3BB8A

E1 dehydrase h220k mutant
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
436
structure length
420
Chain Sequence
SQEELRQQIAELVAQYAETAMAPKPFEAGKSVVPPSGKVIGTKELQLMVEASLDGWLTTGRFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTALTSPKLGVRALKPGDEVITVAAGFPTTVNPTIQNGLIPVFVDVDIPTYNVNASLIEAAVSDKTKAIMIAHTLGNLFDLAEVRRVADKYNLWLIEDCCDALGSTYDGKMAGTFGDIGTVSFYPAKHITMGEGGAVFTQSAELKSIIESFRDWGRDCQLGSLPFGYDHKYTYSHLGYNLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSDPSWFGFPITLKEDSGVSRIDLVKFLDEAKVGTRLLFAGNLTRQPYFHDVKYRVVGELTNTDRIMNQTFWIGIYPGLTHDHLDYVVSKFEEFFGLNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CDP-4-keto-6-deoxy-D-glucose-3-dehydrase
publication title E1 Dehydrase H220K Mutant
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Oxidoreductase
total genus 141
structure length 420
sequence length 436
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3bb8A01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3bb8A02
1ASMA 3TFUA 1AJSA 3A9XA 3FVXA 2QB3A 3N5MA 3PD6A 3HLMA 4OCAA 2CANA 3GJUA 1AMRA 1KKJA 3GETA 3A9ZA 1BT4A 3FQAA 3LG0A 4WLHA 2BI3A 4JEVA 2FQ6A 4R2NA 1W3UA 1SF2A 3CQ6A 1QJ5A 3HDOA 1LW4A 3BN1A 3FTBA 3ZZJA 1B8GA 3NUIA 3NU7A 3ELPA 5D5SA 2VI9A 4OMAA 4CBRA 4RM1A 2VLHA 1AHYA 3ATHA 4JEXA 5F8VA 1B5OA 1O61A 1QIRA 2HP1A 5EUEA 1YJYA 4WYGA 3TQXA 4DBCA 4BMKA 2W8VA 1DJ9A 4ZWMA 3ZRQA 4KAMA 1M7YA 2F8JA 1YJZA 4B98A 2AY1A 1D2FA 4Q76A 4AOAA 3HBXA 1ASFA 2E7JA 1BJOB 5DX5A 4RKCA 3NX3A 2GMUA 2O7CA 3OKSA 1ZODA 3MADA 2OKKA 1I29A 4CVQA 3BS8A 3QBOA 1QJ3A 1SZSA 4KYOA 1DGDA 1OXOA 3HMUA 2WK9A 4A00A 2CY8A 4P7YA 4DGTA 1AMQA 2GSAA 3FZ7A 3GR9A 3FZ6A 2BWPA 2AY6A 2AY4A 4UHNA 5M4DA 2HUIA 4A0HA 1JG8A 1T3IA 2HOXA 1BJOA 1KL2A 1AKAA 2JJGA 1UU2A 1AKBA 2QLRA 3AOVA 3RBLA 5E4ZA 3FFRA 9AATA 1GEXA 1V72A 3AEMA 5M4BA 3ZZKA 1S06A 1B9HA 3EUCA 4F5MA 3DR4A 4DQ6A 4Q31A 2XH1A 4U2HA 1FC4A 2ZY5A 3IHJA 5E5IA 2X8UA 2HUFA 4PFNA 1ASBA 1I41A 1M32A 3N0LA 3QI6A 5G4IA 5EUDA 4RKDA 4H51A 5IWQA 1M0PA 1W7MA 1JF9A 3OP7A 4WLJA 4XK1A 5AX8A 3GZDC 1SVVA 1AHEA 1UU0A 2BI2A 2WK7A 5HHYA 3DRDA 5K8BA 2CJHA 4W1WA 3G0TA 1LK9A 5M46A 1TARA 1TOIA 1TATA 2DGMA 2W7JA 2DOUA 4F5HA 2DKBA 1MDZA 2CINA 3FQ7A 2VMUA 4FFCA 5LHAA 5FT5A 4GSAA 1D7UA 4OBVA 1S08A 2YCTA 1EG5A 4XJOA 1GEYA 2OKJA 1GC0A 3LVMA 4UHMA 3W1JA 2VMQA 2ZP7A 1UKJA 3GWPA 3RCHB 4I8AA 1C7NA 3A9YA 4JE5A 3NRAA 3PGYA 2VGZA 1M0QA 5E3KA 1DJEA 1TOGA 2CTZA 1BJNA 3E2FA 2OATA 3F0HA 1ECXA 2D64A 4A0FA 1MLZA 1TOJA 2VGVA 3E6GA 2W7MA 3VAXA 2VGWA 1WYTB 2OQXA 4WYAA 3NTJA 3EI8A 4EU1A 3I16A 1ARTA 1O4SA 2W7EA 3AOWA 2CJGA 3KKIA 2X3LA 1ZC9A 4NOGA 4IXZA 3L8AA 1J04A 2BI9A 4RAEA 2W7DA 2NMPA 3DC1A 4ITXA 5G2PA 3AEJC 3QPGA 2V0YA 1W23A 1V2DA 1PFFA 4ITGA 1YNUA 4TMRA 3NU8A 2VMYA 3KGWA 1J32A 3G7QA 2HZPA 1WYTA 3DYDA 2QB2A 2ORDA 2YHKA 3TATA 4PFFA 3W1IA 3NYTA 2VMZA 3RUYA 3WY7A 3PDXA 2VMPA 2QBTA 2VMNA 2JGTA 2YKUA 3ISLA 3ZRRA 5BJ3A 3NUBA 1B9IA 