A;  1UU1 A;  3FZ7 A;  1AKB A;  2EPJ A;  2OGA A;  1X2A A;  1AAM A;  3ZRQ A;  4TMR A;  3FDB A;  1MLZ A;  4UQV A;  4BHD A;  2CY8 A;  3JW9 A;  3R4T A;  1ORD A;  3H7F A;  1IBJ A;  5G4I A;  3UWC A;  3QPG A;  4U2H A;  2Z1Y A;  3WKR A;  3NYS A;  1PMO A;  2D7Y A;  3BWN A;  3FQA A;  3A8U X;  2QLR A;  2O0R A;  5E4Z A;  4IXZ A;  4F5M A;  4E1O A;  3HQT A;  1WYT B;  4A00 A;  5LHA A;  4MQQ A;  5G09 A;  4IW7 A;  1ARH A;  4JE5 A;  4LW4 A;  4XJM A;  3LVK A;  1DJE A;  4RJ0 A;  5M4D A;  1X0M A;  1TAR A;  2HUF A;  4I8A A;  4WB0 A;  2YKX A;  4PFF A;  1X28 A;  1AMR A;  2W8V A;  4OYT A;  2W8J A;  2Z67 A;  1BJ4 A;  3EZS A;  1KMJ A;  5DX5 A;  3MC6 A;  3HL2 A;  1YJZ A;  1TOE A;  2VMN A;  5HHY A;  2CIN A;  2FNI A;  3HT4 A;  3VOM A;  1IX6 A;  2D61 A;  5M4B A;  3NU8 A;  2ZSL A;  1TOK A;  1ASM A;  1GC3 A;  5G4J A;  2AY2 A;  4AZJ A;  4ZDO A;  3NTJ A;  2ZUK A;  3GJU A;  2VI9 A;  4ADB A;  4Y0I A;  5FT5 A;  1QIS A;  1DJ9 A;  3RCH B;  3BB8 A;  4ATP A;  1QIT A;  5E3K A;  2D66 A;  3HVY A;  1EG5 A;  2QA3 A;  3ECD A;  4WYF A;  4B9B A;  5C6U A;  2DR1 A;  3GBX A;  1P3W A;  1AJS A;  1G4V A;  3B8X A;  3TFU A;  2AEU A;  3GR9 A;  3W1J A;  3UAK A;  2PO3 A;  4MQR A;  4IXS A;  3HLM A;  4WYG A;  1I29 A;  3IF2 A;  1OXP A;  3DR4 A;  2ZJG A;  5EIG B;  3G7Q A;  4RKD A;  1DFO A;  2FN6 A;  2AEV A;  3A9Y A;  1GC0 A;  4XJP A;  2VMV A;  4WYC A;  3HMU A;  2YOB A;  3GWP A;  1Z3Z A;  1IUG A;  3ASA A;  1M4N A;  2HP2 A;  1W23 A;  3AEN B;  2BWP A;  3MEB A;  3KKI A;  1LW5 A;  4JEW A;  3AEP A;  8AAT A;  1N8P A;  3GZD C;  3E2Y A;  5G2P A;  5K8B A;  1B9H A;  1KMK A;  2VYC A;  4OMA A;  4WP0 A;  4AO4 A;  1QJ5 A;  3DU4 A;  2BIA A;  2EH6 A;  3WX9 A;  4AZK A;  4ZSW A;  2DKJ A;  2ZY3 A;  4M2M A;  4J8L A;  3A9Z A;  2W7L A;  3WGC A;  3F9T A;  4OT8 A;  3IHJ A;  4BQ0 A;  1LC8 A;  2HOY A;  2OKJ A;  3B1C A;  3BWO A;  3EI6 A;  1OHV A;  4LW2 A;  1ELU A;  2GSA A;  1OAT A;  1TPL A;  3A2B A;  4MGR A;  4A0F A;  2YKV A;  4ADD A;  1ELQ A;  4KYO A;  4MSO A;  2XH1 A;  4R5F A;  3FCR A;  2VGW A;  4F5J A;  3K28 A;  2XBN A;  1CQ7 A;  3CBF A;  2VIA A;  2W7E A;  3AEM A;  1B9I A;  1AIC A;  1AMA A;  1ASD A;  1W7N A;  1PFF A;  2TPL A;  2AY8 A;  3AOW A;  1PG8 A;  1RVU A;  1AY4 A;  2X5F A;  4ITX A;  5BJ3 A;  1ASA A;  1J04 A;  4ZSY A;  4GE9 A;  3EUC A;  4IY7 A;  1DJU A;  2O1B A;  1QIR A;  1FG3 A;  1TAS A;  3KGX A;  4F5L A;  4IYO B;  1AKA A;  2VLF A;  4K2B A;  1Z7D A;  1W3U A;  1B5O A;  3B46 A;  5D5S A;  1GDE A;  4XK1 A;  1M0N A;  4W1X A;  2W8W A;  3MKJ A;  2ZC0 A;  4TN4 A;  2Z9U A;  3PDB B;  2JJG A;  1M32 A; 
#chains in the Genus database with same CATH topology
