3AOVA

Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
404
structure length
404
Chain Sequence
SMLGDVERFFSKKALEMRASEVRELLKLVETSDIISLAGGLPNPKTFPKEIIRDILVEIMEKYADKALQYGTTKGFTPLRETLMKWLGKRYGISQDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYIQIPLDDEGMKVEILEEKLKELKSQGKKVKVVYTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRYSGNPEKKIKALDNEGRVIYLGTFSKILAPGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGYLEKHIPEIRKFYKPRRDAMLEALEEFMPEGVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKKGVAYVPGEAFYAHRDVKNTMRLNFTYVDEDKIMEGIKRLAETIKEELKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein PH0207
publication title Characterization of kynurenine aminotransferase from hyperthermophilic archaeon: enzymatic activity for conversion to kynurenic acid is allosterically regulated by alpha-ketoglutaric acid cooperatively with kynurenine
rcsb
source organism Pyrococcus horikoshii
molecule tags Transferase
total genus 148
structure length 404
sequence length 404
chains with identical sequence C
ec nomenclature ec 2.6.1.7: Kynurenine--oxoglutarate transaminase.
pdb deposition date 2010-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3aovA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3aovA01
4K2MA 2TPLA 1YIZA 3EZ1A 4AZJA 2VMUA 1MLZA 1C4KA 2VIAA 2W7FA 2EH6A 2FN6A 3EIAA 4RITA 1AX4A 1LC8A 1AKAA 2QBTA 3MADA 3PD6A 3Q8NA 4A0GA 1PG8A 1V2FA 4B9BA 1WYVA 3PD6B 4ZDPA 1N31A 2GMSA 4GE7A 3HT4A 4UHNA 4GRXA 4IX8A 2VGVA 3HL2A 1ARIA 1CL1A 3NNKA 1DFOA 4LC3A 4ZDLA 4WYGA 2D64A 4B98A 2O1BA 4TN4A 1EJIA 2ZC0A 1EQBA 3MC6C 2WK7A 1AHFA 4F4EA 2ZSMA 3E2FA 2DGMA 2Z67A 3B1EA 4ADDA 1M6SA 2AY2A 1IUGA 3BS8A 1BJWA 4A6RA 1BQAA 2D61A 3VAXA 3AEJC 3GR9A 2VGSA 3PAAA 2G6WA 2VGUA 3JZLA 1W3UA 2JISA 1AHXA 1XEYA 2BWOA 4BMKA 1C0NA 1OXPA 2EZ2A 4WBTA 1FC4A 5EIGA 3A2BA 1AHEA 1MAQA 3LY1A 2E7IA 2D7ZA 4GE4A 4O6ZA 3TCMA 3FQ8A 4CXRA 1IBJA 2CINA 1SZUA 4N0WA 1AJRA 1I29A 4W1XA 3WX9A 3DR7A 2VI8A 3DR4A 1FG3A 3HBXA 1TOJA 4JF0A 4FFCA 3CBFA 2HUUA 4A0FA 3ASBA 2QLRA 1VP4A 2HOYA 3DYDA 3QN6A 4ZM3A 2W8TA 1SZSA 3QBOA 1W23A 4ISYA 4ITGA 1OHVA 5D95A 1SVVA 3E2ZB 4Q31A 1ASCA 1JS3A 4EU1A 3NTJA 2QA3A 3HDOA 1YNUA 3B1DA 1D7RA 2VMXA 3G0TA 1X2AA 5EUNA 2QB2A 1AY8A 1V2EA 4Q75A 2VMTA 3AEPA 2YKUA 1GEWA 2HUFA 5AX8A 1MLYA 4F5FA 3B1CA 4ZWMA 4M2MA 5M4DA 3G8MA 1G7XA 2W8UA 1LK9A 3FQ7A 3F0HA 1CQ7A 1RVYA 1J04A 2ZY5A 2ZUKA 2D66A 2Z9VA 4BHDA 3HLMA 3FVUA 3B46A 5E3KA 2X5FA 3FDDA 2YOBA 4UHMA 1GC0A 3A8UX 3QGUA 4R5ZA 3LVKA 4BA5A 2VIBA 3P1TA 4KYOA 1Y4IA 2EPJA 3AENA 3ZZKA 1YJSA 2FM1A 3T32A 3NUBA 4MKKA 4R2NA 3ACZA 3QM2A 4CBSA 3FQAA 1D2FA 2R5EA 1SPAA 3A9YA 1AJSA 3D6KA 1AMSA 5HDMA 3DXVA 1O62A 1OATA 1AJSB 4ITXA 1AHGA 3M5UA 4J8LA 3NYSA 1X29A 3ISLA 4RLGA 2AY1A 3EI7A 4XJMA 2CY8A 4J5UA 3TQXA 2O7CA 1C7GA 2VYCA 4ZASA 3DC1A 3KE3A 2R5CB 1AICA 1IX7A 2W8WA 1ASLA 5EUEA 4UQVA 2EGYA 2V0YA 4CVQA 3N5MA 2E7JA 1ECXA 3ATHA 1MDXA 4WLHA 3NDNA 3UAKA 3EUCA 3QI6A 5FT6A 1M32A 3G7QA 4A0RA 3OKSA 2W7EA 1LC5A 2AY7A 4WXGA 4ADCA 1AKBA 4ATPA 2ZY3A 3R4TA 5EFSA 3ZRPA 3NUIA 4W91A 1OHWA 3AATA 2GQNA 2EO5A 3NX3A 1CZEA 2AY5A 2BYLA 3RUYA 5M49A 2YRRA 3P6KA 5K8BA 1QJ5A 2CH2A 3W1HA 1I41A 1RV3A 3RI6A 1ASDA 1C9CA 4M2JA 3FD0A 2DOUA 3CQ5A 4R8DA 1WKGA 4GDYA 4AH3A 3MAUA 4JEYA 2GMUA 5D5SA 1BQDA 2AY6A 3PIUA 3UE8A 5FT5A 4WXFA 2W7HA 1O61A 3WY7A 2C81A 2YKXA 1ORDA 2BI2A 5G2PA 1AAMA 1O69A 5DJ1A 1H1CA 1CQ8A 3E9KA 1G4XA 2VMYA 3F9TA 2X5DA 3NRAA 4ZSWA 1GEYA 3ZRQA 3AEOA 9AATA 1CL2A 1BJOA 3BWNA 3L44A 4XK1A 2VGTA 2HOZA 4PFFA 1BJOB 1LW5A 2VMQA 2OKKA 3B8XA 2ORDA 4XJOA 7AATA 4KAMA 4JE5A 4F5GA 4WYAA 3BWOA 3FFHA 4WD2A 1M7YA 2NMPA 1DJ9A 2Z1ZA 3II0A 3DXWA 3JW9A 4RKCA 4BA4A 2CJHA 3IF2A 3PJ0A 3EZSA 2VMOA 1DKAA 1W7MA 1AY5A 1TPLA 3ELEA 4IW7A 4MSOA 1ZC9A 1S08A 3ZRRA 1CZCA 1SF2A 1SZKA 2BIGA 2VLHA 3BCXA 3PDBB 3LG0A 4I8AA 1V72A 3LVLB 4JEVA 2GSAA 1S06A 1ASMA 2W8JA 4HVKA 1N8PA 5DX5A 2R2NA 4RJ0A 3NU7A 2PB2A 1ARHA 2VLFA 3DZZA 4MGRA 3PA9A 1VJOA 4UOYA 3COGA 2CTZA 3BN1A 3E2ZA 1W7LA 1CS1A 3USFA 2AATA 4L0OA 4MKJA 4ZM4A 4OBUA 1I43A 1TOEA 1D7VA 4MQQA 1S09A 4GEBA 3R9AA 2QB3A 2AY9A 2XBNA 4H51A 1S07A 2JG2A 3PGYA 2BI1A 1GCKA 1ELQA 1GC2A 1ZOBA 4WB0B 4WXBA 4P7YA 4OTLA 2C0RA 4XAUA 3GZDA 2DR1A 3WGBA 4E1OA 3CAIA 4F5MA 5LH9A 3K40A 2OKJA 2Z9XA 1E5FA 1GDEA 3VK2A 1MDZA 3RBLA 4OYTA 1D7SA 1OXOA 1M4NA 1YAAA 2D65A 2OQXA 1E5EA 4F5JA 1DGDA 1TOKA 3JU7A 2C7TA 3AELA 2W7MA 3WCNA 4W1WA 3WGCA 1TARA 2QMAA 2VMRA 1YIYA 1W7NA 1X28A 3DU4A 3ASAA 3TATA 1UU0A 4BQ0A 1BS0A 4GSAA 4ZAHA 3KKIA 3N0LA 2BYJA 1TOIA 2GB3A 2ZP7A 4IY7A 4UHOA 5F9SA 4QGRA 1I48A 2ZY2A 1GD9A 2YRIA 3NYUA 3H14A 4MY5A 5F8VA 1KKJA 3CQ6A 3E77A 2HORA 1ASGA 1UU1A 4TV7A 4FL0A 3FZ8A 2VGWA 2R5CA 1B4XA 1T3IA 3FZ7A 2VMPA 3GZCA 2W7IA 4ZSYA 2Z1YA 3KGXA 3MKJA 5LHAA 2FYFA 3FDBA 1LKCA 1ZODA 3F6TA 3MBBA 4EMYA 2W7DA 1AMRA 4RAEA 2V1PA 1IVRA 2WK8A 2BI3A 3PDXA 4RKDA 1CJ0A 3BC8A 5E4ZA 2YCTA 1SFFA 4LNLA 2JJHA 3VK4A 4RM1A 1TASA 1ELUA 1TOGA 1B5OA 3GWPA 1B9IA 4PFNA 1QZ9A 2AY8A 2C44A 2DGKA 3BWNC 1ASAA 2XH1A 2BWNA 2BI5A 2AY3A 2VMVA 2W7GA 4JE5D 1AKCA 1ARSA 1KL2A 4LW2A 3WKSA 2E7UA 1KKPA 3JWBA 4MQRA 4XJPA 1IX8A 1WYUA 3JTXA 1GEXA 4JEXA 3IHJA 4A6UA 1WYUB 1AAWA 2E54A 3K28A 4OCAA 4ADEA 2AEUA 5BJ3A 2YCPA 1J32A 5BJ4A 3LVMA 4WYDA 3H7FA 5EQCA 1U08A 2EZ1A 4F5IA 4R5FA 1C7NA 1YJZA 3FRKA 1QIRA 3I16A 4U1TA 1ARTA 5FT8A 2DGLA 4AOAA 4CXQA 4OBVA 1Z3ZA 1D7UA 4IXZA 3GETA 1LS3A 2BKWA 3EI8A 5DB5A 5G0AA 3BB8A 5HHYA 4AO9A 4E77A 1DGEA 4N0BA 4E3QA 4DQ6A 1M0NA 2CANA 3AOWA 3AV7A 3GSBA 2ZY4A 3W1IA 4WYEA 3JWAA 3EIBA 1ASBA 4F5KA 1KMKA 1EG5A 1Z7DA 3DODA 2BI9A 3FVSA 5G2QA 2OATA 1AIBA 1O4SA 2Z20A 1VEFA 4A6TA 1GC3A 2AY4A 1DJUA 1WYVB 1AIAA 3RCHA 1JS6A 2VMWA 3AEMA 2W7JA 3PDBA 3RCHB 4JEZA 1TATA 1DTYA 3FCRA 3LV2A 4XJLA 3HMUA 4EFFA 4EB5A 4K2BA 3I5TA 2CJGA 5EAAA 1P3WA 2HZPA 4F5HA 3EI9A 3GZDC 3I4JA 4IYOA 1X0MA 4DGTA 5G09A 4IYOB 5C6UA 5EUDA 4OT8A 1YOOA 3FVXA 4PVFA 1ASNA 2Z61A 3WCOA 4IXOA 4XEWA 4LW4A 4P3MA 5DJ9A 2DKJA 4W5KA 1OHYA 1G7WA 3TFTA 2JGTA 4RJYA 3K7YA 2OGEA 1PMMA 2X3LA 1AMQA 