2DGKA 1AX4A 2AY3A 3BV0A 3EIAA 3JWAA 5EAAA 4F4EA 4E3RA 2BWNA 1KMJA 2FNUA 2C7TA 3BC8A 1S09A 4R5ZA 1JS3A 1OHVA 3WX9A 7AATA 4MY5A 1CS1A 1PMOA 2YKYA 2JJHA 3DXWA 2Z9XA 5D95A 1MAPA 2C81A 2D7ZA 2R0TA 4XJLA 1BJWA 1KL1A 3MBBA 2BKWA 4WB0A 2JJEA 1V2FA 1E5FA 3LVLB 3WKSA 2WK8A 1AHGA 3AELA 2E7UA 4JF0A 1V2EA 1WYVB 5EFSA 1AMSA 1WKGA 4AH3A 2G6WA 3LY1A 4ADDA 4ATQA 1B5PA 3A8UX 4ZSYA 3RBFA 3HQTA 1DJUA 3QGUA 5F9SA 2PB2A 4GRXA 1CJ0A 4TN4A 3NYSA 1QGNA 4PVFA 3R9AA 1ASCA 1TOEA 1E5EA 2VIAA 1EQBA 2HUUA 3PAAA 4JEYA 4BA5A 2OGAA 3MAUA 3CQ5A 3BWNC 2BIAA 3FD0A 3H14A 3MC6A 1G4VA 1ZOBA 3N75A 3II0A 8AATA 2VMOA 4GE7A 4N0WA 2CSTA 2CJDA 2D7YA 2Z1ZA 2ZJGA 3GZCA 1AY5A 1GD9A 3H7FA 1ASGA 1WYVA 1OHWA 4IY7A 2YRIA 2AY2A 4ZDLA 1C9CA 1CL2A 3FFHA 3VP6A 1IX8A 1RVUA 1X2AA 1SZUA 4ZDPA 2HORA 3P1TA 1AAWA 2PB0A 3EI9A 1LC7A 4IX8A 4OBUA 3DXVA 4WYDA 4A0RA 3VOMA 4W1XA 1ARSA 2EH6A 1TPLA 2R5EA 4WP0A 1RV4A 1BW0A 1QISA 2D66A 1PMMA 3VK2A 4ADEA 3LWSA 1AKCA 1X28A 2AY7A 3FQ8A 1YAAA 3ASBA 3LV2A 1ARIA 2QA3A 1AMAA 2VLFA 3BCXA 2ZY2A 3CBFA 5HDMA 3RQ1A 1IJIA 1FG3A 1N2TA 2GB3A 3WCOA 2EZ2A 5HXXA 1IX7A 2VYCA 2EPJA 4W91A 4WXBA 2Z67A 5FT6A 4ISYA 4K2MA 5DJ9A 4ZM4A 1AAMA 1IUGA 1C7OA 4MQPA 1W7LA 1IAXA 5DJ1A 1UU1A 3ZRPA 3R4TA 5J8QA 3VK4A 1OXPA 1CZEA 3B46A 3GSBA 3AEMC 3PPLA 4EFFA 2BIEA 2DR1A 4WXGA 3TCMA 4JE5D 1B4XA 1AIBA 4W5KA 2D65A 3B1CA 1LKCA 2WKAA 1X29A 1GC3A 2BIGA 4AO4A 1GBNA 1G7WA 3JTXA 2W8UA 3FVSA 4CBSA 3EI6A 2CH1A 2FYFA 5TF5A 3L44A 3EIBA 3GBXA 1CQ7A 2AEUA 2HOYA 4HVKA 2W7FA 1FG7A 2TPLA 3RI6A 2W8WA 1I43A 4Y0DA 4EB5A 2ZYJA 3AEPA 3DODA 1VJOA 2BHXA 1GDEA 4J8LA 4ZM3A 4RJYA 1TASA 1PG8A 4MKKA 2EO5A 4UOYA 5FT8A 5JAYA 2Z9UA 4E3QA 2AY9A 3QN6A 3COGA 1LC5A 3FCRA 5DB5A 2W7LA 4MKJA 4LC3A 4JF1A 1M0OA 1ORDA 2BYJA 3MKJA 3FDBA 4UHOA 4XJMA 2AATA 1ASNA 2QMAA 1BKGA 3LVJA 4TV7A 4BQ0A 1VEFA 5BJ4A 3BCBA 1Z7DA 4E77A 1DGEA 2YRRA 3B1EA 5G4JA 2W8TA 1I48A 2Z9VA 3USFA 1AY4A 3AEJA 4R8DA 1M4NA 4CXQA 3AV7A 2E7IA 1YOOA 2CB1A 4Y0IA 4MSOA 4A6TA 3JU7A 1C7GA 1YIYA 2OGEA 3CAIA 4ADCA 3NYUA 3F9TA 4IXOA 1P3WA 3E9KA 4WB0B 3G8MA 4WXFA 3DR7A 2R5CB 3IF2A 4W1VA 1CQ8A 1ARGA 1TOKA 2VMRA 3JZLA 1ASDA 2CH2A 2AY5A 2ZC0A 3UWCA 4F5LA 1WYUA 1WKHA 5EIGB 4W8IA 2BWOA 1EJIA 2D63A 2W7IA 2W7HA 3UE8A 3Q8NA 2VMVA 4AO9A 1S0AA 3QHXA 4ATPA 4GE9A 4GDYA 2X5FA 1BS0A 2VGSA 4JEZA 4ZDOA 4XJPA 2BI1A 1IVRA 2YKXA 4FL0A 4UQVA 2R5CA 3VK3A 3FKDA 2AEVA 3F6TA 2Z1YA 4RITA 3FVUA 4XEWA 4Q75A 4M2MA 2D61A 1RV3A 5EIGA 2W7GA 3BCAA 4L0OA 1YJSA 4WYCA 4AZKA 3D6KA 1D7RA 4J5UA 1AY8A 4K2BA 1D7SA 1GEWA 1ASAA 2VMSA 3KE3A 1CQ6A 4OC9A 3E2ZA 5LH9A 1DKAA 4F5KA 3ECDA 2VGUA 2YKVA 3JW9A 4BHDA 4MQRA 3BWNA 1O69A 1KMKA 3EZ1A 4IW7A 3W1HA 1N8PA 4LNMA 4B9BA 3PDBA 3AEOA 3LVKA 5G2QA 2FN6A 4Q6RA 5G09A 4LW2A 1MDOA 3E2YA 2CFBA 3K7YA 4A0GA 4OT8A 4WD2A 1SZKA 1QZ9A 2VMXA 1H0CA 1SPAA 3B8XA 3PA9A 3ASAA 4CXRA 1YIZA 2VMTA 1QITA 1AHXA 2Z61A 1JS6A 4XQ2A 4PIWA 4HF8A 5M49A 1LC8A 3HL2A 3MAFB 1MLYA 2BYLA 1IX6A 