 3VP6 A;  4PVF A;  4WXG A;  5M46 A;  2VMT A;  3HDO A;  4LNM A;  1BKG A;  2VGZ A;  1C0N A;  4ZDP A;  4Q6R A;  4W91 A;  3VK4 A;  5JAY A;  1O61 A;  2ZYJ A;  4K2M A;  5FT4 A;  2A1V A;  1ARI A;  3JWB A;  4DGT A;  2BIG A;  2NMP A;  3EI5 A;  1ZOD A;  2Z61 A;  1AMS A;  1O62 A;  2E7I A;  3ZZJ A;  2EZ1 A;  4KXK A;  1S07 A;  2BI1 A;  1AY5 A;  1ZC9 A;  2DGK A;  2Z1Z A;  3FKD A;  4WBT A;  5EIG A;  7AAT A;  3QN6 A;  1ECX A;  3NNK A;  1YNU A;  5G0A A;  3B1D A;  3WGB A;  3AEO A;  3QHX A;  4GDY A;  1J32 A;  4Q76 A;  2CJH A;  2CJG A;  3AEN A;  3NYU A;  3TCM A;  1VP4 A;  4M2J A;  1ASB A;  1SVV A;  2FKI A;  2CST A;  2VMZ A;  1ASN A;  3KGW A;  3MAF B;  3USF A;  3E2Z B;  4GE4 A;  4O6Z A;  3PD6 B;  4F5I A;  2BHX A;  1KL2 A;  1MAP A;  3VAX A;  4XQ2 A;  3OP7 A;  1WYV A;  2AY4 A;  4AOA A;  1CQ6 A;  4EMY A;  4H51 A;  4A6U A;  1XEY A;  1JF9 A;  1VJO A;  1N31 A;  1S06 A;  3DC1 A;  1CL2 A;  2E54 A;  2QB2 A;  3GZC A;  2W7K A;  4RIT A;  2FNU A;  2ZY2 A;  4K2I A;  3PPL A;  1M6S A;  4N0B A;  4W1V A;  1C7O A;  1O4S A;  2V1P A;  3N75 A;  4F5K A;  1RVY A;  3DZZ A;  2HUI A;  1YJY A;  2DGM A;  2FM1 A;  4WYD A;  4DQ6 A;  2BKW A;  2W8T A;  2YCN A;  5J8Q A;  4J5U A;  4UHN A;  1AJR A;  3AEJ C;  4OBV A;  3WZF A;  2WK9 A;  4TV7 A;  2VGT A;  3FQ8 A;  3ASB A;  4ATQ A;  3PAA A;  4WD2 A;  1BJO B;  1QGN A;  3II0 A;  4GSA A;  2PB0 A;  1LW4 A;  1TOJ A;  2YRI A;  2VIB A;  3FVU A;  3N5M A;  2BI3 A;  2Z20 A;  2YRR A;  4ZDL A;  1MDO A;  4F5H A;  1LK9 A;  2JIS A;  1VEF A;  2VMQ A;  3DRD A;  2QB3 A;  1BJW A;  3G0T A;  2GMU A;  4JEV A;  2X3L A;  3GET A;  1M0Q A;  4Q31 A;  1D7U A;  2VMU A;  2R5C B;  1S08 A;  4BMK A;  2BI5 A;  2CB1 A;  4A0G A;  4EB5 A;  2AY9 A;  4LNL A;  2YHK A;  1CZC A;  1ASE A;  5DB5 A;  3N7N A;  3NUI A;  4OCA A;  5F9S A;  4AO9 A;  1WST A;  3NDN A;  1PMM A;  2C81 A;  4F4E A;  2W7M A;  4F5F A;  1C7G A;  4GRX A;  2AY3 A;  1H1C A;  4JE5 D;  5TF5 A;  3P1T A;  4LC3 A;  2YKY A;  3DXV A;  1CZE A;  4WXB A;  1I48 A;  1YIY A;  4U1T A;  4Y0H A;  4EU1 A;  1BW0 A;  1GBN A;  2HOX A;  5I92 A;  2V0Y A;  2W7F A;  3FFR A;  3N4R A;  3FDD A;  1XI9 A;  3BC8 A;  3W1H A;  3F0H A;  1G4X A;  1V2D A;  1LC7 A;  3ZRR A;  1RV3 A;  3LY1 A;  1C7N A;  1ARS A;  2BWO A;  3FVX A;  5HXX A;  3PGY A;  2W7H A;  1JS3 A;  1WYT A;  2X8U A;  3EI7 A;  3NRA A;  4RLG A;  4RJY A;  1IVR A;  3BN1 A;  1AIA A;  2VMO A;  3A9X A;  3CQ6 A;  2ZP7 A;  4WB0 B;  5D95 A;  1OXO A;  3DR7 A;  3RBF A;  2RFV A;  2PB2 A;  4R5Z A;  3D6K A;  1TAT A;  3E2F A;  2JJE A;  1YOO A;  2EO5 A;  4WYA A;  1LKC A;  3FD0 A;  1D7V A;  3FFH A;  3LV2 A;  5IWQ A;  3ATH A;  2EZ2 A;  2WK8 A;  1AY8 A;  3LWS A;  2ZY5 A;  3COG A;  3GZD A;  4W5K