2OGAA 2VMZA 3L8AA 2VMNA 3ELPA 3W1JA 1WKHA 4WLJA 3EI5A 5EIGB 1ARGA 3UWCA 3GBXA 1CQ6A 2X8UA 1BT4A 1JF9A 4CBRA 3DRDA 1M0QA 2WKAA 2ZSLA 4KXKA 2VGZA 4ATQA 4WB0A 3FSLA 1FG7A 4IXSA 4WYCA 4K2IA 2F8JA 4AZKA 2FQ6A 8AATA 3CQ4A 5FT4A 2D7YA 1H0CA 3BCBA 1ASEA 4W1VA 2Z9WA 1RV4A 5IWQA 1AMAA 3AOVA 5I92A 1M0PA 3MC6A 3HVYA 1AY4A 2VMSA 1QJ3A 3RBFA 3QHXA 1QGNA 3RQ1A 3VOMA 1RVUA 2ZYJA 2W7LA 1PMOA 2CH1A 2D63A 4LNJA 5G4JA 3TFUA 1UU2A 3AEJA 1BKGA 3E6GA 1ASFA 4A00A 1JG8A 4LNMA 2CJDA 4ZWVA 3NU8A 1M0OA 2CSTA 2ZJGA 3VK3A 1UKJA 5E5IA 2CFBA 5TF5A 3FZ6A 4XQ2A 1IAYA 4Y0IA 2JJEA 1B5PA 5EAVA 2AEVA 4Q76A 5M4BA 2BIEA 2BHXA 1IX6A 1G4VA 3E2YA 4GE9A 4Q6RA 3VP6A 4F5LA 2CB1A 4A72A 1V2DA 1XI9A 2FNIA 1B8GA 5G4IA 5M46A 1IAXA 4NOGA 3WKRA 2DKBA 3WZFA 3MAFA 4MQPA 1LW4A 2BWPA 4E3RA 3MAFB 2FNUA 1WSTA 4OMAA 3AENB 4W8IA 2WK9A 2YKVA 1C7OA 5HXXA 4RIZA 3A9ZA 4Y0HA 5JAYA 3HQTA 1GBNA 3MEBA 4OC9A 4ZLVA 4WP0A 2RFVA 2HUIA 1LC7A 2HP1A 3LVJA 4U2HA 2R0TA 2PO3A 3FFRA 2W8VA 2YKYA 4JEWA 1MAPA 2Q7WA 4DBCA 1KMJA 3ZZJA 3EI6A 3OP7A 2JJFA 1N2TA 1GC4A 1S0AA 1QISA 3LWSA 3BCAA 4JF1A 1YJYA 3QPGA 4M2KA 2YCNA 1MGVA 4TMRA 4ZDOA 1BJNA 1KL1A 2PB0A 2HP2A 2VI9A 1BJ4A 4Y0DA 4EB7A 1PFFA 1IJIA 1MDOA 2JJGA 3AEMC 3GJUA 4ADBA 1BW0A 5J8QA 3FTBA 3BV0A 4A0HA 3A9XA 1B9HA 2Z9UA 1WYTA 1DJEA 2D5YA 2YHKA 1WYTB 3KGWA 3ECDA 3N75A 2HOXA 3NYTA 3PPLA 4WYFA 4AO4A 1QITA 2BIAA 4HF8A 3WLXA 4PIWA 3FKDA 2O0RA 2W7KA 1AHYA
chains in the Genus database with same CATH superfamily
4K2MA 2TPLA 1YIZA 3EZ1A 4AZJA 2VMUA 1MLZA 1C4KA 1KAFA 2VIAA 2W7FA 2EH6A 2FN6A 3EIAA 4RITA 1AX4A 1LC8A 1AKAA 2QBTA 3MADA 3PD6A 3Q8NA 4A0GA 1PG8A 1V2FA 4B9BA 1WYVA 3PD6B 4ZDPA 1N31A 2GMSA 4GE7A 3HT4A 4UHNA 4GRXA 4IX8A 2VGVA 3HL2A 1ARIA 1CL1A 3NNKA 1DFOA 4LC3A 4ZDLA 4WYGA 2D64A 4B98A 2O1BA 4TN4A 1EJIA 2ZC0A 1EQBA 3MC6C 2WK7A 1AHFA 4F4EA 2ZSMA 3E2FA 2DGMA 2Z67A 3B1EA 4ADDA 1M6SA 2AY2A 1IUGA 3BS8A 1BJWA 4A6RA 1BQAA 2D61A 3VAXA 3AEJC 3GR9A 2VGSA 3PAAA 2G6WA 2VGUA 3JZLA 1W3UA 2JISA 1AHXA 1XEYA 2BWOA 4BMKA 1C0NA 1OXPA 2EZ2A 4WBTA 1FC4A 5EIGA 3A2BA 1AHEA 1MAQA 3LY1A 2E7IA 2D7ZA 4GE4A 4O6ZA 3TCMA 3FQ8A 4CXRA 1IBJA 2CINA 1SZUA 4N0WA 1AJRA 1I29A 4W1XA 3WX9A 3DR7A 2VI8A 3DR4A 1FG3A 3HBXA 1TOJA 4JF0A 4FFCA 3CBFA 2HUUA 4A0FA 3ASBA 2QLRA 1VP4A 2HOYA 3DYDA 3QN6A 4ZM3A 2W8TA 1SZSA 3QBOA 1W23A 4ISYA 4ITGA 1OHVA 5D95A 1SVVA 3E2ZB 4Q31A 1ASCA 1JS3A 4EU1A 3NTJA 2QA3A 3HDOA 1YNUA 3B1DA 1D7RA 2VMXA 3G0TA 1X2AA 5EUNA 2QB2A 1AY8A 3N4SA 1V2EA 4Q75A 2VMTA 3AEPA 2YKUA 1GEWA 2HUFA 5AX8A 1MLYA 4F5FA 3B1CA 4ZWMA 4M2MA 5M4DA 3G8MA 1G7XA 2W8UA 1LK9A 3FQ7A 3F0HA 1CQ7A 1RVYA 1J04A 2ZY5A 2ZUKA 2D66A 2Z9VA 4BHDA 3HLMA 3FVUA 3B46A 5E3KA 2X5FA 3FDDA 2YOBA 4UHMA 1GC0A 3A8UX 3QGUA 4R5ZA 3LVKA 4BA5A 2VIBA 3P1TA 4KYOA 1Y4IA 2EPJA 3AENA 3ZZKA 1YJSA 2FM1A 3T32A 3NUBA 4MKKA 4R2NA 3ACZA 3QM2A 4CBSA 3FQAA 1D2FA 2R5EA 1SPAA 3A9YA 1AJSA 3D6KA 1AMSA 5HDMA 3DXVA 1O62A 1OATA 1AJSB 4ITXA 1AHGA 3M5UA 4J8LA 3NYSA 1X29A 3ISLA 4RLGA 2AY1A 3EI7A 4XJMA 2CY8A 4J5UA 3TQXA 2O7CA 1C7GA 2VYCA 4ZASA 2EYQA 3DC1A 3KE3A 2R5CB 1AICA 1IX7A 2W8WA 1ASLA 5EUEA 4UQVA 2EGYA 2V0YA 4CVQA 3N5MA 2E7JA 1ECXA 3ATHA 1MDXA 4WLHA 3NDNA 3UAKA 3EUCA 3QI6A 5FT6A 1M32A 3G7QA 4A0RA 3OKSA 2W7EA 1LC5A 2AY7A 4WXGA 4ADCA 1AKBA 4ATPA 2ZY3A 3R4TA 5EFSA 3ZRPA 3NUIA 4W91A 1OHWA 3AATA 2GQNA 2EO5A 3NX3A 1CZEA 2AY5A 2BYLA 3RUYA 5M49A 2YRRA 3P6KA 5K8BA 1QJ5A 2CH2A 3W1HA 1I41A 1RV3A 3RI6A 1ASDA 1C9CA 4M2JA 3FD0A 2DOUA 3CQ5A 4R8DA 1WKGA 4GDYA 4AH3A 3MAUA 4JEYA 2G7JA 2GMUA 5D5SA 1BQDA 2AY6A 3PIUA 3UE8A 5FT5A 4WXFA 2W7HA 1O61A 3WY7A 2C81A 2YKXA 1ORDA 3H9XA 2BI2A 5G2PA 1AAMA 1O69A 5DJ1A 1H1CA 1CQ8A 3E9KA 1G4XA 2VMYA 3F9TA 2X5DA 3NRAA 4ZSWA 1GEYA 3ZRQA 3AEOA 9AATA 1CL2A 1BJOA 3BWNA 3L44A 4XK1A 2VGTA 2HOZA 4PFFA 1BJOB 1LW5A 2VMQA 2OKKA 3B8XA 2ORDA 4XJOA 7AATA 4KAMA 4JE5A 4F5GA 4WYAA 3BWOA 3FFHA 4WD2A 1M7YA 2NMPA 1DJ9A 2Z1ZA 3II0A 3DXWA 3JW9A 4RKCA 4BA4A 2CJHA 3IF2A 3PJ0A 3EZSA 2VMOA 1DKAA 1W7MA 1AY5A 1TPLA 3ELEA 4IW7A 4MSOA 3N7NA 1ZC9A 1S08A 3ZRRA 1CZCA 1SF2A 1SZKA 2BIGA 2VLHA 3BCXA 3PDBB 3LG0A 4I8AA 3N4RA 1V72A 3LVLB 4JEVA 2GSAA 1S06A 1ASMA 2W8JA 4HVKA 1N8PA 5DX5A 2R2NA 4RJ0A 3NU7A 2PB2A 1ARHA 2VLFA 3DZZA 4MGRA 3PA9A 1VJOA 4UOYA 3COGA 2CTZA 5KTBA 3BN1A 3E2ZA 1W7LA 1CS1A 3USFA 2AATA 4L0OA 4MKJA 4ZM4A 4OBUA 1I43A 1TOEA 1D7VA 4MQQA 1S09A 4GEBA 3R9AA 2QB3A 2AY9A 2XBNA 4H51A 1S07A 2JG2A 3PGYA 2BI1A 1GCKA 1ELQA 1GC2A 1ZOBA 4WB0B 4WXBA 4P7YA 4OTLA 2C0RA 4XAUA 3GZDA 2DR1A 3WGBA 4E1OA 3CAIA 4F5MA 5LH9A 3K40A 2OKJA 2Z9XA 1E5FA 1GDEA 3VK2A 1MDZA 3RBLA 4OYTA 1D7SA 1OXOA 1M4NA 1YAAA 2D65A 2OQXA 2A1VA 1E5EA 4F5JA 1DGDA 1TOKA 3JU7A 2C7TA 3AELA 2W7MA 3WCNA 4W1WA 3WGCA 1TARA 2QMAA 2VMRA 1YIYA 1W7NA 1X28A 3DU4A 3ASAA 3TATA 1UU0A 4BQ0A 1BS0A 4GSAA 4ZAHA 3KKIA 3N0LA 2BYJA 1TOIA 2GB3A 2ZP7A 4IY7A 4UHOA 5F9SA 4QGRA 1I48A 2ZY2A 1GD9A 2YRIA 3NYUA 3H14A 4MY5A 5F8VA 1KKJA 3CQ6A 3E77A 2HORA 1ASGA 1UU1A 4TV7A 4FL0A 3FZ8A 2VGWA 2R5CA 1B4XA 1T3IA 3FZ7A 2VMPA 3GZCA 2W7IA 4ZSYA 2Z1YA 3KGXA 3MKJA 5LHAA 2FYFA 3FDBA 1LKCA 1ZODA 3F6TA 3MBBA 4EMYA 2W7DA 1AMRA 4RAEA 2V1PA 1IVRA 2WK8A 2BI3A 3PDXA 4RKDA 1CJ0A 3BC8A 5E4ZA 2YCTA 1SFFA 4LNLA 2JJHA 3VK4A 2KFPA 4RM1A 1TASA 1ELUA 1TOGA 1B5OA 3GWPA 1B9IA 4PFNA 1QZ9A 2AY8A 2C44A 2DGKA 3BWNC 1ASAA 2XH1A 2BWNA 2BI5A 2AY3A 2VMVA 2W7GA 4JE5D 1AKCA 1ARSA 1KL2A 4LW2A 3WKSA 2E7UA 1KKPA 3JWBA 4MQRA 4XJPA 1IX8A 1WYUA 3JTXA 1GEXA 4JEXA 3IHJA 4A6UA 1WYUB 1AAWA 2E54A 3K28A 4OCAA 4ADEA 2AEUA 5BJ3A 2YCPA 1J32A 5BJ4A 3LVMA 4WYDA 3H7FA 5EQCA 1U08A 2EZ1A 4F5IA 4R5FA 3N4XA 1C7NA 1YJZA 3FRKA 1QIRA 3I16A 4U1TA 1ARTA 5FT8A 2DGLA 4AOAA 4CXQA 4OBVA 1Z3ZA 1D7UA 4IXZA 3GETA 1LS3A 2BKWA 3EI8A 5DB5A 5G0AA 3BB8A 5HHYA 4AO9A 4E77A 1DGEA 4N0BA 4E3QA 4DQ6A 1M0NA 2CANA 3AOWA 3AV7A 3GSBA 2ZY4A 3W1IA 4WYEA 3JWAA 4H63Q 3EIBA 1ASBA 4F5KA 1KMKA 1EG5A 1Z7DA 3DODA 2BI9A 3FVSA 5G2QA 2OATA 1AIBA 1O4SA 2Z20A 1VEFA 4A6TA 1GC3A 2AY4A 1DJUA 1WYVB 1AIAA 3RCHA 1JS6A 2VMWA 3AEMA 2W7JA 3PDBA 3RCHB 4JEZA 1TATA 1DTYA 3FCRA 3LV2A 4XJLA 3HMUA 4EFFA 4EB5A 4K2BA 