4OYTA 1AHFA 2E54A 3I4JA 1LS3A 1G4XA 4R5FA 1C4KA 3EZSA 4LNJA 3MC6C 1AICA 4KXKA 3PIUA 2W7KA 2DGLA 1ASEA 1GCKA 1X0MA 4M2KA 1MDXA 2EZ1A 4OTLA 4M2JA 1LW5A 3T32A 3MEBA 1SFFA 3B1DA 2Z20A 4IXSA 3FZ8A 3FSLA 4MGRA 3ELEA 4ZASA 1O62A 2FM1A 3GZDA 3MAFA 4QGRA 1IBJA 1XEYA 4XAUA 2R2NA 2FNIA 1ARHA 1H1CA 3KGXA 4F5FA 2ZY4A 4Y0HA 1C0NA 2BI5A 1W7NA 1Z3ZA 4RJ0A 2C44A 2YCNA 4GEBA 3A2BA 1M6SA 4N0BA 4F5IA 5C6UA 3WGBA 4ZWVA 3P6KA 4EMYA 1DTYA 4MQQA 1BJ4A 4A6RA 4IYOB 2Q7WA 4WYEA 2RFVA 4RIZA 1GC4A 2VIBA 4E1OA 5FT4A 2C0RA 2JISA 2PO3A 4U1TA 4ZLVA 2ZY3A 2JJFA 1KKPA 2HP2A 3TFTA 4ZAHA 4WYFA 1WSTA 2JG2A 3PJ0A 3WLXA 1MAQA 1CZCA 2HOZA 4P3MA 3E77A 3QM2A 5G0AA 2VGTA 1N31A 1AIAA 5I92A 2XBNA 2O0RA 2GMSA 3WKRA 1BQDA 1MGVA 1ELQA 3EI7A 4LNLA 2W8JA 3WCNA 3NNKA 4RLGA 4IYOA 2D5YA 1WYUB 2VI8A 3K40A 1DFOA 1OHYA 5EUNA 3ACZA 1ELUA 4ADBA 3CQ4A 1CL1A 2ZSLA 3WGCA 1GC2A 4EB7A 2YOBA 3AENB 2Z9WA 4BA4A 1U08A 3HVYA 4O6ZA 4JEWA 2AY8A 3DZZA 3FRKA 3FDDA 1VP4A 2VMWA 3AATA 2ZSMA 3DU4A 1IAYA 4A72A 3M5UA 3BWOA 3RCHA 1OATA 4K2IA 1AJSB 4AZJA 1G7XA 3PD6B 1M0NA 3HT4A 4F5GA 4F5JA 2X5DA 4LW4A 1D7VA 1ASLA 2EGYA 3E2ZB 3AENA 3K28A 2YCPA 3WZFA 1AJRA 2GQNA 4ZSWA 1Y4IA 3JWBA 1XI9A 3BB8A 2V1PA 5EQCA 1S07A 3UAKA 1RVYA 2ZUKA 3NDNA 3PDBB 4A6UA 2DKJA 2O1BA 3EI5A 1BQAA 5EAVA 4GE4A 4WBTA 3I5TA
chains in the Genus database with same CATH superfamily
1ASMA 3TFUA 1AJSA 3A9XA 3FVXA 2QB3A 3N5MA 3PD6A 3HLMA 4OCAA 2CANA 3GJUA 1AMRA 1KKJA 3GETA 3A9ZA 1BT4A 3FQAA 3LG0A 4WLHA 2BI3A 4JEVA 2FQ6A 4R2NA 1W3UA 1SF2A 3CQ6A 1QJ5A 3N4XA 3HDOA 1LW4A 3BN1A 3FTBA 3ZZJA 1B8GA 3NUIA 3NU7A 3ELPA 5D5SA 2VI9A 4OMAA 4CBRA 4RM1A 2VLHA 1AHYA 3ATHA 4JEXA 5F8VA 1B5OA 1O61A 1QIRA 2HP1A 5EUEA 1YJYA 4WYGA 3TQXA 4DBCA 4BMKA 2W8VA 1DJ9A 4ZWMA 3ZRQA 4KAMA 1M7YA 2F8JA 1YJZA 4B98A 2AY1A 1D2FA 4Q76A 4AOAA 3HBXA 1ASFA 2E7JA 1BJOB 5DX5A 4RKCA 3NX3A 2GMUA 2O7CA 3OKSA 1ZODA 3MADA 2OKKA 1I29A 4CVQA 3BS8A 3QBOA 1QJ3A 1SZSA 4KYOA 1DGDA 1OXOA 3HMUA 2WK9A 4A00A 2CY8A 4P7YA 4DGTA 1AMQA 2GSAA 3FZ7A 3GR9A 3FZ6A 2BWPA 2AY6A 2AY4A 4UHNA 5M4DA 2HUIA 4A0HA 1JG8A 1T3IA 2HOXA 1BJOA 1KL2A 1AKAA 2JJGA 1UU2A 1AKBA 2QLRA 3AOVA 3RBLA 5E4ZA 3FFRA 9AATA 1GEXA 1V72A 3AEMA 5M4BA 3ZZKA 1S06A 1B9HA 3EUCA 4F5MA 3DR4A 4DQ6A 4Q31A 2XH1A 4U2HA 1FC4A 2ZY5A 3IHJA 5E5IA 2X8UA 2HUFA 4PFNA 2KFPA 1ASBA 1I41A 1M32A 3N0LA 3QI6A 5G4IA 5EUDA 4RKDA 4H51A 5IWQA 1M0PA 1W7MA 1JF9A 3OP7A 4WLJA 4XK1A 5AX8A 3GZDC 1SVVA 1AHEA 1UU0A 2BI2A 2WK7A 5HHYA 3DRDA 5K8BA 2CJHA 4W1WA 3G0TA 1LK9A 5M46A 1TARA 1TOIA 1TATA 2DGMA 2W7JA 2DOUA 4F5HA 2DKBA 1MDZA 2CINA 3FQ7A 2VMUA 4FFCA 5LHAA 5FT5A 4GSAA 1D7UA 4OBVA 1S08A 2YCTA 1EG5A 4XJOA 1GEYA 2OKJA 1GC0A 3LVMA 4UHMA 3W1JA 2VMQA 2ZP7A 1UKJA 3GWPA 3RCHB 4H63Q 4I8AA 1C7NA 3A9YA 4JE5A 2QSRA 3NRAA 3PGYA 2VGZA 1M0QA 5E3KA 1DJEA 1TOGA 2CTZA 1BJNA 3E2FA 2OATA 3F0HA 1ECXA 2D64A 4A0FA 1MLZA 1TOJA 2VGVA 3E6GA 2W7MA 3VAXA 2VGWA 1WYTB 2OQXA 4WYAA 3NTJA 3EI8A 