A;  4BA4 A;  3BS8 A;  3MAU A;  1MAQ A;  5EAV A;  2YCP A;  2BWN A;  3W1I A;  2R5E A;  3H14 A;  1G7W A;  1OHW A;  3MBB A;  1N2T A;  4JF0 A;  2G6W A;  4HVK A;  5BJ4 A;  1ASG A;  4ITG A;  4MQP A;  4B98 A;  3DOD A;  1QZ9 A;  4W1W A;  3RI6 A;  4GE7 A;  1FG7 A;  4RAE A;  4Y0D A;  1IJI A;  3WCN A;  2AY7 A;  1B8G A;  1YJS A;  2JJF A;  1ASF A;  3RCH A;  3DYD A;  1AIB A;  1V72 A;  4EB7 A;  2HZP A;  5AX8 A;  4E3R A;  2R2N A;  2BI2 A;  3E6G A;  2VMP A;  5E5I A;  3I5T A;  2C44 A;  2VGV A;  2JGT A;  2ZY4 A;  4JEZ A;  1AJS B;  3BV0 A;  1AAW A;  3QGU A;  2ZSM A;  5DJ1 A;  2GQN A;  1V2F A;  4CBR A;  2AY1 A;  4JEY A;  1ARG A;  4JF1 A;  2HP1 A;  5EAA A;  1YAA A;  5FT6 A;  3OKS A;  4CVQ A;  1KL1 A;  1BQD A;  1D7S A;  1M0O A;  3F6T A;  4CBS A;  4ZWV A;  1E5F A;  2QBT A;  1DKA A;  4WYE A;  2DOU A;  3TAT A;  3CAI A;  4GEB A;  3FZ6 A;  1GEY A;  1IX8 A;  4AH3 A;  5DJ9 A;  3PDX A;  2BYJ A;  1M0P A;  3BCA A;  1IAY A;  1W7M A;  1D7R A;  2VGU A;  3JZL A;  3WLX A;  3L44 A;  3DXW A;  3PA9 A;  3MC6 C;  3EIA A;  2CH2 A;  1Y4I A;  3FZ8 A;  1OHY A;  1SZU A;  2R0T A;  4N0W A;  1M7Y A;  2WK7 A;  2W8U A;  1JG8 A;  2VMX A;  2VI8 A;  1WKG A;  4F5G A;  3UE8 A;  1RV4 A;  4ZLV A;  3CQ5 A;  4OTL A;  1SZK A;  1WYU B;  4RIZ A;  2Z9X A;  3AAT A;  1FC4 A;  2VLH A;  4A72 A;  5KTB A;  1SFF A;  1LC5 A;  2AAT A;  1KKJ A;  4PFN A;  1SPA A;  2CH1 A;  4L0O A;  3TFT A;  4FL0 A;  1SF2 A;  4A0R A;  3T32 A;  3H9X A;  1KKP A;  3WKS A;  4CXQ A;  2OQX A;  4DBC A;  4RM1 A;  3GSB A;  2GB3 A;  2D65 A;  4WXF A;  4QGR A;  2QSR A;  1MLY A;  4R2N A;  1CQ8 A;  3LVJ A;  3I4J A;  3LVM A;  1MGV A;  1QJ3 A;  4MKJ A;  3NU7 A;  4UHO A;  1S0A A;  2E7U A;  4ZAH A;  2W7D A;  2HUU A;  4IX8 A;  3WY7 A;  1X29 A;  1W7L A;  2BI9 A;  1CJ0 A;  1TOG A;  2DGL A;  3HBX A;  3M5U A;  4IYO A;  1GEX A;  3FRK A;  5EUD A;  1AHG A;  2VMY A;  4M2K A;  2QMA A;  4P7Y A;  4HF8 A;  4XEW A;  1AHF A;  3EIB A;  2BYL A;  3PDB A;  5HDM A;  1AHY A;  1EQB A;  1IAX A;  4R8D A;  1DGD A;  1H0C A;  3L8A A;  4CXR A;  5FT8 A;  1AMQ A;  3RQ1 A;  2AY6 A;  1GC2 A;  2W7I A;  4WLH A;  1JS6 A;  2Q7W A;  3BCX A;  3BCB A;  4P3M A;  2Z9W A;  4Q75 A;  4ADC A;  3E77 A;  3E9K A;  4E77 A;  4LNJ A;  4ZM3 A;  4A6T A;  2CJD A;  1S09 A;  1AHE A;  3ELE A;  3JU7 A;  2HOZ A;  1E5E A;  1O69 A;  2D64 A;  1IX7 A;  1AX4 A;  3AEJ A;  1GD9 A;  3AEL A;  2BIE A;  3EZ1 A;  4OBU A;  1DGE A;  3RUY A;  4BA5 A;  1MDZ A;  3NX3 A;  4XJO A;  1AHX A;  3KE3 A;  9AAT A;  2ORD A;  2F8J A;  3LG0 A;  1UU2 A;  1ASL A;  1BQA A;  5EUE A;  2D63 A;  3AEM C;  3JWA A;  1YIZ A;  1B5P A;  2O7C A;  2VMW A;  3FQ7 A;  1UKJ A;  5EUN A;  3AV7 A;  4ZM4 