3I5TA 2CJGA 5EAAA 1P3WA 2HZPA 4F5HA 3EI9A 3GZDC 3I4JA 4IYOA 1X0MA 4DGTA 5G09A 4IYOB 5C6UA 5EUDA 4OT8A 1YOOA 3FVXA 4PVFA 1ASNA 2Z61A 3WCOA 4IXOA 4XEWA 4LW4A 4P3MA 4K05A 5DJ9A 2DKJA 4W5KA 1OHYA 1G7WA 3TFTA 2JGTA 4RJYA 3K7YA 2OGEA 1PMMA 2X3LA 1AMQA 2OGAA 2VMZA 3L8AA 2WB6A 2VMNA 3ELPA 3W1JA 1WKHA 4WLJA 3EI5A 5EIGB 1ARGA 3UWCA 3GBXA 1CQ6A 2X8UA 1BT4A 1JF9A 4CBRA 3DRDA 1M0QA 2WKAA 2ZSLA 4KXKA 2VGZA 4ATQA 4WB0A 3FSLA 1FG7A 4IXSA 4WYCA 4K2IA 2F8JA 4AZKA 2FQ6A 8AATA 3CQ4A 5FT4A 2D7YA 1H0CA 3BCBA 1ASEA 4W1VA 2Z9WA 1RV4A 5IWQA 1AMAA 3AOVA 5I92A 1M0PA 3MC6A 3HVYA 1AY4A 2VMSA 1QJ3A 3RBFA 3QHXA 1QGNA 3RQ1A 3VOMA 1RVUA 2ZYJA 2W7LA 1PMOA 2CH1A 2D63A 4LNJA 5G4JA 3TFUA 1UU2A 3AEJA 1BKGA 3E6GA 1ASFA 4A00A 1JG8A 4LNMA 2CJDA 4ZWVA 3NU8A 1M0OA 2CSTA 2ZJGA 3VK3A 1UKJA 5E5IA 2CFBA 5TF5A 3FZ6A 4XQ2A 1IAYA 4Y0IA 2JJEA 1B5PA 5EAVA 2AEVA 4Q76A 5M4BA 2BIEA 2BHXA 1IX6A 1G4VA 3E2YA 4GE9A 4Q6RA 3VP6A 4F5LA 2CB1A 2QSRA 4A72A 1V2DA 1XI9A 2FNIA 1B8GA 5G4IA 5M46A 1IAXA 4NOGA 3WKRA 2DKBA 3WZFA 3MAFA 4MQPA 1LW4A 2BWPA 4E3RA 3MAFB 2FNUA 1WSTA 4OMAA 3AENB 4W8IA 2WK9A 2YKVA 1C7OA 5HXXA 4RIZA 3A9ZA 4Y0HA 5JAYA 3HQTA 1GBNA 3MEBA 4OC9A 4ZLVA 4WP0A 2RFVA 2HUIA 1LC7A 2HP1A 3LVJA 4U2HA 2R0TA 2PO3A 3FFRA 2W8VA 2YKYA 4JEWA 1MAPA 2Q7WA 4DBCA 1KMJA 3ZZJA 3EI6A 3OP7A 2JJFA 1N2TA 1GC4A 1S0AA 1QISA 3LWSA 3BCAA 4JF1A 1YJYA 3QPGA 4M2KA 2YCNA 1MGVA 4TMRA 4ZDOA 1BJNA 1KL1A 2PB0A 2HP2A 2VI9A 1BJ4A 4Y0DA 4EB7A 2FKIA 1PFFA 1IJIA 1MDOA 2JJGA 3AEMC 3GJUA 4ADBA 1BW0A 5J8QA 3FTBA 3BV0A 4A0HA 3A9XA 1B9HA 2Z9UA 1WYTA 1DJEA 2D5YA 2YHKA 1WYTB 3KGWA 3ECDA 3N75A 2HOXA 3NYTA 3PPLA 4WYFA 4AO4A 1QITA 2BIAA 4HF8A 3WLXA 4PIWA 3FKDA 2O0RA 2W7KA 1AHYA
chains in the Genus database with same CATH topology
4K2MA 2TPLA 1YIZA 3EZ1A 4AZJA 2VMUA 1MLZA 1C4KA 2VIAA 2W7FA 2EH6A 2FN6A 3EIAA 4RITA 1AX4A 1LC8A 1AKAA 2QBTA 3MADA 3PD6A 3Q8NA 4A0GA 1PG8A 1V2FA 4B9BA 1WYVA 3PD6B 4ZDPA 1N31A 2GMSA 4GE7A 3HT4A 4UHNA 4GRXA 4IX8A 2VGVA 3HL2A 1ARIA 1CL1A 3NNKA 1DFOA 4LC3A 4ZDLA 4WYGA 2D64A 4B98A 2O1BA 4TN4A 1EJIA 2ZC0A 1EQBA 3MC6C 2WK7A 1AHFA 4F4EA 2ZSMA 3E2FA 2DGMA 2Z67A 3B1EA 4ADDA 1M6SA 2AY2A 1IUGA 3BS8A 1BJWA 4A6RA 1BQAA 2D61A 3VAXA 3AEJC 3GR9A 2VGSA 3PAAA 2G6WA 2VGUA 3JZLA 1W3UA 2JISA 1AHXA 1XEYA 2BWOA 4BMKA 1C0NA 1OXPA 2EZ2A 4WBTA 1FC4A 5EIGA 3A2BA 1AHEA 1MAQA 3LY1A 2E7IA 2D7ZA 4GE4A 4O6ZA 3TCMA 3FQ8A 4CXRA 1IBJA 2CINA 1SZUA 4N0WA 1AJRA 1I29A 4W1XA 3WX9A 3DR7A 2VI8A 3DR4A 1FG3A 3HBXA 1TOJA 4JF0A 4FFCA 3CBFA 2HUUA 4A0FA 3ASBA 2QLRA 1VP4A 2HOYA 3DYDA 3QN6A 4ZM3A 2W8TA 1SZSA 3QBOA 1W23A 4ISYA 4ITGA 1OHVA 5D95A 1SVVA 3E2ZB 4Q31A 1ASCA 1JS3A 4EU1A 3NTJA 2QA3A 3HDOA 1YNUA 3B1DA 1D7RA 2VMXA 3G0TA 1X2AA 5EUNA 2QB2A 1AY8A 3N4SA 1V2EA 4Q75A 2VMTA 3AEPA 2YKUA 1GEWA 2HUFA 5AX8A 1MLYA 4F5FA 3B1CA 4ZWMA 4M2MA 5M4DA 3G8MA 1G7XA 2W8UA 1LK9A 3FQ7A 3F0HA 1CQ7A 1RVYA 1J04A 2ZY5A 2ZUKA 2D66A 2Z9VA 4BHDA 3HLMA 3FVUA 3B46A 5E3KA 2X5FA 3FDDA 2YOBA 4UHMA 1GC0A 3A8UX 3QGUA 4R5ZA 3LVKA 4BA5A 2VIBA 3P1TA 4KYOA 1Y4IA 2EPJA 3AENA 3ZZKA 1YJSA 2FM1A 3T32A 3NUBA 4MKKA 4R2NA 3ACZA 3QM2A 4CBSA 3FQAA 1D2FA 2R5EA 1SPAA 3A9YA 1AJSA 3D6KA 1AMSA 5HDMA 3DXVA 1O62A 1OATA 1AJSB 4ITXA 1AHGA 3M5UA 4J8LA 3NYSA 1X29A 3ISLA 4RLGA 2AY1A 3EI7A 4XJMA 2CY8A 4J5UA 3TQXA 2O7CA 1C7GA 2VYCA 4ZASA 2EYQA 3DC1A 3KE3A 2R5CB 1AICA 1IX7A 2W8WA 1ASLA 5EUEA 4UQVA 2EGYA 2V0YA 4CVQA 3N5MA 2E7JA 1ECXA 3ATHA 1MDXA 4WLHA 3NDNA 3UAKA 3EUCA 3QI6A 5FT6A 1M32A 3G7QA 4A0RA 3OKSA 2W7EA 1LC5A 2AY7A 4WXGA 4ADCA 1AKBA 4ATPA 2ZY3A 3R4TA 5EFSA 3ZRPA 3NUIA 4W91A 1OHWA 3AATA 2GQNA 2EO5A 3NX3A 1CZEA 2AY5A 2BYLA 3RUYA 5M49A 2YRRA 3P6KA 5K8BA 1QJ5A 2CH2A 3W1HA 1I41A 1RV3A 3RI6A 1ASDA 1C9CA 4M2JA 3FD0A 2DOUA 3CQ5A 4R8DA 1WKGA 4GDYA 4AH3A 3MAUA 4JEYA 2G7JA 2GMUA 5D5SA 1BQDA 2AY6A 3PIUA 3UE8A 5FT5A 4WXFA 2W7HA 1O61A 3WY7A 2C81A 2YKXA 1ORDA 3H9XA 2BI2A 5G2PA 1AAMA 1O69A 5DJ1A 1H1CA 1CQ8A 3E9KA 1G4XA 2VMYA 3F9TA 2X5DA 3NRAA 4ZSWA 1GEYA 3ZRQA 3AEOA 9AATA 1CL2A 1BJOA 3BWNA 3L44A 4XK1A 2VGTA 2HOZA 4PFFA 1BJOB 1LW5A 2VMQA 2OKKA 3B8XA 2ORDA 4XJOA 7AATA 4KAMA 4JE5A 4F5GA 4WYAA 3BWOA 3FFHA 4WD2A 1M7YA 2NMPA 1DJ9A 2Z1ZA 3II0A 3DXWA 3JW9A 4RKCA 4BA4A 2CJHA 3IF2A 3PJ0A 3EZSA 2VMOA 1DKAA 1W7MA 1AY5A 1TPLA 3ELEA 4IW7A 4MSOA 3N7NA 1ZC9A 1S08A 3ZRRA 1CZCA 1SF2A 1SZKA 2BIGA 2VLHA 3BCXA 3PDBB 3LG0A 4I8AA 3N4RA 1V72A 3LVLB 4JEVA 2GSAA 1S06A 1ASMA 2W8JA 4HVKA 1N8PA 5DX5A 2R2NA 4RJ0A 3NU7A 2PB2A 1ARHA 2VLFA 3DZZA 4MGRA 3PA9A 1VJOA 4UOYA 3COGA 2CTZA 5KTBA 3BN1A 3E2ZA 1W7LA 1CS1A 3USFA 2AATA 4L0OA 4MKJA 4ZM4A 4OBUA 1I43A 1TOEA 1D7VA 4MQQA 1S09A 4GEBA 3R9AA 2QB3A 2AY9A 2XBNA 4H51A 1S07A 2JG2A 3PGYA 2BI1A 1GCKA 1ELQA 1GC2A 1ZOBA 4WB0B 4WXBA 4P7YA 4OTLA 2C0RA 4XAUA 3GZDA 2DR1A 3WGBA 4E1OA 3CAIA 4F5MA 5LH9A 3K40A 2OKJA 2Z9XA 1E5FA 1GDEA 3VK2A 1MDZA 3RBLA 4OYTA 1D7SA 1OXOA 1M4NA 1YAAA 2D65A 2OQXA 2A1VA 1E5EA 4F5JA 1DGDA 1TOKA 3JU7A 2C7TA 3AELA 2W7MA 3WCNA 4W1WA 3WGCA 1TARA 2QMAA 2VMRA 1YIYA 1W7NA 1X28A 3DU4A 3ASAA 3TATA 1UU0A 4BQ0A 1BS0A 4GSAA 4ZAHA 3KKIA 3N0LA 2BYJA 1TOIA 2GB3A 2ZP7A 4IY7A 4UHOA 5F9SA 4QGRA 1I48A 2ZY2A 1GD9A 2YRIA 3NYUA 3H14A 4MY5A 5F8VA 1KKJA 3CQ6A 3E77A 2HORA 1ASGA 1UU1A 4TV7A 4FL0A 3FZ8A 2VGWA 2R5CA 1B4XA 1T3IA 3FZ7A 2VMPA 3GZCA 2W7IA 4ZSYA 2Z1YA 3KGXA 3MKJA 5LHAA 2FYFA 3FDBA 1LKCA 1ZODA 3F6TA 3MBBA 4EMYA 2W7DA 1AMRA 4RAEA 2V1PA 1IVRA 2WK8A 2BI3A 3PDXA 4RKDA 1CJ0A 3BC8A 5E4ZA 2YCTA 1SFFA 4LNLA 2JJHA 3VK4A 2KFPA 4RM1A 1TASA 1ELUA 1TOGA 1B5OA 3GWPA 1B9IA 4PFNA 1QZ9A 2AY8A 2C44A 2DGKA 3BWNC 1ASAA 2XH1A 2BWNA 2BI5A 2AY3A 2VMVA 2W7GA 4JE5D 1AKCA 1ARSA 1KL2A 4LW2A 3WKSA 2E7UA 1KKPA 3JWBA 4MQRA 4XJPA 1IX8A 1WYUA 3JTXA 1GEXA 4JEXA 3IHJA 4A6UA 1WYUB 1AAWA 2E54A 3K28A 4OCAA 4ADEA 2AEUA 5BJ3A 2YCPA 1J32A 5BJ4A 3LVMA 4WYDA 3H7FA 5EQCA 1U08A 2EZ1A 4F5IA 4R5FA 3N4XA 1C7NA 1YJZA 3FRKA 1QIRA 3I16A 4U1TA 1ARTA 5FT8A 2DGLA 4AOAA 4CXQA 4OBVA 1Z3ZA 1D7UA 4IXZA 3GETA 1LS3A 2BKWA 3EI8A 5DB5A 5G0AA 3BB8A 5HHYA 4AO9A 4E77A 1DGEA 4N0BA 4E3QA 4DQ6A 1M0NA 2CANA 3AOWA 3AV7A 3GSBA 2ZY4A 