4EU1A 3I16A 1ARTA 1O4SA 2W7EA 3AOWA 2CJGA 3KKIA 2X3LA 1ZC9A 4NOGA 4IXZA 3L8AA 1J04A 2BI9A 4RAEA 2W7DA 2NMPA 3DC1A 4ITXA 5G2PA 3AEJC 3QPGA 2V0YA 1W23A 1V2DA 1PFFA 4ITGA 5KTBA 1YNUA 4TMRA 3NU8A 2VMYA 3KGWA 1J32A 3G7QA 2HZPA 1WYTA 3DYDA 2QB2A 2ORDA 2YHKA 3TATA 4PFFA 3W1IA 3NYTA 2VMZA 1KAFA 3RUYA 3WY7A 3PDXA 2VMPA 2QBTA 2VMNA 2JGTA 2YKUA 3ISLA 3ZRRA 5BJ3A 3NUBA 1B9IA 2DGKA 1AX4A 2AY3A 3BV0A 3EIAA 3JWAA 5EAAA 4F4EA 4E3RA 2BWNA 1KMJA 2FNUA 2C7TA 3BC8A 1S09A 4R5ZA 1JS3A 1OHVA 3WX9A 7AATA 4MY5A 1CS1A 1PMOA 2YKYA 2JJHA 3DXWA 2Z9XA 5D95A 1MAPA 2C81A 2D7ZA 2R0TA 4XJLA 1BJWA 1KL1A 3MBBA 2BKWA 4WB0A 2JJEA 1V2FA 1E5FA 3LVLB 3WKSA 2WK8A 1AHGA 3AELA 2E7UA 4JF0A 1V2EA 1WYVB 5EFSA 1AMSA 1WKGA 4AH3A 2G6WA 3LY1A 4ADDA 4ATQA 1B5PA 3A8UX 4ZSYA 3RBFA 3HQTA 1DJUA 3QGUA 5F9SA 2PB2A 4GRXA 1CJ0A 4TN4A 3H9XA 3NYSA 1QGNA 4PVFA 3R9AA 1ASCA 1TOEA 1E5EA 2VIAA 1EQBA 2HUUA 3PAAA 4JEYA 4BA5A 2OGAA 3MAUA 3CQ5A 3BWNC 2BIAA 3FD0A 3H14A 3MC6A 1G4VA 1ZOBA 3N75A 3II0A 8AATA 2A1VA 2VMOA 4GE7A 4N0WA 2CSTA 2CJDA 2D7YA 2Z1ZA 2ZJGA 3GZCA 1AY5A 1GD9A 3H7FA 1ASGA 1WYVA 1OHWA 4IY7A 2YRIA 2AY2A 4ZDLA 1C9CA 1CL2A 3FFHA 3VP6A 1IX8A 1RVUA 1X2AA 1SZUA 4ZDPA 2HORA 3P1TA 1AAWA 2PB0A 3EI9A 1LC7A 4IX8A 4OBUA 3DXVA 4WYDA 4A0RA 3VOMA 4W1XA 1ARSA 2EH6A 1TPLA 2R5EA 4WP0A 1RV4A 1BW0A 1QISA 2D66A 1PMMA 3VK2A 4ADEA 3LWSA 1AKCA 1X28A 2AY7A 3FQ8A 1YAAA 3ASBA 3LV2A 1ARIA 2QA3A 1AMAA 2VLFA 3BCXA 2ZY2A 3CBFA 5HDMA 3RQ1A 1IJIA 1FG3A 1N2TA 2GB3A 3WCOA 2EZ2A 5HXXA 1IX7A 2VYCA 3N7NA 2EPJA 4W91A 4WXBA 2Z67A 5FT6A 4ISYA 4K2MA 5DJ9A 4ZM4A 1AAMA 1IUGA 1C7OA 4MQPA 1W7LA 1IAXA 5DJ1A 1UU1A 3ZRPA 3R4TA 5J8QA 3VK4A 1OXPA 1CZEA 3B46A 3GSBA 3AEMC 3PPLA 4EFFA 2BIEA 2DR1A 4WXGA 3TCMA 4JE5D 1B4XA 1AIBA 4W5KA 2D65A 3B1CA 1LKCA 2WKAA 4K05A 1X29A 1GC3A 2BIGA 4AO4A 1GBNA 1G7WA 3JTXA 2W8UA 3FVSA 4CBSA 3EI6A 2CH1A 2FYFA 5TF5A 3L44A 3EIBA 3GBXA 1CQ7A 2AEUA 2HOYA 4HVKA 2W7FA 1FG7A 2TPLA 3RI6A 2W8WA 1I43A 4Y0DA 4EB5A 2ZYJA 3AEPA 3DODA 1VJOA 2BHXA 1GDEA 4J8LA 4ZM3A 4RJYA 1TASA 1PG8A 4MKKA 2EO5A 4UOYA 5FT8A 5JAYA 2Z9UA 4E3QA 2AY9A 3QN6A 3COGA 1LC5A 3FCRA 5DB5A 2W7LA 4MKJA 4LC3A 4JF1A 1M0OA 1ORDA 2BYJA 3MKJA 3FDBA 4UHOA 4XJMA 2AATA 1ASNA 2QMAA 1BKGA 3LVJA 4TV7A 4BQ0A 1VEFA 5BJ4A 3BCBA 1Z7DA 4E77A 1DGEA 2YRRA 3B1EA 5G4JA 2W8TA 1I48A 2Z9VA 3USFA 1AY4A 3AEJA 4R8DA 1M4NA 4CXQA 3AV7A 2E7IA 1YOOA 2CB1A 4Y0IA 4MSOA 4A6TA 3JU7A 1C7GA 1YIYA 2OGEA 3CAIA 4ADCA 3NYUA 3F9TA 4IXOA 1P3WA 3E9KA 4WB0B 3G8MA 4WXFA 3DR7A 2R5CB 3IF2A 4W1VA 1CQ8A 1ARGA 1TOKA 2VMRA 3JZLA 1ASDA 2CH2A 2AY5A 2ZC0A 3UWCA 4F5LA 1WYUA 1WKHA 5EIGB 4W8IA 2BWOA 1EJIA 2D63A 2W7IA 2W7HA 3UE8A 3Q8NA 2VMVA 4AO9A 1S0AA 3QHXA 4ATPA 4GE9A 4GDYA 2X5FA 1BS0A 2VGSA 4JEZA 4ZDOA 4XJPA 2BI1A 1IVRA 2YKXA 4FL0A 4UQVA 2R5CA 3VK3A 3FKDA 2AEVA 3F6TA 2Z1YA 4RITA 3FVUA 4XEWA 3N4SA 4Q75A 4M2MA 2D61A 1RV3A 5EIGA 2W7GA 3BCAA 4L0OA 1YJSA 4WYCA 4AZKA 3D6KA 1D7RA 4J5UA 1AY8A 4K2BA 