A;  1LS3 A;  2JG2 A;  1MDX A;  4KAM A;  2YKU A;  3AOV A;  2VGS A;  2VMS A;  1G7X A;  1BJN A;  2CTZ A;  4EFF A;  2C0R A;  4UOY A;  2DKB A;  3VK3 A;  3N4X A;  3FSL A;  4FFC A;  1B4X A;  3K40 A;  3FVS A;  1C9C A;  4OC9 A;  3MAF A;  4IXO A;  3E2Z A;  4RKC A;  3PD6 A;  2OKK A;  4MY5 A;  4UHM A;  3P6K A;  2CFB A;  3EI8 A;  1ART A;  1WYV B;  2Z9V A;  3ACZ A;  2C7T A;  3QM2 A;  2E7J A;  4JEX A;  3TQX A;  1TOI A;  5M49 A;  4A6R A;  2AY5 A;  4MKK A;  1WYU A;  4ISY A;  4XAU A;  3ZRP A;  2JJH A;  4PIW A;  1BT4 A;  5F8V A;  1DTY A;  2EGY A;  2FYF A;  3CQ4 A;  3Q8N A;  2W7G A;  3R9A A;  4W8I A;  4A0H A;  2WB6 A;  1GCK A;  3ELP A;  3ISL A;  2OGE A;  3FTB A;  1EJI A;  5G2Q A;  2VMR A;  3NUB A;  4WLJ A;  4E3Q A;  1U08 A;  3WCO A;  3ZZK A;  1I41 A;  1AKC A;  1GC4 A;  1CL1 A;  1KAF A;  3LVL B;  1BJO A;  2D7Z A;  4ZWM A;  4ADE A;  1UU0 A;  3VK2 A;  3K7Y A;  5LH9 A;  2GMS A;  3PIU A;  3JTX A;  2FQ6 A;  2OAT A;  2X5D A;  2W7J A;  3BWN C;  3I16 A;  3QBO A;  4XJL A;  3RBL A;  2HOR A;  1T3I A;  1BS0 A;  1C4K A;  3NYT A;  3G8M A;  1I43 A;  3MAD A;  1V2E A;  1WKH A;  2G7J A;  1CS1 A;  2R5C A;  1SZS A;  2YCT A;  5EQC A;  4NOG A;  3QI6 A;  3B1E A;  3PJ0 A;  5EFS A;  3N0L A;  1ASC A;  1GEW A;  1D2F A;  2CAN A;  2D5Y A;  4ZAS A;  1ZOB A;  3EI9 A;  2WKA A;  1UU1 A;  3FZ7 A;  1AKB A;  2EPJ A;  2OGA A;  1X2A A;  1AAM A;  3ZRQ A;  4TMR A;  3FDB A;  4H63 Q;  1MLZ A;  4UQV A;  4BHD A;  2CY8 A;  3JW9 A;  3R4T A;  1ORD A;  3H7F A;  1IBJ A;  5G4I A;  3UWC A;  3QPG A;  4U2H A;  2Z1Y A;  3WKR A;  3NYS A;  1PMO A;  2D7Y A;  3BWN A;  3FQA A;  3A8U X;  2QLR A;  2O0R A;  5E4Z A;  4IXZ A;  4F5M A;  4E1O A;  3HQT A;  1WYT B;  4A00 A;  5LHA A;  4MQQ A;  5G09 A;  4IW7 A;  1ARH A;  4JE5 A;  4LW4 A;  4XJM A;  3LVK A;  4K05 A;  1DJE A;  4RJ0 A;  5M4D A;  1X0M A;  1TAR A;  2HUF A;  4I8A A;  4WB0 A;  2YKX A;  4PFF A;  1X28 A;  1AMR A;  2W8V A;  4OYT A;  2W8J A;  2Z67 A;  1BJ4 A;  3EZS A;  1KMJ A;  5DX5 A;  3MC6 A;  3HL2 A;  1YJZ A;  1TOE A;  2VMN A;  5HHY A;  2KFP A;  2CIN A;  2FNI A;  3HT4 A;  3VOM A;  1IX6 A;  2D61 A;  5M4B A;  3NU8 A;  2ZSL A;  1TOK A;  1ASM A;  1GC3 A;  5G4J A;  2AY2 A;  4AZJ A;  4ZDO A;  3NTJ A;  2ZUK A;  3GJU A;  2VI9 A;  4ADB A;  4Y0I A;  5FT5 A;  1QIS A;  1DJ9 A;  3RCH B;  3BB8 A;  4ATP A;  1QIT A;  5E3K A;  2D66 A;  3HVY A;  1EG5 A;  2QA3 A;  3ECD A;  4WYF A;  4B9B A;  5C6U A;  2DR1 A;  3GBX A;  1P3W A;  1AJS A;  1G4V A;  3B8X A;  3TFU A;  2AEU A;  3GR9 A;  3W1J A;  3UAK A;  2PO3 A;  4MQR A;  4IXS A;  3HLM A;  4WYG A;  1I29 A;  3IF2 A;  1OXP A;  3DR4 A;  2ZJG A;  5EIG B;  3G7Q A;  4RKD A;  1DFO A;  2FN6 A;  2AEV A;  