3W1IA 4WYEA 3JWAA 4H63Q 3EIBA 1ASBA 4F5KA 1KMKA 1EG5A 1Z7DA 3DODA 2BI9A 3FVSA 5G2QA 2OATA 1AIBA 1O4SA 2Z20A 1VEFA 4A6TA 1GC3A 2AY4A 1DJUA 1WYVB 1AIAA 3RCHA 1JS6A 2VMWA 3AEMA 2W7JA 3PDBA 3RCHB 4JEZA 1TATA 1DTYA 3FCRA 3LV2A 4XJLA 3HMUA 4EFFA 4EB5A 4K2BA 3I5TA 2CJGA 5EAAA 1P3WA 2HZPA 4F5HA 3EI9A 3GZDC 3I4JA 4IYOA 1X0MA 4DGTA 5G09A 4IYOB 5C6UA 5EUDA 4OT8A 1YOOA 3FVXA 4PVFA 1ASNA 2Z61A 3WCOA 4IXOA 4XEWA 4LW4A 4P3MA 4K05A 5DJ9A 2DKJA 4W5KA 1OHYA 1G7WA 3TFTA 2JGTA 4RJYA 3K7YA 2OGEA 1PMMA 2X3LA 1AMQA 2OGAA 2VMZA 3L8AA 2WB6A 2VMNA 3ELPA 3W1JA 1WKHA 4WLJA 3EI5A 5EIGB 1ARGA 3UWCA 3GBXA 1CQ6A 2X8UA 1BT4A 1JF9A 4CBRA 3DRDA 1M0QA 2WKAA 2ZSLA 4KXKA 2VGZA 4ATQA 4WB0A 3FSLA 1FG7A 4IXSA 4WYCA 4K2IA 2F8JA 4AZKA 2FQ6A 8AATA 3CQ4A 5FT4A 2D7YA 1H0CA 3BCBA 1ASEA 4W1VA 2Z9WA 1RV4A 5IWQA 1AMAA 3AOVA 5I92A 1M0PA 3MC6A 3HVYA 1AY4A 2VMSA 1QJ3A 3RBFA 3QHXA 1QGNA 3RQ1A 3VOMA 1RVUA 2ZYJA 2W7LA 1PMOA 2CH1A 2D63A 4LNJA 5G4JA 3TFUA 1UU2A 3AEJA 1BKGA 3E6GA 1ASFA 4A00A 1JG8A 4LNMA 2CJDA 4ZWVA 3NU8A 1M0OA 2CSTA 2ZJGA 3VK3A 1UKJA 5E5IA 2CFBA 5TF5A 3FZ6A 4XQ2A 1IAYA 4Y0IA 2JJEA 1B5PA 5EAVA 2AEVA 4Q76A 5M4BA 2BIEA 2BHXA 1IX6A 1G4VA 3E2YA 4GE9A 4Q6RA 3VP6A 4F5LA 2CB1A 2QSRA 4A72A 1V2DA 1XI9A 2FNIA 1B8GA 5G4IA 5M46A 1IAXA 4NOGA 3WKRA 2DKBA 3WZFA 3MAFA 4MQPA 1LW4A 2BWPA 4E3RA 3MAFB 2FNUA 1WSTA 4OMAA 3AENB 4W8IA 2WK9A 2YKVA 1C7OA 5HXXA 4RIZA 3A9ZA 4Y0HA 5JAYA 3HQTA 1GBNA 3MEBA 4OC9A 4ZLVA 4WP0A 2RFVA 2HUIA 1LC7A 2HP1A 3LVJA 4U2HA 2R0TA 2PO3A 3FFRA 2W8VA 2YKYA 4JEWA 1MAPA 2Q7WA 4DBCA 1KMJA 3ZZJA 3EI6A 3OP7A 2JJFA 1N2TA 1GC4A 1S0AA 1QISA 3LWSA 3BCAA 4JF1A 1YJYA 3QPGA 4M2KA 2YCNA 1MGVA 4TMRA 4ZDOA 1BJNA 1KL1A 2PB0A 2HP2A 2VI9A 1BJ4A 4Y0DA 4EB7A 2FKIA 1PFFA 1IJIA 1MDOA 2JJGA 3AEMC 3GJUA 4ADBA 1BW0A 5J8QA 3FTBA 3BV0A 4A0HA 3A9XA 1B9HA 2Z9UA 1WYTA 1DJEA 2D5YA 2YHKA 1WYTB 3KGWA 3ECDA 3N75A 2HOXA 3NYTA 3PPLA 4WYFA 4AO4A 1QITA 2BIAA 4HF8A 3WLXA 4PIWA 3FKDA 2O0RA 2W7KA 1AHYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2M A;  2TPL A;  1YIZ A;  3EZ1 A;  4AZJ A;  2VMU A;  1MLZ A;  1C4K A;  2VIA A;  2W7F A;  2EH6 A;  2FN6 A;  3EIA A;  4RIT A;  1AX4 A;  1LC8 A;  1AKA A;  2QBT A;  3MAD A;  3PD6 A;  3Q8N A;  4A0G A;  1PG8 A;  1V2F A;  4B9B A;  1WYV A;  3PD6 B;  4ZDP A;  1N31 A;  2GMS A;  4GE7 A;  3HT4 A;  4UHN A;  4GRX A;  4IX8 A;  2VGV A;  3HL2 A;  1ARI A;  1CL1 A;  3NNK A;  1DFO A;  4LC3 A;  4ZDL A;  4WYG A;  2D64 A;  4B98 A;  2O1B A;  4TN4 A;  1EJI A;  2ZC0 A;  1EQB A;  3MC6 C;  2WK7 A;  1AHF A;  4F4E A;  2ZSM A;  3E2F A;  2DGM A;  2Z67 A;  3B1E A;  4ADD A;  1M6S A;  2AY2 A;  1IUG A;  3BS8 A;  1BJW A;  4A6R A;  1BQA A;  2D61 A;  3VAX A;  3AEJ C;  3GR9 A;  2VGS A;  3PAA A;  2G6W A;  2VGU A;  3JZL A;  1W3U A;  2JIS A;  1AHX A;  1XEY A;  2BWO A;  4BMK A;  1C0N A;  1OXP A;  2EZ2 A;  4WBT A;  1FC4 A;  5EIG A;  3A2B A;  1AHE A;  1MAQ A;  3LY1 A;  2E7I A;  2D7Z A;  4GE4 A;  4O6Z A;  3TCM A;  3FQ8 A;  4CXR A;  1IBJ A;  2CIN A;  1SZU A;  4N0W A;  1AJR A;  1I29 A;  4W1X A;  3WX9 A;  3DR7 A;  2VI8 A;  3DR4 A;  1FG3 A;  3HBX A;  1TOJ A;  4JF0 A;  4FFC A;  3CBF A;  2HUU A;  4A0F A;  3ASB A;  2QLR A;  1VP4 A;  2HOY A;  3DYD A;  3QN6 A;  4ZM3 A;  2W8T A;  1SZS A;  3QBO A;  1W23 A;  4ISY A;  4ITG A;  1OHV A;  5D95 A;  1SVV A;  3E2Z B;  4Q31 A;  1ASC A;  1JS3 A;  4EU1 A;  3NTJ A;  2QA3 A;  3HDO A;  1YNU A;  3B1D A;  1D7R A;  2VMX A;  3G0T A;  1X2A A;  5EUN A;  2QB2 A;  1AY8 A;  1V2E A;  4Q75 A;  2VMT A;  3AEP A;  2YKU A;  1GEW A;  2HUF A;  5AX8 A;  1MLY A;  4F5F A;  3B1C A;  4ZWM A;  4M2M A;  5M4D A;  3G8M A;  1G7X A;  2W8U A;  1LK9 A;  3FQ7 A;  3F0H A;  1CQ7 A;  1RVY A;  1J04 A;  2ZY5 A;  2ZUK A;  2D66 A;  2Z9V A;  4BHD A;  3HLM A;  3FVU A;  3B46 A;  5E3K A;  2X5F A;  3FDD A;  2YOB A;  4UHM A;  1GC0 A;  3A8U X;  3QGU A;  4R5Z A;  3LVK A;  4BA5 A;  2VIB A;  3P1T A;  4KYO A;  1Y4I A;  2EPJ A;  3AEN A;  3ZZK A;  1YJS A;  2FM1 A;  3T32 A;  3NUB A;  4MKK A;  4R2N A;  3ACZ A;  3QM2 A;  4CBS A;  3FQA A;  1D2F A;  2R5E A;  1SPA A;  3A9Y A;  1AJS A;  3D6K A;  1AMS A;  5HDM A;  3DXV A;  1O62 A;  1OAT A;  1AJS B;  4ITX A;  1AHG A;  3M5U A;  4J8L A;  3NYS A;  1X29 A;  3ISL A;  4RLG A;  2AY1 A;  3EI7 A;  4XJM A;  2CY8 A;  4J5U A;  3TQX A;  2O7C A;  1C7G A;  2VYC A;  4ZAS A;  3DC1 A;  3KE3 A;  2R5C B;  1AIC A;  1IX7 A;  2W8W A;  1ASL A;  5EUE A;  4UQV A;  2EGY A;  2V0Y A;  4CVQ A;  3N5M A;  2E7J A;  1ECX A;  3ATH A;  1MDX A;  4WLH A;  3NDN A;  3UAK A;  3EUC A;  3QI6 A;  5FT6 A;  1M32 A;  3G7Q A;  4A0R A;  3OKS A;  2W7E A;  1LC5 A;  2AY7 A;  4WXG A;  4ADC A;  1AKB A;  4ATP A;  2ZY3 A;  3R4T A;  5EFS A;  3ZRP A;  3NUI A;  4W91 A;  1OHW A;  3AAT A;  2GQN A;  2EO5 A;  3NX3 A;  1CZE A;  2AY5 A;  2BYL A;  3RUY A;  5M49 A;  2YRR A;  3P6K A;  5K8B A;  1QJ5 A;  2CH2 A;  3W1H A;  1I41 A;  1RV3 A;  3RI6 A;  1ASD A;  1C9C A;  4M2J A;  3FD0 A;  2DOU A;  3CQ5 A;  4R8D A;  1WKG A;  4GDY A;  4AH3 A;  3MAU A;  4JEY A;  2GMU A;  5D5S A;  1BQD A;  2AY6 A;  3PIU A;  3UE8 A;  5FT5 A;  4WXF A;  2W7H A;  1O61 A;  3WY7 A;  2C81 A;  2YKX A;  1ORD A;  2BI2 A;  5G2P A;  1AAM A;  1O69 A;  5DJ1 A;  1H1C A;  1CQ8 A;  3E9K A;  1G4X A;  2VMY A;  3F9T A;  2X5D A;  3NRA A;  4ZSW A;  1GEY A;  3ZRQ A;  3AEO A;  9AAT A;  1CL2 A;  1BJO A;  3BWN A;  3L44 A;  4XK1 A;  2VGT A;  2HOZ A;  4PFF A;  1BJO B;  1LW5 A;  2VMQ A;  2OKK A;  3B8X A;  2ORD A;  4XJO A;  7AAT A;  4KAM A;  4JE5 A;  4F5G A;  4WYA A;  3BWO A;  3FFH A;  4WD2 A;  1M7Y A;  2NMP A;  1DJ9 A;  2Z1Z A;  3II0 A;  3DXW A;  3JW9 A;  4RKC A;  4BA4 A;  2CJH A;  3IF2 A;  3PJ0 A;  3EZS A;  2VMO A;  1DKA A;  1W7M A;  1AY5 A;  1TPL A;  3ELE A;  4IW7 A;  4MSO A;  1ZC9 A;  1S08 A;  3ZRR A;  1CZC A;  1SF2 A;  1SZK A;  2BIG A;  2VLH A;  3BCX A;  3PDB B;  3LG0 A;  4I8A A;  1V72 A;  3LVL B;  4JEV A;  2GSA A;  1S06 A;  1ASM A;  2W8J A;  4HVK A;  1N8P A;  5DX5 A;  2R2N A;  4RJ0 A;  3NU7 A;  2PB2 A;  1ARH A;  2VLF A;  3DZZ A;  4MGR A;  3PA9 A;  1VJO