1D7SA 1GEWA 1ASAA 2VMSA 3KE3A 1CQ6A 4OC9A 3E2ZA 5LH9A 1DKAA 4F5KA 3ECDA 2VGUA 2YKVA 3JW9A 4BHDA 4MQRA 3BWNA 1O69A 1KMKA 3EZ1A 4IW7A 3W1HA 1N8PA 4LNMA 4B9BA 3PDBA 3AEOA 3LVKA 5G2QA 2FN6A 4Q6RA 5G09A 4LW2A 1MDOA 3E2YA 2CFBA 3K7YA 4A0GA 4OT8A 4WD2A 1SZKA 1QZ9A 2VMXA 1H0CA 1SPAA 3B8XA 3PA9A 3ASAA 4CXRA 1YIZA 2VMTA 1QITA 1AHXA 2Z61A 1JS6A 4XQ2A 4PIWA 4HF8A 5M49A 1LC8A 3HL2A 3MAFB 1MLYA 2BYLA 1IX6A 4OYTA 1AHFA 2E54A 3I4JA 1LS3A 1G4XA 4R5FA 1C4KA 3EZSA 4LNJA 3MC6C 1AICA 4KXKA 3PIUA 2W7KA 2DGLA 1ASEA 1GCKA 1X0MA 4M2KA 1MDXA 2EZ1A 4OTLA 4M2JA 1LW5A 3T32A 3MEBA 1SFFA 3B1DA 2Z20A 4IXSA 3FZ8A 3FSLA 4MGRA 3ELEA 4ZASA 1O62A 2FM1A 3GZDA 3MAFA 4QGRA 1IBJA 1XEYA 4XAUA 2R2NA 2FNIA 1ARHA 1H1CA 3KGXA 4F5FA 2ZY4A 4Y0HA 1C0NA 2BI5A 1W7NA 1Z3ZA 4RJ0A 2C44A 2YCNA 3N4RA 4GEBA 3A2BA 1M6SA 4N0BA 4F5IA 5C6UA 3WGBA 4ZWVA 3P6KA 4EMYA 1DTYA 4MQQA 1BJ4A 4A6RA 4IYOB 2Q7WA 4WYEA 2FKIA 2RFVA 4RIZA 1GC4A 2VIBA 4E1OA 5FT4A 2C0RA 2JISA 2PO3A 4U1TA 4ZLVA 2ZY3A 2JJFA 1KKPA 2HP2A 3TFTA 2EYQA 4ZAHA 4WYFA 1WSTA 2JG2A 3PJ0A 3WLXA 1MAQA 1CZCA 2HOZA 4P3MA 3E77A 3QM2A 5G0AA 2VGTA 1N31A 1AIAA 5I92A 2XBNA 2O0RA 2GMSA 3WKRA 1BQDA 1MGVA 1ELQA 3EI7A 4LNLA 2W8JA 3WCNA 3NNKA 4RLGA 4IYOA 2D5YA 1WYUB 2VI8A 3K40A 1DFOA 1OHYA 5EUNA 3ACZA 1ELUA 4ADBA 3CQ4A 1CL1A 2ZSLA 3WGCA 1GC2A 4EB7A 2YOBA 3AENB 2Z9WA 4BA4A 2G7JA 1U08A 3HVYA 4O6ZA 4JEWA 2AY8A 3DZZA 3FRKA 3FDDA 1VP4A 2VMWA 3AATA 2ZSMA 3DU4A 1IAYA 4A72A 3M5UA 3BWOA 3RCHA 1OATA 4K2IA 1AJSB 4AZJA 1G7XA 3PD6B 1M0NA 3HT4A 4F5GA 4F5JA 2X5DA 4LW4A 1D7VA 1ASLA 2EGYA 2WB6A 3E2ZB 3AENA 3K28A 2YCPA 3WZFA 1AJRA 2GQNA 4ZSWA 1Y4IA 3JWBA 1XI9A 3BB8A 2V1PA 5EQCA 1S07A 3UAKA 1RVYA 2ZUKA 3NDNA 3PDBB 4A6UA 2DKJA 2O1BA 3EI5A 1BQAA 5EAVA 4GE4A 4WBTA 3I5TA
chains in the Genus database with same CATH topology
1ASMA 3TFUA 1AJSA 3A9XA 3FVXA 2QB3A 3N5MA 3PD6A 3HLMA 4OCAA 2CANA 3GJUA 1AMRA 1KKJA 3GETA 3A9ZA 1BT4A 3FQAA 3LG0A 4WLHA 2BI3A 4JEVA 2FQ6A 4R2NA 1W3UA 1SF2A 3CQ6A 1QJ5A 3N4XA 3HDOA 1LW4A 3BN1A 3FTBA 3ZZJA 1B8GA 3NUIA 3NU7A 3ELPA 5D5SA 2VI9A 4OMAA 4CBRA 4RM1A 2VLHA 1AHYA 3ATHA 4JEXA 5F8VA 1B5OA 1O61A 1QIRA 2HP1A 5EUEA 1YJYA 4WYGA 3TQXA 4DBCA 4BMKA 2W8VA 1DJ9A 4ZWMA 3ZRQA 4KAMA 1M7YA 2F8JA 1YJZA 4B98A 2AY1A 1D2FA 4Q76A 4AOAA 3HBXA 1ASFA 2E7JA 1BJOB 5DX5A 4RKCA 3NX3A 2GMUA 2O7CA 3OKSA 1ZODA 3MADA 2OKKA 1I29A 4CVQA 3BS8A 3QBOA 1QJ3A 1SZSA 4KYOA 1DGDA 1OXOA 3HMUA 2WK9A 4A00A 2CY8A 4P7YA 4DGTA 1AMQA 2GSAA 3FZ7A 3GR9A 3FZ6A 2BWPA 2AY6A 2AY4A 4UHNA 5M4DA 2HUIA 4A0HA 1JG8A 1T3IA 2HOXA 1BJOA 1KL2A 1AKAA 2JJGA 1UU2A 1AKBA 2QLRA 3AOVA 3RBLA 5E4ZA 3FFRA 9AATA 1GEXA 1V72A 3AEMA 5M4BA 3ZZKA 1S06A 1B9HA 3EUCA 4F5MA 3DR4A 4DQ6A 4Q31A 2XH1A 4U2HA 1FC4A 2ZY5A 3IHJA 5E5IA 2X8UA 2HUFA 4PFNA 2KFPA 1ASBA 1I41A 1M32A 3N0LA 3QI6A 5G4IA 5EUDA 4RKDA 4H51A 5IWQA 1M0PA 1W7MA 1JF9A 3OP7A 4WLJA 4XK1A 5AX8A 3GZDC 1SVVA 1AHEA 1UU0A 2BI2A 2WK7A 5HHYA 3DRDA 5K8BA 2CJHA 