3A9Y A;  1GC0 A;  4XJP A;  2VMV A;  4WYC A;  3HMU A;  2YOB A;  3GWP A;  1Z3Z A;  1IUG A;  3ASA A;  1M4N A;  2HP2 A;  1W23 A;  3AEN B;  2BWP A;  3MEB A;  3KKI A;  1LW5 A;  4JEW A;  3AEP A;  8AAT A;  1N8P A;  3GZD C;  3E2Y A;  5G2P A;  5K8B A;  1B9H A;  1KMK A;  2VYC A;  4OMA A;  4WP0 A;  4AO4 A;  1QJ5 A;  3DU4 A;  2BIA A;  2EH6 A;  3WX9 A;  4AZK A;  4ZSW A;  2DKJ A;  2ZY3 A;  4M2M A;  4J8L A;  3A9Z A;  2W7L A;  3WGC A;  3F9T A;  4OT8 A;  3IHJ A;  4BQ0 A;  1LC8 A;  2HOY A;  2OKJ A;  3B1C A;  3BWO A;  3EI6 A;  1OHV A;  4LW2 A;  1ELU A;  2GSA A;  1OAT A;  1TPL A;  3A2B A;  4MGR A;  4A0F A;  2YKV A;  4ADD A;  1ELQ A;  4KYO A;  4MSO A;  2XH1 A;  4R5F A;  3FCR A;  2VGW A;  4F5J A;  3K28 A;  2XBN A;  1CQ7 A;  3CBF A;  2VIA A;  2W7E A;  3AEM A;  1B9I A;  1AIC A;  1AMA A;  1ASD A;  1W7N A;  1PFF A;  2TPL A;  2AY8 A;  3AOW A;  1PG8 A;  1RVU A;  1AY4 A;  2X5F A;  4ITX A;  5BJ3 A;  1ASA A;  1J04 A;  4ZSY A;  4GE9 A;  3EUC A;  3N4S A;  4IY7 A;  1DJU A;  2O1B A;  1QIR A;  1FG3 A;  1TAS A;  3KGX A;  4F5L A;  4IYO B;  1AKA A;  2VLF A;  4K2B A;  2EYQ A;  1Z7D A;  1W3U A;  1B5O A;  3B46 A;  5D5S A;  1GDE A;  4XK1 A;  1M0N A;  4W1X A;  2W8W A;  3MKJ A;  2ZC0 A;  4TN4 A;  2Z9U A;  3PDB B;  2JJG A;  1M32 A; 
#chains in the Genus database with same CATH homology
 3VP6 A;  4PVF A;  4WXG A;  5M46 A;  2VMT A;  3HDO A;  4LNM A;  1BKG A;  2VGZ A;  1C0N A;  4ZDP A;  4Q6R A;  4W91 A;  3VK4 A;  5JAY A;  1O61 A;  2ZYJ A;  4K2M A;  5FT4 A;  2A1V A;  1ARI A;  3JWB A;  4DGT A;  2BIG A;  2NMP A;  3EI5 A;  1ZOD A;  2Z61 A;  1AMS A;  1O62 A;  2E7I A;  3ZZJ A;  2EZ1 A;  4KXK A;  1S07 A;  2BI1 A;  1AY5 A;  1ZC9 A;  2DGK A;  2Z1Z A;  3FKD A;  4WBT A;  5EIG A;  7AAT A;  3QN6 A;  1ECX A;  3NNK A;  1YNU A;  5G0A A;  3B1D A;  3WGB A;  3AEO A;  3QHX A;  4GDY A;  1J32 A;  4Q76 A;  2CJH A;  2CJG A;  3AEN A;  3NYU A;  3TCM A;  1VP4 A;  4M2J A;  1ASB A;  1SVV A;  2FKI A;  2CST A;  2VMZ A;  1ASN A;  3KGW A;  3MAF B;  3USF A;  3E2Z B;  4GE4 A;  4O6Z A;  3PD6 B;  4F5I A;  2BHX A;  1KL2 A;  1MAP A;  3VAX A;  4XQ2 A;  3OP7 A;  1WYV A;  2AY4 A;  4AOA A;  1CQ6 A;  4EMY A;  4H51 A;  4A6U A;  1XEY A;  1JF9 A;  1VJO A;  1N31 A;  1S06 A;  3DC1 A;  1CL2 A;  2E54 A;  2QB2 A;  3GZC A;  2W7K A;  4RIT A;  2FNU A;  2ZY2 A;  4K2I A;  3PPL A;  1M6S A;  4N0B A;  4W1V A;  1C7O A;  1O4S A;  2V1P A;  3N75 A;  4F5K A;  1RVY A;  3DZZ A;  2HUI A;  1YJY A;  2DGM A;  2FM1 A;  4WYD A;  4DQ6 A;  2BKW A;  2W8T A;  2YCN A;  5J8Q A;  4J5U A;  4UHN A;  1AJR A;  3AEJ C;  4OBV A;  3WZF A;  2WK9 A;  4TV7 A;  2VGT A;  3FQ8 A;  3ASB A;  4ATQ A;  3PAA A;  4WD2 A;  1BJO B;  1QGN