A;  4UOY A;  3COG A;  2CTZ A;  3BN1 A;  3E2Z A;  1W7L A;  1CS1 A;  3USF A;  2AAT A;  4L0O A;  4MKJ A;  4ZM4 A;  4OBU A;  1I43 A;  1TOE A;  1D7V A;  4MQQ A;  1S09 A;  4GEB A;  3R9A A;  2QB3 A;  2AY9 A;  2XBN A;  4H51 A;  1S07 A;  2JG2 A;  3PGY A;  2BI1 A;  1GCK A;  1ELQ A;  1GC2 A;  1ZOB A;  4WB0 B;  4WXB A;  4P7Y A;  4OTL A;  2C0R A;  4XAU A;  3GZD A;  2DR1 A;  3WGB A;  4E1O A;  3CAI A;  4F5M A;  5LH9 A;  3K40 A;  2OKJ A;  2Z9X A;  1E5F A;  1GDE A;  3VK2 A;  1MDZ A;  3RBL A;  4OYT A;  1D7S A;  1OXO A;  1M4N A;  1YAA A;  2D65 A;  2OQX A;  1E5E A;  4F5J A;  1DGD A;  1TOK A;  3JU7 A;  2C7T A;  3AEL A;  2W7M A;  3WCN A;  4W1W A;  3WGC A;  1TAR A;  2QMA A;  2VMR A;  1YIY A;  1W7N A;  1X28 A;  3DU4 A;  3ASA A;  3TAT A;  1UU0 A;  4BQ0 A;  1BS0 A;  4GSA A;  4ZAH A;  3KKI A;  3N0L A;  2BYJ A;  1TOI A;  2GB3 A;  2ZP7 A;  4IY7 A;  4UHO A;  5F9S A;  4QGR A;  1I48 A;  2ZY2 A;  1GD9 A;  2YRI A;  3NYU A;  3H14 A;  4MY5 A;  5F8V A;  1KKJ A;  3CQ6 A;  3E77 A;  2HOR A;  1ASG A;  1UU1 A;  4TV7 A;  4FL0 A;  3FZ8 A;  2VGW A;  2R5C A;  1B4X A;  1T3I A;  3FZ7 A;  2VMP A;  3GZC A;  2W7I A;  4ZSY A;  2Z1Y A;  3KGX A;  3MKJ A;  5LHA A;  2FYF A;  3FDB A;  1LKC A;  1ZOD A;  3F6T A;  3MBB A;  4EMY A;  2W7D A;  1AMR A;  4RAE A;  2V1P A;  1IVR A;  2WK8 A;  2BI3 A;  3PDX A;  4RKD A;  1CJ0 A;  3BC8 A;  5E4Z A;  2YCT A;  1SFF A;  4LNL A;  2JJH A;  3VK4 A;  4RM1 A;  1TAS A;  1ELU A;  1TOG A;  1B5O A;  3GWP A;  1B9I A;  4PFN A;  1QZ9 A;  2AY8 A;  2C44 A;  2DGK A;  3BWN C;  1ASA A;  2XH1 A;  2BWN A;  2BI5 A;  2AY3 A;  2VMV A;  2W7G A;  4JE5 D;  1AKC A;  1ARS A;  1KL2 A;  4LW2 A;  3WKS A;  2E7U A;  1KKP A;  3JWB A;  4MQR A;  4XJP A;  1IX8 A;  1WYU A;  3JTX A;  1GEX A;  4JEX A;  3IHJ A;  4A6U A;  1WYU B;  1AAW A;  2E54 A;  3K28 A;  4OCA A;  4ADE A;  2AEU A;  5BJ3 A;  2YCP A;  1J32 A;  5BJ4 A;  3LVM A;  4WYD A;  3H7F A;  5EQC A;  1U08 A;  2EZ1 A;  4F5I A;  4R5F A;  1C7N A;  1YJZ A;  3FRK A;  1QIR A;  3I16 A;  4U1T A;  1ART A;  5FT8 A;  2DGL A;  4AOA A;  4CXQ A;  4OBV A;  1Z3Z A;  1D7U A;  4IXZ A;  3GET A;  1LS3 A;  2BKW A;  3EI8 A;  5DB5 A;  5G0A A;  3BB8 A;  5HHY A;  4AO9 A;  4E77 A;  1DGE A;  4N0B A;  4E3Q A;  4DQ6 A;  1M0N A;  2CAN A;  3AOW A;  3AV7 A;  3GSB A;  2ZY4 A;  3W1I A;  4WYE A;  3JWA A;  3EIB A;  1ASB A;  4F5K A;  1KMK A;  1EG5 A;  1Z7D A;  3DOD A;  2BI9 A;  3FVS A;  5G2Q A;  2OAT A;  1AIB A;  1O4S A;  2Z20 A;  1VEF A;  4A6T A;  1GC3 A;  2AY4 A;  1DJU A;  1WYV B;  1AIA A;  3RCH A;  1JS6 A;  2VMW A;  3AEM A;  2W7J A;  3PDB A;  3RCH B;  4JEZ A;  1TAT A;  1DTY A;  3FCR A;  3LV2 A;  4XJL A;  3HMU A;  4EFF A;  4EB5 A;  4K2B A;  3I5T A;  2CJG A;  5EAA A;  1P3W A;  2HZP A;  4F5H A;  3EI9 A;  3GZD C;  3I4J A;  4IYO A;  1X0M A;  4DGT A;  5G09 A;  4IYO B;  5C6U A;  5EUD A;  4OT8 A;  1YOO A;  3FVX A;  4PVF A;  1ASN A;  2Z61 A;  3WCO A;  4IXO A;  4XEW A;  4LW4 A;  4P3M A;  5DJ9 A;  2DKJ A;  4W5K A;  1OHY A;  1G7W A;  3TFT A;  2JGT A;  4RJY A;  3K7Y A;  2OGE A;  1PMM A;  2X3L A;  1AMQ A;  2OGA A;  2VMZ A;  3L8A A;  2VMN A;  3ELP A;  3W1J A;  1WKH A;  4WLJ A;  3EI5 A;  5EIG B;  1ARG A;  3UWC A;  3GBX A;  1CQ6 A;  2X8U A;  1BT4 A;  1JF9 A;  4CBR A;  3DRD A;  1M0Q A;  2WKA A;  2ZSL A;  4KXK A;  2VGZ A;  4ATQ A;  4WB0 A;  3FSL A;  1FG7 A;  4IXS A;  4WYC A;  4K2I A;  2F8J A;  4AZK A;  2FQ6 A;  8AAT A;  3CQ4 A;  5FT4 A;  2D7Y A;  1H0C A;  3BCB A;  1ASE A;  4W1V A;  2Z9W A;  1RV4 A;  5IWQ A;  1AMA A;  3AOV A;  5I92 A;  1M0P A;  3MC6 A;  3HVY A;  1AY4 A;  2VMS A;  1QJ3 A;  3RBF A;  3QHX A;  1QGN A;  3RQ1 A;  3VOM A;  1RVU A;  2ZYJ A;  2W7L A;  1PMO A;  2CH1 A;  2D63 A;  4LNJ A;  5G4J A;  3TFU A;  1UU2 A;  3AEJ A;  1BKG A;  3E6G A;  1ASF A;  4A00 A;  1JG8 A;  4LNM A;  2CJD A;  4ZWV A;  3NU8 A;  1M0O A;  2CST A;  2ZJG A;  3VK3 A;  1UKJ A;  5E5I A;  2CFB A;  5TF5 A;  3FZ6 A;  4XQ2 A;  1IAY A;  4Y0I A;  2JJE A;  1B5P A;  5EAV A;  2AEV A;  4Q76 A;  5M4B A;  2BIE A;  2BHX A;  1IX6 A;  1G4V A;  3E2Y A;  4GE9 A;  4Q6R A;  3VP6 A;  4F5L A;  2CB1 A;  4A72 A;  1V2D A;  1XI9 A;  2FNI A;  1B8G A;  5G4I A;  5M46 A;  1IAX A;  4NOG A;  3WKR A;  2DKB A;  3WZF A;  3MAF A;  4MQP A;  1LW4 A;  2BWP A;  4E3R A;  3MAF B;  2FNU A;  1WST A;  4OMA A;  3AEN B;  4W8I A;  2WK9 A;  2YKV A;  1C7O A;  5HXX A;  4RIZ A;  3A9Z A;  4Y0H A;  5JAY A;  3HQT A;  1GBN A;  3MEB A;  4OC9 A;  4ZLV A;  4WP0 A;  2RFV A;  2HUI A;  1LC7 A;  2HP1 A;  3LVJ A;  4U2H A;  2R0T A;  2PO3 A;  3FFR A;  2W8V A;  2YKY A;  4JEW A;  1MAP A;  2Q7W A;  4DBC A;  1KMJ A;  3ZZJ A;  3EI6 A;  3OP7 A;  2JJF A;  1N2T A;  1GC4 A;  1S0A A;  1QIS A;  3LWS A;  3BCA A;  4JF1 A;  1YJY A;  3QPG A;  4M2K A;  2YCN A;  1MGV A;  4TMR A;  4ZDO A;  1BJN A;  1KL1 A;  2PB0 A;  2HP2 A;  2VI9 A;  1BJ4 A;  4Y0D A;  4EB7 A;  1PFF A;  1IJI A;  1MDO A;  2JJG A;  3AEM C;  3GJU A;  4ADB A;  1BW0 A;  5J8Q A;  3FTB A;  3BV0 A;  4A0H A;  3A9X A;  1B9H A;  2Z9U A;  1WYT A;  1DJE A;  2D5Y A;  2YHK A;  1WYT B;  3KGW A;  3ECD A;  3N75 A;  2HOX A;  3NYT A;  3PPL A;  4WYF A;  4AO4 A;  1QIT A;  2BIA A;  4HF8 A;  3WLX A;  4PIW A;  3FKD A;  2O0R A;  2W7K A;  1AHY A; 
#chains in the Genus database with same CATH topology