4W1WA 3G0TA 1LK9A 5M46A 1TARA 1TOIA 1TATA 2DGMA 2W7JA 2DOUA 4F5HA 2DKBA 1MDZA 2CINA 3FQ7A 2VMUA 4FFCA 5LHAA 5FT5A 4GSAA 1D7UA 4OBVA 1S08A 2YCTA 1EG5A 4XJOA 1GEYA 2OKJA 1GC0A 3LVMA 4UHMA 3W1JA 2VMQA 2ZP7A 1UKJA 3GWPA 3RCHB 4H63Q 4I8AA 1C7NA 3A9YA 4JE5A 2QSRA 3NRAA 3PGYA 2VGZA 1M0QA 5E3KA 1DJEA 1TOGA 2CTZA 1BJNA 3E2FA 2OATA 3F0HA 1ECXA 2D64A 4A0FA 1MLZA 1TOJA 2VGVA 3E6GA 2W7MA 3VAXA 2VGWA 1WYTB 2OQXA 4WYAA 3NTJA 3EI8A 4EU1A 3I16A 1ARTA 1O4SA 2W7EA 3AOWA 2CJGA 3KKIA 2X3LA 1ZC9A 4NOGA 4IXZA 3L8AA 1J04A 2BI9A 4RAEA 2W7DA 2NMPA 3DC1A 4ITXA 5G2PA 3AEJC 3QPGA 2V0YA 1W23A 1V2DA 1PFFA 4ITGA 5KTBA 1YNUA 4TMRA 3NU8A 2VMYA 3KGWA 1J32A 3G7QA 2HZPA 1WYTA 3DYDA 2QB2A 2ORDA 2YHKA 3TATA 4PFFA 3W1IA 3NYTA 2VMZA 3RUYA 3WY7A 3PDXA 2VMPA 2QBTA 2VMNA 2JGTA 2YKUA 3ISLA 3ZRRA 5BJ3A 3NUBA 1B9IA 2DGKA 1AX4A 2AY3A 3BV0A 3EIAA 3JWAA 5EAAA 4F4EA 4E3RA 2BWNA 1KMJA 2FNUA 2C7TA 3BC8A 1S09A 4R5ZA 1JS3A 1OHVA 3WX9A 7AATA 4MY5A 1CS1A 1PMOA 2YKYA 2JJHA 3DXWA 2Z9XA 5D95A 1MAPA 2C81A 2D7ZA 2R0TA 4XJLA 1BJWA 1KL1A 3MBBA 2BKWA 4WB0A 2JJEA 1V2FA 1E5FA 3LVLB 3WKSA 2WK8A 1AHGA 3AELA 2E7UA 4JF0A 1V2EA 1WYVB 5EFSA 1AMSA 1WKGA 4AH3A 2G6WA 3LY1A 4ADDA 4ATQA 1B5PA 3A8UX 4ZSYA 3RBFA 3HQTA 1DJUA 3QGUA 5F9SA 2PB2A 4GRXA 1CJ0A 4TN4A 3H9XA 3NYSA 1QGNA 4PVFA 3R9AA 1ASCA 1TOEA 1E5EA 2VIAA 1EQBA 2HUUA 3PAAA 4JEYA 4BA5A 2OGAA 3MAUA 3CQ5A 3BWNC 2BIAA 3FD0A 3H14A 3MC6A 1G4VA 1ZOBA 3N75A 3II0A 8AATA 2A1VA 2VMOA 4GE7A 4N0WA 2CSTA 2CJDA 2D7YA 2Z1ZA 2ZJGA 3GZCA 1AY5A 1GD9A 3H7FA 1ASGA 1WYVA 1OHWA 4IY7A 2YRIA 2AY2A 4ZDLA 1C9CA 1CL2A 3FFHA 3VP6A 1IX8A 1RVUA 1X2AA 1SZUA 4ZDPA 2HORA 3P1TA 1AAWA 2PB0A 3EI9A 1LC7A 4IX8A 4OBUA 3DXVA 4WYDA 4A0RA 3VOMA 4W1XA 1ARSA 2EH6A 1TPLA 2R5EA 4WP0A 1RV4A 1BW0A 1QISA 2D66A 1PMMA 3VK2A 4ADEA 3LWSA 1AKCA 1X28A 2AY7A 3FQ8A 1YAAA 3ASBA 3LV2A 1ARIA 2QA3A 1AMAA 2VLFA 3BCXA 2ZY2A 3CBFA 5HDMA 3RQ1A 1IJIA 1FG3A 1N2TA 2GB3A 3WCOA 2EZ2A 5HXXA 1IX7A 2VYCA 3N7NA 2EPJA 4W91A 4WXBA 2Z67A 5FT6A 4ISYA 4K2MA 5DJ9A 4ZM4A 1AAMA 1IUGA 1C7OA 4MQPA 1W7LA 1IAXA 5DJ1A 1UU1A 3ZRPA 3R4TA 5J8QA 3VK4A 1OXPA 1CZEA 3B46A 3GSBA 3AEMC 3PPLA 4EFFA 2BIEA 2DR1A 4WXGA 3TCMA 4JE5D 1B4XA 1AIBA 4W5KA 2D65A 3B1CA 1LKCA 2WKAA 4K05A 1X29A 1GC3A 2BIGA 4AO4A 1GBNA 1G7WA 3JTXA 2W8UA 3FVSA 4CBSA 3EI6A 2CH1A 2FYFA 5TF5A 3L44A 3EIBA 3GBXA 1CQ7A 2AEUA 2HOYA 4HVKA 2W7FA 1FG7A 2TPLA 3RI6A 2W8WA 1I43A 4Y0DA 4EB5A 2ZYJA 3AEPA 3DODA 1VJOA 2BHXA 1GDEA 4J8LA 4ZM3A 4RJYA 1TASA 1PG8A 4MKKA 2EO5A 4UOYA 5FT8A 5JAYA 2Z9UA 4E3QA 2AY9A 3QN6A 3COGA 1LC5A 3FCRA 5DB5A 2W7LA 4MKJA 4LC3A 4JF1A 1M0OA 1ORDA 2BYJA 3MKJA 3FDBA 4UHOA 4XJMA 2AATA 1ASNA 2QMAA 1BKGA 3LVJA 4TV7A 4BQ0A 1VEFA 5BJ4A 3BCBA 1Z7DA 4E77A 1DGEA 2YRRA 3B1EA 5G4JA 2W8TA 1I48A 2Z9VA 3USFA 1AY4A 3AEJA 4R8DA 1M4NA 4CXQA 3AV7A 2E7IA 1YOOA 2CB1A 4Y0IA 4MSOA 4A6TA 3JU7A 1C7GA 1YIYA 2OGEA 3CAIA 4ADCA 3NYUA 3F9TA 4IXOA 1P3WA 3E9KA 4WB0B 3G8MA 4WXFA 