A;  3II0 A;  4GSA A;  2PB0 A;  1LW4 A;  1TOJ A;  2YRI A;  2VIB A;  3FVU A;  3N5M A;  2BI3 A;  2Z20 A;  2YRR A;  4ZDL A;  1MDO A;  4F5H A;  1LK9 A;  2JIS A;  1VEF A;  2VMQ A;  3DRD A;  2QB3 A;  1BJW A;  3G0T A;  2GMU A;  4JEV A;  2X3L A;  3GET A;  1M0Q A;  4Q31 A;  1D7U A;  2VMU A;  2R5C B;  1S08 A;  4BMK A;  2BI5 A;  2CB1 A;  4A0G A;  4EB5 A;  2AY9 A;  4LNL A;  2YHK A;  1CZC A;  1ASE A;  5DB5 A;  3N7N A;  3NUI A;  4OCA A;  5F9S A;  4AO9 A;  1WST A;  3NDN A;  1PMM A;  2C81 A;  4F4E A;  2W7M A;  4F5F A;  1C7G A;  4GRX A;  2AY3 A;  1H1C A;  4JE5 D;  5TF5 A;  3P1T A;  4LC3 A;  2YKY A;  3DXV A;  1CZE A;  4WXB A;  1I48 A;  1YIY A;  4U1T A;  4Y0H A;  4EU1 A;  1BW0 A;  1GBN A;  2HOX A;  5I92 A;  2V0Y A;  2W7F A;  3FFR A;  3N4R A;  3FDD A;  1XI9 A;  3BC8 A;  3W1H A;  3F0H A;  1G4X A;  1V2D A;  1LC7 A;  3ZRR A;  1RV3 A;  3LY1 A;  1C7N A;  1ARS A;  2BWO A;  3FVX A;  5HXX A;  3PGY A;  2W7H A;  1JS3 A;  1WYT A;  2X8U A;  3EI7 A;  3NRA A;  4RLG A;  4RJY A;  1IVR A;  3BN1 A;  1AIA A;  2VMO A;  3A9X A;  3CQ6 A;  2ZP7 A;  4WB0 B;  5D95 A;  1OXO A;  3DR7 A;  3RBF A;  2RFV A;  2PB2 A;  4R5Z A;  3D6K A;  1TAT A;  3E2F A;  2JJE A;  1YOO A;  2EO5 A;  4WYA A;  1LKC A;  3FD0 A;  1D7V A;  3FFH A;  3LV2 A;  5IWQ A;  3ATH A;  2EZ2 A;  2WK8 A;  1AY8 A;  3LWS A;  2ZY5 A;  3COG A;  3GZD A;  4W5K A;  4BA4 A;  3BS8 A;  3MAU A;  1MAQ A;  5EAV A;  2YCP A;  2BWN A;  3W1I A;  2R5E A;  3H14 A;  1G7W A;  1OHW A;  3MBB A;  1N2T A;  4JF0 A;  2G6W A;  4HVK A;  5BJ4 A;  1ASG A;  4ITG A;  4MQP A;  4B98 A;  3DOD A;  1QZ9 A;  4W1W A;  3RI6 A;  4GE7 A;  1FG7 A;  4RAE A;  4Y0D A;  1IJI A;  3WCN A;  2AY7 A;  1B8G A;  1YJS A;  2JJF A;  1ASF A;  3RCH A;  3DYD A;  1AIB A;  1V72 A;  4EB7 A;  2HZP A;  5AX8 A;  4E3R A;  2R2N A;  2BI2 A;  3E6G A;  2VMP A;  5E5I A;  3I5T A;  2C44 A;  2VGV A;  2JGT A;  2ZY4 A;  4JEZ A;  1AJS B;  3BV0 A;  1AAW A;  3QGU A;  2ZSM A;  5DJ1 A;  2GQN A;  1V2F A;  4CBR A;  2AY1 A;  4JEY A;  1ARG A;  4JF1 A;  2HP1 A;  5EAA A;  1YAA A;  5FT6 A;  3OKS A;  4CVQ A;  1KL1 A;  1BQD A;  1D7S A;  1M0O A;  3F6T A;  4CBS A;  4ZWV A;  1E5F A;  2QBT A;  1DKA A;  4WYE A;  2DOU A;  3TAT A;  3CAI A;  4GEB A;  3FZ6 A;  1GEY A;  1IX8 A;  4AH3 A;  5DJ9 A;  3PDX A;  2BYJ A;  1M0P A;  3BCA A;  1IAY A;  1W7M A;  1D7R A;  2VGU A;  3JZL A;  3WLX A;  3L44 A;  3DXW A;  3PA9 A;  3MC6 C;  3EIA A;  2CH2 A;  1Y4I A;  3FZ8 A;  1OHY A;  1SZU A;  2R0T A;  4N0W A;  1M7Y A;  2WK7 A;  2W8U A;  1JG8 A;  2VMX A;  2VI8 A;  1WKG A;  4F5G A;  3UE8 A;  1RV4 A;  4ZLV A;  3CQ5 A;  4OTL A;  1SZK A;  1WYU B;  4RIZ A;  2Z9X A;  3AAT A;  1FC4 A;  2VLH A;  4A72 A;  