 4K2M A;  2TPL A;  1YIZ A;  3EZ1 A;  4AZJ A;  2VMU A;  1MLZ A;  1C4K A;  1KAF A;  2VIA A;  2W7F A;  2EH6 A;  2FN6 A;  3EIA A;  4RIT A;  1AX4 A;  1LC8 A;  1AKA A;  2QBT A;  3MAD A;  3PD6 A;  3Q8N A;  4A0G A;  1PG8 A;  1V2F A;  4B9B A;  1WYV A;  3PD6 B;  4ZDP A;  1N31 A;  2GMS A;  4GE7 A;  3HT4 A;  4UHN A;  4GRX A;  4IX8 A;  2VGV A;  3HL2 A;  1ARI A;  1CL1 A;  3NNK A;  1DFO A;  4LC3 A;  4ZDL A;  4WYG A;  2D64 A;  4B98 A;  2O1B A;  4TN4 A;  1EJI A;  2ZC0 A;  1EQB A;  3MC6 C;  2WK7 A;  1AHF A;  4F4E A;  2ZSM A;  3E2F A;  2DGM A;  2Z67 A;  3B1E A;  4ADD A;  1M6S A;  2AY2 A;  1IUG A;  3BS8 A;  1BJW A;  4A6R A;  1BQA A;  2D61 A;  3VAX A;  3AEJ C;  3GR9 A;  2VGS A;  3PAA A;  2G6W A;  2VGU A;  3JZL A;  1W3U A;  2JIS A;  1AHX A;  1XEY A;  2BWO A;  4BMK A;  1C0N A;  1OXP A;  2EZ2 A;  4WBT A;  1FC4 A;  5EIG A;  3A2B A;  1AHE A;  1MAQ A;  3LY1 A;  2E7I A;  2D7Z A;  4GE4 A;  4O6Z A;  3TCM A;  3FQ8 A;  4CXR A;  1IBJ A;  2CIN A;  1SZU A;  4N0W A;  1AJR A;  1I29 A;  4W1X A;  3WX9 A;  3DR7 A;  2VI8 A;  3DR4 A;  1FG3 A;  3HBX A;  1TOJ A;  4JF0 A;  4FFC A;  3CBF A;  2HUU A;  4A0F A;  3ASB A;  2QLR A;  1VP4 A;  2HOY A;  3DYD A;  3QN6 A;  4ZM3 A;  2W8T A;  1SZS A;  3QBO A;  1W23 A;  4ISY A;  4ITG A;  1OHV A;  5D95 A;  1SVV A;  3E2Z B;  4Q31 A;  1ASC A;  1JS3 A;  4EU1 A;  3NTJ A;  2QA3 A;  3HDO A;  1YNU A;  3B1D A;  1D7R A;  2VMX A;  3G0T A;  1X2A A;  5EUN A;  2QB2 A;  1AY8 A;  3N4S A;  1V2E A;  4Q75 A;  2VMT A;  3AEP A;  2YKU A;  1GEW A;  2HUF A;  5AX8 A;  1MLY A;  4F5F A;  3B1C A;  4ZWM A;  4M2M A;  5M4D A;  3G8M A;  1G7X A;  2W8U A;  1LK9 A;  3FQ7 A;  3F0H A;  1CQ7 A;  1RVY A;  1J04 A;  2ZY5 A;  2ZUK A;  2D66 A;  2Z9V A;  4BHD A;  3HLM A;  3FVU A;  3B46 A;  5E3K A;  2X5F A;  3FDD A;  2YOB A;  4UHM A;  1GC0 A;  3A8U X;  3QGU A;  4R5Z A;  3LVK A;  4BA5 A;  2VIB A;  3P1T A;  4KYO A;  1Y4I A;  2EPJ A;  3AEN A;  3ZZK A;  1YJS A;  2FM1 A;  3T32 A;  3NUB A;  4MKK A;  4R2N A;  3ACZ A;  3QM2 A;  4CBS A;  3FQA A;  1D2F A;  2R5E A;  1SPA A;  3A9Y A;  1AJS A;  3D6K A;  1AMS A;  5HDM A;  3DXV A;  1O62 A;  1OAT A;  1AJS B;  4ITX A;  1AHG A;  3M5U A;  4J8L A;  3NYS A;  1X29 A;  3ISL A;  4RLG A;  2AY1 A;  3EI7 A;  4XJM A;  2CY8 A;  4J5U A;  3TQX A;  2O7C A;  1C7G A;  2VYC A;  4ZAS A;  2EYQ A;  3DC1 A;  3KE3 A;  2R5C B;  1AIC A;  1IX7 A;  2W8W A;  1ASL A;  5EUE A;  4UQV A;  2EGY A;  2V0Y A;  4CVQ A;  3N5M A;  2E7J A;  1ECX A;  3ATH A;  1MDX A;  4WLH A;  3NDN A;  3UAK A;  3EUC A;  3QI6 A;  5FT6 A;  1M32 A;  3G7Q A;  4A0R A;  3OKS A;  2W7E A;  1LC5 A;  2AY7 A;  4WXG A;  4ADC A;  1AKB A;  4ATP A;  2ZY3 A;  3R4T A;  5EFS A;  3ZRP A;  3NUI A;  4W91 A;  1OHW A;  3AAT A;  2GQN A;  2EO5 A;  3NX3 A;  1CZE A;  2AY5 A;  2BYL A;  3RUY A;  5M49 A;  2YRR A;  3P6K A;  5K8B A;  1QJ5 A;  2CH2 A;  3W1H A;  1I41 A;  1RV3 A;  3RI6 A;  1ASD A;  1C9C A;  4M2J A;  3FD0 A;  2DOU A;  3CQ5 A;  4R8D A;  1WKG A;  4GDY A;  4AH3 A;  3MAU A;  4JEY A;  2G7J A;  2GMU A;  5D5S A;  1BQD A;  2AY6 A;  3PIU A;  3UE8 A;  5FT5 A;  4WXF A;  2W7H A;  1O61 A;  3WY7 A;  2C81 A;  2YKX A;  1ORD A;  3H9X A;  2BI2 A;  5G2P A;  1AAM A;  1O69 A;  5DJ1 A;  1H1C A;  1CQ8 A;  3E9K A;  1G4X A;  2VMY A;  3F9T A;  2X5D A;  3NRA A;  4ZSW A;  1GEY A;  3ZRQ A;  3AEO A;  9AAT A;  1CL2 A;  1BJO A;  3BWN A;  3L44 A;  4XK1 A;  2VGT A;  2HOZ A;  4PFF A;  1BJO B;  1LW5 A;  2VMQ A;  2OKK A;  3B8X A;  2ORD A;  4XJO A;  7AAT A;  4KAM A;  4JE5 A;  4F5G A;  4WYA A;  3BWO A;  3FFH A;  4WD2 A;  1M7Y A;  2NMP A;  1DJ9 A;  2Z1Z A;  3II0 A;  3DXW A;  3JW9 A;  4RKC A;  4BA4 A;  2CJH A;  3IF2 A;  3PJ0 A;  3EZS A;  2VMO A;  1DKA A;  1W7M A;  1AY5 A;  1TPL A;  3ELE A;  4IW7 A;  4MSO A;  3N7N A;  1ZC9 A;  1S08 A;  3ZRR A;  1CZC A;  1SF2 A;  1SZK A;  2BIG A;  2VLH A;  3BCX A;  3PDB B;  3LG0 A;  4I8A A;  3N4R A;  1V72 A;  3LVL B;  4JEV A;  2GSA A;  1S06 A;  1ASM A;  2W8J A;  4HVK A;  1N8P A;  5DX5 A;  2R2N A;  4RJ0 A;  3NU7 A;  2PB2 A;  1ARH A;  2VLF A;  3DZZ A;  4MGR A;  3PA9 A;  1VJO A;  4UOY A;  3COG A;  2CTZ A;  5KTB A;  3BN1 A;  3E2Z A;  1W7L A;  1CS1 A;  3USF A;  2AAT A;  4L0O A;  4MKJ A;  4ZM4 A;  4OBU A;  1I43 A;  1TOE A;  1D7V A;  4MQQ A;  1S09 A;  4GEB A;  3R9A A;  2QB3 A;  2AY9 A;  2XBN A;  4H51 A;  1S07 A;  2JG2 A;  3PGY A;  2BI1 A;  1GCK A;  1ELQ A;  1GC2 A;  1ZOB A;  4WB0 B;  4WXB A;  4P7Y A;  4OTL A;  2C0R A;  4XAU A;  3GZD A;  2DR1 A;  3WGB A;  4E1O A;  3CAI A;  4F5M A;  5LH9 A;  3K40 A;  2OKJ A;  2Z9X A;  1E5F A;  1GDE A;  3VK2 A;  1MDZ A;  3RBL A;  4OYT A;  1D7S A;  1OXO A;  1M4N A;  1YAA A;  2D65 A;  2OQX A;  2A1V A;  1E5E A;  4F5J A;  1DGD A;  1TOK A;  3JU7 A;  2C7T A;  3AEL A;  2W7M A;  3WCN A;  4W1W A;  3WGC A;  1TAR A;  2QMA A;  2VMR A;  1YIY A;  1W7N A;  1X28 A;  3DU4 A;  3ASA A;  3TAT A;  1UU0 A;  4BQ0 A;  1BS0 A;  4GSA A;  4ZAH A;  3KKI A;  3N0L A;  2BYJ A;  1TOI A;  2GB3 A;  2ZP7 A;  4IY7 A;  4UHO A;  5F9S A;  4QGR A;  1I48 A;  2ZY2 A;  1GD9 A;  2YRI A;  3NYU A;  3H14 A;  4MY5 A;  5F8V A;  1KKJ A;  3CQ6 A;  3E77 A;  2HOR A;  1ASG A;  1UU1 A;  4TV7 A;  4FL0 A;  3FZ8 A;  2VGW A;  2R5C A;  1B4X A;  1T3I A;  3FZ7 A;  2VMP A;  3GZC A;  2W7I A;  4ZSY A;  2Z1Y A;  3KGX A;  3MKJ A;  5LHA A;  2FYF A;  3FDB A;  1LKC A;  1ZOD A;  3F6T A;  3MBB A;  4EMY A;  2W7D A;  1AMR A;  4RAE A;  2V1P A;  1IVR A;  2WK8 A;  2BI3 A;  3PDX A;  4RKD A;  1CJ0 A;  3BC8 A;  5E4Z A;  2YCT A;  1SFF A;  4LNL A;  2JJH A;  3VK4 A;  2KFP A;  4RM1 A;  1TAS A;  1ELU A;  1TOG A;  1B5O A;  3GWP A;  1B9I A;  4PFN A;  1QZ9 A;  2AY8 A;  2C44 A;  2DGK A;  3BWN C;  1ASA A;  2XH1 A;  2BWN A;  2BI5 A;  2AY3 A;  2VMV A;  2W7G A;  4JE5 D;  1AKC A;  1ARS A;  1KL2 A;  4LW2 A;  3WKS A;  2E7U A;  1KKP A;  3JWB A;  4MQR A;  4XJP A;  1IX8 A;  1WYU A;  3JTX A;  1GEX A;  4JEX A;  3IHJ A;  4A6U A;  1WYU B;  1AAW A;  2E54 A;  3K28 A;  4OCA A;  4ADE A;  2AEU A;  5BJ3 A;  2YCP A;  1J32 A;  5BJ4 A;  3LVM A;  4WYD A;  3H7F A;  5EQC A;  1U08 A;  2EZ1 A;  4F5I A;  4R5F A;  3N4X A;  1C7N A;  1YJZ A;  3FRK A;  1QIR A;  3I16 A;  4U1T A;  1ART A;  5FT8 A;  2DGL A;  4AOA A;  4CXQ A;  4OBV A;  1Z3Z A;  1D7U A;  4IXZ A;  3GET A;  1LS3 A;  2BKW A;  3EI8 A;  5DB5 A;  5G0A A;  3BB8 A;  5HHY A;  4AO9 A;  4E77 A;  1DGE A;  4N0B A;  4E3Q A;  4DQ6 A;  1M0N A;  2CAN A;  3AOW A;  3AV7 A;  3GSB A;  2ZY4 A;  3W1I A;  4WYE A;  3JWA A;  4H63 Q;  3EIB A;  1ASB A;  4F5K A;  1KMK A;  1EG5 A;  1Z7D A;  3DOD A;  2BI9 A;  3FVS A;  5G2Q A;  2OAT A;  1AIB A;  1O4S A;  2Z20 A;  1VEF A;  4A6T A;  1GC3 A;  2AY4 A;  1DJU A;  1WYV B;  1AIA A;  3RCH A;  1JS6 A;  2VMW A;  3AEM A;  2W7J A;  3PDB A;  3RCH B;  4JEZ A;  1TAT A;  1DTY A;  3FCR A;  3LV2 A;  4XJL A;  3HMU