3DR7A 2R5CB 3IF2A 4W1VA 1CQ8A 1ARGA 1TOKA 2VMRA 3JZLA 1ASDA 2CH2A 2AY5A 2ZC0A 3UWCA 4F5LA 1WYUA 1WKHA 5EIGB 4W8IA 2BWOA 1EJIA 2D63A 2W7IA 2W7HA 3UE8A 3Q8NA 2VMVA 4AO9A 1S0AA 3QHXA 4ATPA 4GE9A 4GDYA 2X5FA 1BS0A 2VGSA 4JEZA 4ZDOA 4XJPA 2BI1A 1IVRA 2YKXA 4FL0A 4UQVA 2R5CA 3VK3A 3FKDA 2AEVA 3F6TA 2Z1YA 4RITA 3FVUA 4XEWA 3N4SA 4Q75A 4M2MA 2D61A 1RV3A 5EIGA 2W7GA 3BCAA 4L0OA 1YJSA 4WYCA 4AZKA 3D6KA 1D7RA 4J5UA 1AY8A 4K2BA 1D7SA 1GEWA 1ASAA 2VMSA 3KE3A 1CQ6A 4OC9A 3E2ZA 5LH9A 1DKAA 4F5KA 3ECDA 2VGUA 2YKVA 3JW9A 4BHDA 4MQRA 3BWNA 1O69A 1KMKA 3EZ1A 4IW7A 3W1HA 1N8PA 4LNMA 4B9BA 3PDBA 3AEOA 3LVKA 5G2QA 2FN6A 4Q6RA 5G09A 4LW2A 1MDOA 3E2YA 2CFBA 3K7YA 4A0GA 4OT8A 4WD2A 1SZKA 1QZ9A 2VMXA 1H0CA 1SPAA 3B8XA 3PA9A 3ASAA 4CXRA 1YIZA 2VMTA 1QITA 1AHXA 2Z61A 1JS6A 4XQ2A 4PIWA 4HF8A 5M49A 1LC8A 3HL2A 3MAFB 1MLYA 2BYLA 1IX6A 4OYTA 1AHFA 2E54A 3I4JA 1LS3A 1G4XA 4R5FA 1C4KA 3EZSA 4LNJA 3MC6C 1AICA 4KXKA 3PIUA 2W7KA 2DGLA 1ASEA 1GCKA 1X0MA 4M2KA 1MDXA 2EZ1A 4OTLA 4M2JA 1LW5A 3T32A 3MEBA 1SFFA 3B1DA 2Z20A 4IXSA 3FZ8A 3FSLA 4MGRA 3ELEA 4ZASA 1O62A 2FM1A 3GZDA 3MAFA 4QGRA 1IBJA 1XEYA 4XAUA 2R2NA 2FNIA 1ARHA 1H1CA 3KGXA 4F5FA 2ZY4A 4Y0HA 1C0NA 2BI5A 1W7NA 1Z3ZA 4RJ0A 2C44A 2YCNA 3N4RA 4GEBA 3A2BA 1M6SA 4N0BA 4F5IA 5C6UA 3WGBA 4ZWVA 3P6KA 4EMYA 1DTYA 4MQQA 1BJ4A 4A6RA 4IYOB 2Q7WA 4WYEA 2FKIA 2RFVA 4RIZA 1GC4A 2VIBA 4E1OA 5FT4A 2C0RA 2JISA 2PO3A 4U1TA 4ZLVA 2ZY3A 2JJFA 1KKPA 2HP2A 3TFTA 2EYQA 4ZAHA 4WYFA 1WSTA 2JG2A 3PJ0A 3WLXA 1MAQA 1CZCA 2HOZA 4P3MA 3E77A 3QM2A 5G0AA 2VGTA 1N31A 1AIAA 5I92A 2XBNA 2O0RA 2GMSA 3WKRA 1BQDA 1MGVA 1ELQA 3EI7A 4LNLA 2W8JA 3WCNA 3NNKA 4RLGA 4IYOA 2D5YA 1WYUB 2VI8A 3K40A 1DFOA 1OHYA 5EUNA 3ACZA 1ELUA 4ADBA 3CQ4A 1CL1A 2ZSLA 3WGCA 1GC2A 4EB7A 2YOBA 3AENB 2Z9WA 4BA4A 2G7JA 1U08A 3HVYA 4O6ZA 4JEWA 2AY8A 3DZZA 3FRKA 3FDDA 1VP4A 2VMWA 3AATA 2ZSMA 3DU4A 1IAYA 4A72A 3M5UA 3BWOA 3RCHA 1OATA 4K2IA 1AJSB 4AZJA 1G7XA 3PD6B 1M0NA 3HT4A 4F5GA 4F5JA 2X5DA 4LW4A 1D7VA 1ASLA 2EGYA 2WB6A 3E2ZB 3AENA 3K28A 2YCPA 3WZFA 1AJRA 2GQNA 4ZSWA 1Y4IA 3JWBA 1XI9A 3BB8A 2V1PA 5EQCA 1S07A 3UAKA 1RVYA 2ZUKA 3NDNA 3PDBB 4A6UA 2DKJA 2O1BA 3EI5A 1BQAA 5EAVA 4GE4A 4WBTA 3I5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASM A;  3TFU A;  1AJS A;  3A9X A;  3FVX A;  2QB3 A;  3N5M A;  3PD6 A;  3HLM A;  4OCA A;  2CAN A;  3GJU A;  1AMR A;  1KKJ A;  3GET A;  3A9Z A;  1BT4 A;  3FQA A;  3LG0 A;  4WLH A;  2BI3 A;  4JEV A;  2FQ6 A;  4R2N A;  1W3U A;  1SF2 A;  3CQ6 A;  1QJ5 A;  3HDO A;  1LW4 A;  3BN1 A;  3FTB A;  3ZZJ A;  1B8G A;  3NUI A;  3NU7 A;  3ELP A;  5D5S A;  2VI9 A;  4OMA A;  4CBR A;  4RM1 A;  2VLH A;  1AHY A;  3ATH A;  4JEX A;  5F8V A;  1B5O A;  1O61 A;  1QIR A;  2HP1 A;  5EUE A;  1YJY A;  4WYG A;  3TQX A;  4DBC A;  4BMK A;  2W8V A;  1DJ9 A;  4ZWM A;  3ZRQ A;  4KAM A;  1M7Y A;  2F8J A;  1YJZ A;  4B98 A;  2AY1 A;  1D2F A;  4Q76 A;  4AOA A;  3HBX