5KTB A;  1SFF A;  1LC5 A;  2AAT A;  1KKJ A;  4PFN A;  1SPA A;  2CH1 A;  4L0O A;  3TFT A;  4FL0 A;  1SF2 A;  4A0R A;  3T32 A;  3H9X A;  1KKP A;  3WKS A;  4CXQ A;  2OQX A;  4DBC A;  4RM1 A;  3GSB A;  2GB3 A;  2D65 A;  4WXF A;  4QGR A;  2QSR A;  1MLY A;  4R2N A;  1CQ8 A;  3LVJ A;  3I4J A;  3LVM A;  1MGV A;  1QJ3 A;  4MKJ A;  3NU7 A;  4UHO A;  1S0A A;  2E7U A;  4ZAH A;  2W7D A;  2HUU A;  4IX8 A;  3WY7 A;  1X29 A;  1W7L A;  2BI9 A;  1CJ0 A;  1TOG A;  2DGL A;  3HBX A;  3M5U A;  4IYO A;  1GEX A;  3FRK A;  5EUD A;  1AHG A;  2VMY A;  4M2K A;  2QMA A;  4P7Y A;  4HF8 A;  4XEW A;  1AHF A;  3EIB A;  2BYL A;  3PDB A;  5HDM A;  1AHY A;  1EQB A;  1IAX A;  4R8D A;  1DGD A;  1H0C A;  3L8A A;  4CXR A;  5FT8 A;  1AMQ A;  3RQ1 A;  2AY6 A;  1GC2 A;  2W7I A;  4WLH A;  1JS6 A;  2Q7W A;  3BCX A;  3BCB A;  4P3M A;  2Z9W A;  4Q75 A;  4ADC A;  3E77 A;  3E9K A;  4E77 A;  4LNJ A;  4ZM3 A;  4A6T A;  2CJD A;  1S09 A;  1AHE A;  3ELE A;  3JU7 A;  2HOZ A;  1E5E A;  1O69 A;  2D64 A;  1IX7 A;  1AX4 A;  3AEJ A;  1GD9 A;  3AEL A;  2BIE A;  3EZ1 A;  4OBU A;  1DGE A;  3RUY A;  4BA5 A;  1MDZ A;  3NX3 A;  4XJO A;  1AHX A;  3KE3 A;  9AAT A;  2ORD A;  2F8J A;  3LG0 A;  1UU2 A;  1ASL A;  1BQA A;  5EUE A;  2D63 A;  3AEM C;  3JWA A;  1YIZ A;  1B5P A;  2O7C A;  2VMW A;  3FQ7 A;  1UKJ A;  5EUN A;  3AV7 A;  4ZM4 A;  1LS3 A;  2JG2 A;  1MDX A;  4KAM A;  2YKU A;  3AOV A;  2VGS A;  2VMS A;  1G7X A;  1BJN A;  2CTZ A;  4EFF A;  2C0R A;  4UOY A;  2DKB A;  3VK3 A;  3N4X A;  3FSL A;  4FFC A;  1B4X A;  3K40 A;  3FVS A;  1C9C A;  4OC9 A;  3MAF A;  4IXO A;  3E2Z A;  4RKC A;  3PD6 A;  2OKK A;  4MY5 A;  4UHM A;  3P6K A;  2CFB A;  3EI8 A;  1ART A;  1WYV B;  2Z9V A;  3ACZ A;  2C7T A;  3QM2 A;  2E7J A;  4JEX A;  3TQX A;  1TOI A;  5M49 A;  4A6R A;  2AY5 A;  4MKK A;  1WYU A;  4ISY A;  4XAU A;  3ZRP A;  2JJH A;  4PIW A;  1BT4 A;  5F8V A;  1DTY A;  2EGY A;  2FYF A;  3CQ4 A;  3Q8N A;  2W7G A;  3R9A A;  4W8I A;  4A0H A;  2WB6 A;  1GCK A;  3ELP A;  3ISL A;  2OGE A;  3FTB A;  1EJI A;  5G2Q A;  2VMR A;  3NUB A;  4WLJ A;  4E3Q A;  1U08 A;  3WCO A;  3ZZK A;  1I41 A;  1AKC A;  1GC4 A;  1CL1 A;  3LVL B;  1BJO A;  2D7Z A;  4ZWM A;  4ADE A;  1UU0 A;  3VK2 A;  3K7Y A;  5LH9 A;  2GMS A;  3PIU A;  3JTX A;  2FQ6 A;  2OAT A;  2X5D A;  2W7J A;  3BWN C;  3I16 A;  3QBO A;  4XJL A;  3RBL A;  2HOR A;  1T3I A;  1BS0 A;  1C4K A;  3NYT A;  3G8M A;  1I43 A;  3MAD A;  1V2E A;  1WKH A;  2G7J A;  1CS1 A;  2R5C A;  1SZS A;  2YCT A;  5EQC A;  4NOG A;  3QI6 A;  3B1E A;  3PJ0 A;  5EFS A;  3N0L A;  1ASC A;  1GEW A;  1D2F A;  2CAN A;  2D5Y A;  4ZAS A;  1ZOB A;  3EI9 A;  2WKA A;  1UU1 A;  3FZ7 