A;  4EFF A;  4EB5 A;  4K2B A;  3I5T A;  2CJG A;  5EAA A;  1P3W A;  2HZP A;  4F5H A;  3EI9 A;  3GZD C;  3I4J A;  4IYO A;  1X0M A;  4DGT A;  5G09 A;  4IYO B;  5C6U A;  5EUD A;  4OT8 A;  1YOO A;  3FVX A;  4PVF A;  1ASN A;  2Z61 A;  3WCO A;  4IXO A;  4XEW A;  4LW4 A;  4P3M A;  4K05 A;  5DJ9 A;  2DKJ A;  4W5K A;  1OHY A;  1G7W A;  3TFT A;  2JGT A;  4RJY A;  3K7Y A;  2OGE A;  1PMM A;  2X3L A;  1AMQ A;  2OGA A;  2VMZ A;  3L8A A;  2WB6 A;  2VMN A;  3ELP A;  3W1J A;  1WKH A;  4WLJ A;  3EI5 A;  5EIG B;  1ARG A;  3UWC A;  3GBX A;  1CQ6 A;  2X8U A;  1BT4 A;  1JF9 A;  4CBR A;  3DRD A;  1M0Q A;  2WKA A;  2ZSL A;  4KXK A;  2VGZ A;  4ATQ A;  4WB0 A;  3FSL A;  1FG7 A;  4IXS A;  4WYC A;  4K2I A;  2F8J A;  4AZK A;  2FQ6 A;  8AAT A;  3CQ4 A;  5FT4 A;  2D7Y A;  1H0C A;  3BCB A;  1ASE A;  4W1V A;  2Z9W A;  1RV4 A;  5IWQ A;  1AMA A;  3AOV A;  5I92 A;  1M0P A;  3MC6 A;  3HVY A;  1AY4 A;  2VMS A;  1QJ3 A;  3RBF A;  3QHX A;  1QGN A;  3RQ1 A;  3VOM A;  1RVU A;  2ZYJ A;  2W7L A;  1PMO A;  2CH1 A;  2D63 A;  4LNJ A;  5G4J A;  3TFU A;  1UU2 A;  3AEJ A;  1BKG A;  3E6G A;  1ASF A;  4A00 A;  1JG8 A;  4LNM A;  2CJD A;  4ZWV A;  3NU8 A;  1M0O A;  2CST A;  2ZJG A;  3VK3 A;  1UKJ A;  5E5I A;  2CFB A;  5TF5 A;  3FZ6 A;  4XQ2 A;  1IAY A;  4Y0I A;  2JJE A;  1B5P A;  5EAV A;  2AEV A;  4Q76 A;  5M4B A;  2BIE A;  2BHX A;  1IX6 A;  1G4V A;  3E2Y A;  4GE9 A;  4Q6R A;  3VP6 A;  4F5L A;  2CB1 A;  2QSR A;  4A72 A;  1V2D A;  1XI9 A;  2FNI A;  1B8G A;  5G4I A;  5M46 A;  1IAX A;  4NOG A;  3WKR A;  2DKB A;  3WZF A;  3MAF A;  4MQP A;  1LW4 A;  2BWP A;  4E3R A;  3MAF B;  2FNU A;  1WST A;  4OMA A;  3AEN B;  4W8I A;  2WK9 A;  2YKV A;  1C7O A;  5HXX A;  4RIZ A;  3A9Z A;  4Y0H A;  5JAY A;  3HQT A;  1GBN A;  3MEB A;  4OC9 A;  4ZLV A;  4WP0 A;  2RFV A;  2HUI A;  1LC7 A;  2HP1 A;  3LVJ A;  4U2H A;  2R0T A;  2PO3 A;  3FFR A;  2W8V A;  2YKY A;  4JEW A;  1MAP A;  2Q7W A;  4DBC A;  1KMJ A;  3ZZJ A;  3EI6 A;  3OP7 A;  2JJF A;  1N2T A;  1GC4 A;  1S0A A;  1QIS A;  3LWS A;  3BCA A;  4JF1 A;  1YJY A;  3QPG A;  4M2K A;  2YCN A;  1MGV A;  4TMR A;  4ZDO A;  1BJN A;  1KL1 A;  2PB0 A;  2HP2 A;  2VI9 A;  1BJ4 A;  4Y0D A;  4EB7 A;  2FKI A;  1PFF A;  1IJI A;  1MDO A;  2JJG A;  3AEM C;  3GJU A;  4ADB A;  1BW0 A;  5J8Q A;  3FTB A;  3BV0 A;  4A0H A;  3A9X A;  1B9H A;  2Z9U A;  1WYT A;  1DJE A;  2D5Y A;  2YHK A;  1WYT B;  3KGW A;  3ECD A;  3N75 A;  2HOX A;  3NYT A;  3PPL A;  4WYF A;  4AO4 A;  1QIT A;  2BIA A;  4HF8 A;  3WLX A;  4PIW A;  3FKD A;  2O0R A;  2W7K A;  1AHY A; 
#chains in the Genus database with same CATH homology
 4K2M A;  2TPL A;  1YIZ A;  3EZ1 A;  4AZJ A;  2VMU A;  1MLZ A;  1C4K A;  2VIA A;  2W7F A;  2EH6 A;  2FN6 A;  3EIA A;  4RIT A;  1AX4 A;  1LC8 A;  1AKA A;  2QBT A;  3MAD A;  3PD6 A;  3Q8N A;  4A0G A;  1PG8 A;  1V2F A;  4B9B A;  1WYV A;  3PD6 B;  4ZDP A;  1N31 A;  2GMS A;  4GE7 A;  3HT4 A;  4UHN A;  4GRX A;  4IX8 A;  2VGV A;  3HL2 A;  1ARI A;  1CL1 A;  3NNK A;  1DFO A;  4LC3 A;  4ZDL A;  4WYG A;  2D64 A;  4B98 A;  2O1B A;  4TN4 A;  1EJI A;  2ZC0 A;  1EQB A;  3MC6 C;  2WK7 A;  1AHF A;  4F4E A;  2ZSM A;  3E2F A;  2DGM A;  2Z67 A;  3B1E A;  4ADD A;  1M6S A;  2AY2 A;  1IUG A;  3BS8 A;  1BJW A;  4A6R A;  1BQA A;  2D61 A;  3VAX A;  3AEJ C;  3GR9 A;  2VGS A;  3PAA A;  2G6W A;  2VGU A;  3JZL A;  1W3U A;  2JIS A;  1AHX A;  1XEY A;  2BWO A;  4BMK A;  1C0N A;  1OXP A;  2EZ2 A;  4WBT A;  1FC4 A;  5EIG A;  3A2B A;  1AHE A;  1MAQ A;  3LY1 A;  2E7I A;  2D7Z A;  4GE4 A;  4O6Z A;  3TCM A;  3FQ8 A;  4CXR A;  1IBJ A;  2CIN A;  1SZU A;  4N0W A;  1AJR A;  1I29 A;  4W1X A;  3WX9 A;  3DR7 A;  2VI8 A;  3DR4 A;  1FG3 A;  3HBX A;  1TOJ A;  4JF0 A;  4FFC A;  3CBF A;  2HUU A;  4A0F A;  3ASB A;  2QLR A;  1VP4 A;  2HOY A;  3DYD A;  3QN6 A;  4ZM3 A;  2W8T A;  1SZS A;  3QBO A;  1W23 A;  4ISY A;  4ITG A;  1OHV A;  5D95 A;  1SVV A;  3E2Z B;  4Q31 A;  1ASC A;  1JS3 A;  4EU1 A;  3NTJ A;  2QA3 A;  3HDO A;  1YNU A;  3B1D A;  1D7R A;  2VMX A;  3G0T A;  1X2A A;  5EUN A;  2QB2 A;  1AY8 A;  3N4S A;  1V2E A;  4Q75 A;  2VMT A;  3AEP A;  2YKU A;  1GEW A;  2HUF A;  5AX8 A;  1MLY A;  4F5F A;  3B1C A;  4ZWM A;  4M2M A;  5M4D A;  3G8M A;  1G7X A;  2W8U A;  1LK9 A;  3FQ7 A;  3F0H A;  1CQ7 A;  1RVY A;  1J04 A;  2ZY5 A;  2ZUK A;  2D66 A;  2Z9V A;  4BHD A;  3HLM A;  3FVU A;  3B46 A;  5E3K A;  2X5F A;  3FDD A;  2YOB A;  4UHM A;  1GC0 A;  3A8U X;  3QGU A;  4R5Z A;  3LVK A;  4BA5 A;  2VIB A;  3P1T A;  4KYO A;  1Y4I A;  2EPJ A;  3AEN A;  3ZZK A;  1YJS A;  2FM1 A;  3T32 A;  3NUB A;  4MKK A;  4R2N A;  3ACZ A;  3QM2 A;  4CBS A;  3FQA A;  1D2F A;  2R5E A;  1SPA A;  3A9Y A;  1AJS A;  3D6K A;  1AMS A;  5HDM A;  3DXV A;  1O62 A;  1OAT A;  1AJS B;  4ITX A;  1AHG A;  3M5U A;  4J8L A;  3NYS A;  1X29 A;  3ISL A;  4RLG A;  2AY1 A;  3EI7 A;  4XJM A;  2CY8 A;  4J5U A;  3TQX A;  2O7C A;  1C7G A;  2VYC A;  4ZAS A;  2EYQ A;  3DC1 A;  3KE3 A;  2R5C B;  1AIC A;  1IX7 A;  2W8W A;  1ASL A;  5EUE A;  4UQV A;  2EGY A;  2V0Y A;  4CVQ A;  3N5M A;  2E7J A;  1ECX A;  3ATH A;  1MDX A;  4WLH A;  3NDN A;  3UAK A;  3EUC A;  3QI6 A;  5FT6 A;  1M32 A;  3G7Q A;  4A0R A;  3OKS A;  2W7E A;  1LC5 A;  2AY7 A;  4WXG A;  4ADC A;  1AKB A;  4ATP A;  2ZY3 A;  3R4T A;  5EFS A;  3ZRP A;  3NUI A;  4W91 A;  1OHW A;  3AAT A;  2GQN A;  2EO5 A;  3NX3 A;  1CZE A;  2AY5 A;  2BYL A;  3RUY A;  5M49 A;  2YRR A;  3P6K A;  5K8B A;  1QJ5 A;  2CH2 A;  3W1H A;  1I41 A;  1RV3 A;  3RI6 A;  1ASD A;  1C9C A;  4M2J A;  3FD0 A;  2DOU A;  3CQ5 A;  4R8D A;  1WKG A;  4GDY A;  4AH3 A;  3MAU A;  4JEY A;  2G7J A;  2GMU A;  5D5S A;  1BQD A;  2AY6 A;  3PIU A;  3UE8 A;  5FT5 A;  4WXF A;  2W7H A;  1O61 A;  3WY7 A;  2C81 A;  2YKX A;  1ORD A;  3H9X A;  2BI2 A;  5G2P A;  1AAM A;  1O69 A;  5DJ1 A;  1H1C A;  1CQ8 A;  3E9K A;  1G4X A;  2VMY A;  3F9T A;  2X5D A;  3NRA A;  4ZSW A;  1GEY A;  3ZRQ A;  3AEO A;  9AAT A;  1CL2 A;  1BJO A;  3BWN A;  3L44 A;  4XK1 A;  2VGT A;  2HOZ A;  4PFF A;  1BJO B;  1LW5 A;  2VMQ A;  2OKK A;  3B8X A;  2ORD A;  4XJO A;  7AAT A;  4KAM A;  4JE5 A;  4F5G A;  4WYA A;  3BWO A;  3FFH A;  4WD2 A;  1M7Y A;  2NMP A;  1DJ9 A;  2Z1Z A;  3II0 A;  3DXW A;  3JW9 A;  4RKC A;  4BA4 A;  2CJH A;  3IF2 A;  3PJ0 A;  3EZS A;  2VMO A;  1DKA A;  1W7M A;  1AY5 A;  1TPL A;  3ELE A;  4IW7 A;  4MSO A;  3N7N A;  1ZC9 A;  1S08 A;  3ZRR A;  1CZC A;  1SF2 A;  1SZK A;  2BIG A;  2VLH A;  3BCX A;  3PDB B;  3LG0 A;  4I8A A;  3N4R A;  1V72 A;  3LVL B;  4JEV A;  2GSA A;  1S06 A;  1ASM A;  2W8J A;  4HVK A;  1N8P A;  5DX5 A;  2R2N A;  4RJ0 A;  3NU7 A;  2PB2 A;  1ARH A;  2VLF A;  3DZZ A;  4MGR A;  3PA9 A;  1VJO A;  4UOY A;  3COG A;  2CTZ A;  5KTB A;  3BN1 A;  3E2Z A;  1W7L A;  1CS1 A;  3USF A;  2AAT A;  4L0O A;  4MKJ A;  4ZM4 A;  4OBU A;  1I43 A;  1TOE A;  1D7V A;  4MQQ A;  1S09 A;  4GEB A;  3R9A A;  2QB3 A;  2AY9 A;  2XBN A;  4H51 A;  1S07 A;  2JG2 A;  3PGY A;  2BI1 A;  1GCK A;  1ELQ A;  1GC2 A;  1ZOB A;  4WB0 B;  4WXB A;  4P7Y A;  4OTL A;  2C0R A;  4XAU A;  3GZD A;  2DR1 A;  3WGB A;  4E1O A;  3CAI A;  4F5M A;  5LH9 A;  3K40 A;  2OKJ A;  2Z9X A;  1E5F A;  1GDE A;  3VK2 A;  1MDZ A;  3RBL A;  4OYT A;  1D7S A;  1OXO A;  1M4N A;  1YAA A;  2D65 A;  2OQX A;  2A1V A;  1E5E A;  4F5J A;  1DGD A;  1TOK A;  3JU7 A;  2C7T A;  3AEL A;  2W7M A;  3WCN A;  4W1W A;  3WGC A;  1TAR A;  2QMA A;  2VMR A;  1YIY A;  1W7N A;  1X28 A;  3DU4 A;  3ASA A;  3TAT A;  1UU0 A;  4BQ0 A;  1BS0 A;  4GSA A;  4ZAH A;  3KKI A;  3N0L A;  2BYJ A;  1TOI A;  2GB3 A;  2ZP7 A;  4IY7 A;  4UHO A;  5F9S A;  4QGR A;  1I48 A;  2ZY2 A;  1GD9 A;  2YRI A;  3NYU A;  3H14 A;  4MY5 A;  5F8V A;  1KKJ A;  3CQ6 A;  3E77 A;  2HOR A;  1ASG A;  1UU1 A;  4TV7 A;  4FL0 A;  3FZ8 A;  2VGW A;  2R5C A;  1B4X A;  1T3I A;  3FZ7 A;  2VMP A;  3GZC A;  2W7I A;  4ZSY A;  2Z1Y A;  3KGX A;  3MKJ A;  5LHA A;  2FYF A;  3FDB A;  1LKC A;  1ZOD A;  3F6T A;  3MBB A;  4EMY A;  2W7D A;  1AMR A;  4RAE A;  2V1P A;  1IVR A;  2WK8 A;  2BI3 A;  3PDX A;  4RKD A;  1CJ0 A;  3BC8 A;  5E4Z A;  2YCT A;  1SFF A;  4LNL A;  2JJH A;  3VK4 A;  2KFP A;  4RM1 A;  1TAS A;  1ELU A;  1TOG A;  1B5O A;  3GWP A;  1B9I A;  4PFN A;  1QZ9 A;  2AY8 A;  2C44 A;  2DGK A;  3BWN C;  1ASA A;  2XH1 A;  2BWN A;  2BI5 A;  2AY3 A;  2VMV A;  2W7G A;  4JE5 D;  1AKC A;  1ARS A;  1KL2 A;  4LW2 A;  3WKS A;  2E7U A;  1KKP A;  3JWB A;  4MQR A;  4XJP A;  1IX8 A;  1WYU A;  3JTX A;  1GEX A;  4JEX A;  3IHJ A;  4A6U A;  1WYU B;  1AAW A;  2E54 A;  3K28 A;  4OCA A;  4ADE A;  2AEU A;  5BJ3 A;  2YCP A;  1J32 A;  5BJ4 A;  3LVM A;  4WYD A;  3H7F A;  5EQC A;  1U08 A;  2EZ1 A;  4F5I A;  4R5F A;  3N4X A;  1C7N A;  1YJZ A;  3FRK A;  1QIR A;  3I16 A;  4U1T A;  1ART A;  5FT8 A;  2DGL A;  4AOA A;  4CXQ A;  4OBV A;  1Z3Z A;  1D7U A;  4IXZ A;  3GET A;  1LS3 A;  2BKW A;  3EI8 A;  5DB5 A;  5G0A A;  3BB8 A;  5HHY A;  4AO9 A;  4E77 A;  1DGE A;  4N0B A;  4E3Q A;  4DQ6 A;  1M0N A;  2CAN A;  3AOW A;  3AV7 A;  3GSB A;  2ZY4 A;  3W1I A;  4WYE A;  3JWA A;  4H63 Q;  3EIB A;  1ASB A;  4F5K A;  1KMK A;  1EG5 A;  1Z7D A;  3DOD A;  2BI9 A;  3FVS A;  5G2Q A;  2OAT A;  1AIB A;  1O4S A;  2Z20 A;  1VEF A;  4A6T A;  1GC3 A;  2AY4 A;  1DJU A;  1WYV B;  1AIA A;  3RCH A;  1JS6 A;  2VMW A;  3AEM A;  2W7J A;  3PDB A;  3RCH B;  4JEZ A;  1TAT A;  1DTY A;  3FCR A;  3LV2 A;  4XJL A;  3HMU A;  4EFF A;  4EB5 A;  4K2B A;  3I5T A;  2CJG A;  5EAA A;  1P3W A;  2HZP A;  4F5H A;  3EI9 A;  3GZD C;  3I4J A;  4IYO A;  1X0M A;  4DGT A;  5G09 A;  4IYO B;  5C6U A;  5EUD A;  4OT8 A;  1YOO A;  3FVX A;  4PVF A;  1ASN A;  2Z61 A;  3WCO A;  4IXO A;  4XEW A;  4LW4 A;  4P3M A;  4K05 A;  5DJ9 A;  2DKJ A;  4W5K A;  1OHY A;  1G7W A;  3TFT A;  2JGT A;  4RJY A;  3K7Y A;  2OGE A;  1PMM A;  2X3L A;  1AMQ A;  2OGA A;  2VMZ A;  3L8A A;  2WB6 A;  2VMN A;  3ELP A;  3W1J A;  1WKH A;  4WLJ A;  3EI5 A;  5EIG B;  1ARG A;  3UWC A;  3GBX A;  1CQ6 A;  2X8U A;  1BT4 A;  1JF9 A;  4CBR A;  3DRD A;  1M0Q A;  2WKA A;  2ZSL A;  4KXK A;  2VGZ A;  4ATQ A;  4WB0 A;  3FSL A;  1FG7 A;  4IXS A;  4WYC A;  4K2I A;  2F8J A;  4AZK A;  2FQ6 A;  8AAT A;  3CQ4 A;  5FT4 A;  2D7Y A;  1H0C A;  3BCB A;  1ASE A;  4W1V A;  2Z9W A;  1RV4 A;  5IWQ A;  1AMA A;  3AOV A;  5I92 A;  1M0P A;  3MC6 A;  3HVY A;  1AY4 A;  2VMS A;  1QJ3 A;  3RBF A;  3QHX A;  1QGN A;  3RQ1 A;  3VOM A;  1RVU A;  2ZYJ A;  2W7L A;  1PMO A;  2CH1 A;  2D63 A;  4LNJ A;  5G4J A;  3TFU A;  1UU2 A;  3AEJ A;  1BKG A;  3E6G A;  1ASF A;  4A00 A;  1JG8 A;  4LNM A;  2CJD A;  4ZWV A;  3NU8 A;  1M0O A;  2CST A;  2ZJG A;  3VK3 A;  1UKJ A;  5E5I A;  2CFB A;  5TF5 A;  3FZ6 A;  4XQ2 A;  1IAY A;  4Y0I A;  2JJE A;  1B5P A;  5EAV A;  2AEV A;  4Q76 A;  5M4B A;  2BIE A;  2BHX A;  1IX6 A;  1G4V A;  3E2Y A;  4GE9 A;  4Q6R A;  3VP6 A;  4F5L A;  2CB1 A;  2QSR A;  4A72 A;  1V2D A;  1XI9 A;  2FNI A;  1B8G A;  5G4I A;  5M46 A;  1IAX A;  4NOG A;  3WKR A;  2DKB A;  3WZF A;  3MAF A;  4MQP A;  1LW4 A;  2BWP A;  4E3R A;  3MAF B;  2FNU A;  1WST A;  4OMA A;  3AEN B;  4W8I A;  2WK9 A;  2YKV A;  1C7O A;  5HXX A;  4RIZ A;  3A9Z A;  4Y0H A;  5JAY A;  3HQT A;  1GBN A;  3MEB A;  4OC9 A;  4ZLV A;  4WP0 A;  2RFV A;  2HUI A;  1LC7 A;  2HP1 A;  3LVJ A;  4U2H A;  2R0T A;  2PO3 A;  3FFR A;  2W8V A;  2YKY A;  4JEW A;  1MAP A;  2Q7W A;  4DBC A;  1KMJ A;  3ZZJ A;  3EI6 A;  3OP7 A;  2JJF A;  1N2T A;  1GC4 A;  1S0A A;  1QIS A;  3LWS A;  3BCA A;  4JF1 A;  1YJY A;  3QPG A;  4M2K A;  2YCN A;  1MGV A;  4TMR A;  4ZDO A;  1BJN A;  1KL1 A;  2PB0 A;  2HP2 A;  2VI9 A;  1BJ4 A;  4Y0D A;  4EB7 A;  2FKI A;  1PFF A;  1IJI A;  1MDO A;  2JJG A;  3AEM C;  3GJU A;  4ADB A;  1BW0 A;  5J8Q A;  3FTB A;  3BV0 A;  4A0H A;  3A9X A;  1B9H A;  2Z9U A;  1WYT A;  1DJE A;  2D5Y A;  2YHK A;  1WYT B;  3KGW A;  3ECD A;  3N75 A;  2HOX A;  3NYT A;  3PPL A;  4WYF A;  4AO4 A;  1QIT A;  2BIA A;  4HF8 A;  3WLX A;  4PIW A;  3FKD A;  2O0R A;  2W7K A;  1AHY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...