A;  1AKB A;  2EPJ A;  2OGA A;  1X2A A;  1AAM A;  3ZRQ A;  4TMR A;  3FDB A;  4H63 Q;  1MLZ A;  4UQV A;  4BHD A;  2CY8 A;  3JW9 A;  3R4T A;  1ORD A;  3H7F A;  1IBJ A;  5G4I A;  3UWC A;  3QPG A;  4U2H A;  2Z1Y A;  3WKR A;  3NYS A;  1PMO A;  2D7Y A;  3BWN A;  3FQA A;  3A8U X;  2QLR A;  2O0R A;  5E4Z A;  4IXZ A;  4F5M A;  4E1O A;  3HQT A;  1WYT B;  4A00 A;  5LHA A;  4MQQ A;  5G09 A;  4IW7 A;  1ARH A;  4JE5 A;  4LW4 A;  4XJM A;  3LVK A;  4K05 A;  1DJE A;  4RJ0 A;  5M4D A;  1X0M A;  1TAR A;  2HUF A;  4I8A A;  4WB0 A;  2YKX A;  4PFF A;  1X28 A;  1AMR A;  2W8V A;  4OYT A;  2W8J A;  2Z67 A;  1BJ4 A;  3EZS A;  1KMJ A;  5DX5 A;  3MC6 A;  3HL2 A;  1YJZ A;  1TOE A;  2VMN A;  5HHY A;  2KFP A;  2CIN A;  2FNI A;  3HT4 A;  3VOM A;  1IX6 A;  2D61 A;  5M4B A;  3NU8 A;  2ZSL A;  1TOK A;  1ASM A;  1GC3 A;  5G4J A;  2AY2 A;  4AZJ A;  4ZDO A;  3NTJ A;  2ZUK A;  3GJU A;  2VI9 A;  4ADB A;  4Y0I A;  5FT5 A;  1QIS A;  1DJ9 A;  3RCH B;  3BB8 A;  4ATP A;  1QIT A;  5E3K A;  2D66 A;  3HVY A;  1EG5 A;  2QA3 A;  3ECD A;  4WYF A;  4B9B A;  5C6U A;  2DR1 A;  3GBX A;  1P3W A;  1AJS A;  1G4V A;  3B8X A;  3TFU A;  2AEU A;  3GR9 A;  3W1J A;  3UAK A;  2PO3 A;  4MQR A;  4IXS A;  3HLM A;  4WYG A;  1I29 A;  3IF2 A;  1OXP A;  3DR4 A;  2ZJG A;  5EIG B;  3G7Q A;  4RKD A;  1DFO A;  2FN6 A;  2AEV A;  3A9Y A;  1GC0 A;  4XJP A;  2VMV A;  4WYC A;  3HMU A;  2YOB A;  3GWP A;  1Z3Z A;  1IUG A;  3ASA A;  1M4N A;  2HP2 A;  1W23 A;  3AEN B;  2BWP A;  3MEB A;  3KKI A;  1LW5 A;  4JEW A;  3AEP A;  8AAT A;  1N8P A;  3GZD C;  3E2Y A;  5G2P A;  5K8B A;  1B9H A;  1KMK A;  2VYC A;  4OMA A;  4WP0 A;  4AO4 A;  1QJ5 A;  3DU4 A;  2BIA A;  2EH6 A;  3WX9 A;  4AZK A;  4ZSW A;  2DKJ A;  2ZY3 A;  4M2M A;  4J8L A;  3A9Z A;  2W7L A;  3WGC A;  3F9T A;  4OT8 A;  3IHJ A;  4BQ0 A;  1LC8 A;  2HOY A;  2OKJ A;  3B1C A;  3BWO A;  3EI6 A;  1OHV A;  4LW2 A;  1ELU A;  2GSA A;  1OAT A;  1TPL A;  3A2B A;  4MGR A;  4A0F A;  2YKV A;  4ADD A;  1ELQ A;  4KYO A;  4MSO A;  2XH1 A;  4R5F A;  3FCR A;  2VGW A;  4F5J A;  3K28 A;  2XBN A;  1CQ7 A;  3CBF A;  2VIA A;  2W7E A;  3AEM A;  1B9I A;  1AIC A;  1AMA A;  1ASD A;  1W7N A;  1PFF A;  2TPL A;  2AY8 A;  3AOW A;  1PG8 A;  1RVU A;  1AY4 A;  2X5F A;  4ITX A;  5BJ3 A;  1ASA A;  1J04 A;  4ZSY A;  4GE9 A;  3EUC A;  3N4S A;  4IY7 A;  1DJU A;  2O1B A;  1QIR A;  1FG3 A;  1TAS A;  3KGX A;  4F5L A;  4IYO B;  1AKA A;  2VLF A;  4K2B A;  2EYQ A;  1Z7D A;  1W3U A;  1B5O A;  3B46 A;  5D5S A;  1GDE A;  4XK1 A;  1M0N A;  4W1X A;  2W8W A;  3MKJ A;  2ZC0 A;  4TN4 A;  2Z9U A;  3PDB B;  2JJG A;  1M32 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...