A;  1ASF A;  2E7J A;  1BJO B;  5DX5 A;  4RKC A;  3NX3 A;  2GMU A;  2O7C A;  3OKS A;  1ZOD A;  3MAD A;  2OKK A;  1I29 A;  4CVQ A;  3BS8 A;  3QBO A;  1QJ3 A;  1SZS A;  4KYO A;  1DGD A;  1OXO A;  3HMU A;  2WK9 A;  4A00 A;  2CY8 A;  4P7Y A;  4DGT A;  1AMQ A;  2GSA A;  3FZ7 A;  3GR9 A;  3FZ6 A;  2BWP A;  2AY6 A;  2AY4 A;  4UHN A;  5M4D A;  2HUI A;  4A0H A;  1JG8 A;  1T3I A;  2HOX A;  1BJO A;  1KL2 A;  1AKA A;  2JJG A;  1UU2 A;  1AKB A;  2QLR A;  3AOV A;  3RBL A;  5E4Z A;  3FFR A;  9AAT A;  1GEX A;  1V72 A;  3AEM A;  5M4B A;  3ZZK A;  1S06 A;  1B9H A;  3EUC A;  4F5M A;  3DR4 A;  4DQ6 A;  4Q31 A;  2XH1 A;  4U2H A;  1FC4 A;  2ZY5 A;  3IHJ A;  5E5I A;  2X8U A;  2HUF A;  4PFN A;  1ASB A;  1I41 A;  1M32 A;  3N0L A;  3QI6 A;  5G4I A;  5EUD A;  4RKD A;  4H51 A;  5IWQ A;  1M0P A;  1W7M A;  1JF9 A;  3OP7 A;  4WLJ A;  4XK1 A;  5AX8 A;  3GZD C;  1SVV A;  1AHE A;  1UU0 A;  2BI2 A;  2WK7 A;  5HHY A;  3DRD A;  5K8B A;  2CJH A;  4W1W A;  3G0T A;  1LK9 A;  5M46 A;  1TAR A;  1TOI A;  1TAT A;  2DGM A;  2W7J A;  2DOU A;  4F5H A;  2DKB A;  1MDZ A;  2CIN A;  3FQ7 A;  2VMU A;  4FFC A;  5LHA A;  5FT5 A;  4GSA A;  1D7U A;  4OBV A;  1S08 A;  2YCT A;  1EG5 A;  4XJO A;  1GEY A;  2OKJ A;  1GC0 A;  3LVM A;  4UHM A;  3W1J A;  2VMQ A;  2ZP7 A;  1UKJ A;  3GWP A;  3RCH B;  4I8A A;  1C7N A;  3A9Y A;  4JE5 A;  3NRA A;  3PGY A;  2VGZ A;  1M0Q A;  5E3K A;  1DJE A;  1TOG A;  2CTZ A;  1BJN A;  3E2F A;  2OAT A;  3F0H A;  1ECX A;  2D64 A;  4A0F A;  1MLZ A;  1TOJ A;  2VGV A;  3E6G A;  2W7M A;  3VAX A;  2VGW A;  1WYT B;  2OQX A;  4WYA A;  3NTJ A;  3EI8 A;  4EU1 A;  3I16 A;  1ART A;  1O4S A;  2W7E A;  3AOW A;  2CJG A;  3KKI A;  2X3L A;  1ZC9 A;  4NOG A;  4IXZ A;  3L8A A;  1J04 A;  2BI9 A;  4RAE A;  2W7D A;  2NMP A;  3DC1 A;  4ITX A;  5G2P A;  3AEJ C;  3QPG A;  2V0Y A;  1W23 A;  1V2D A;  1PFF A;  4ITG A;  1YNU A;  4TMR A;  3NU8 A;  2VMY A;  3KGW A;  1J32 A;  3G7Q A;  2HZP A;  1WYT A;  3DYD A;  2QB2 A;  2ORD A;  2YHK A;  3TAT A;  4PFF A;  3W1I A;  3NYT A;  2VMZ A;  3RUY A;  3WY7 A;  3PDX A;  2VMP A;  2QBT A;  2VMN A;  2JGT A;  2YKU A;  3ISL A;  3ZRR A;  5BJ3 A;  3NUB A;  1B9I A;  2DGK A;  1AX4 A;  2AY3 A;  3BV0 A;  3EIA A;  3JWA A;  5EAA A;  4F4E A;  4E3R A;  2BWN A;  1KMJ A;  2FNU A;  2C7T A;  3BC8 A;  1S09 A;  4R5Z A;  1JS3 A;  1OHV A;  3WX9 A;  7AAT A;  4MY5 A;  1CS1 A;  1PMO A;  2YKY A;  2JJH A;  3DXW A;  2Z9X A;  5D95 A;  1MAP A;  2C81 A;  2D7Z A;  2R0T A;  4XJL A;  1BJW A;  1KL1 A;  3MBB A;  2BKW A;  4WB0 A;  2JJE A;  1V2F A;  1E5F A;  3LVL B;  3WKS A;  2WK8 A;  1AHG A;  3AEL A;  2E7U A;  4JF0 A;  1V2E A;  1WYV B;  5EFS A;  1AMS A;  1WKG A;  4AH3 A;  2G6W A;  3LY1 A;  4ADD A;  4ATQ A;  1B5P A;  3A8U X;  4ZSY A;  3RBF A;  3HQT A;  1DJU A;  3QGU A;  5F9S A;  2PB2 A;  4GRX A;  1CJ0 A;  4TN4 A;  3NYS A;  1QGN A;  4PVF A;  3R9A A;  1ASC A;  1TOE A;  1E5E A;  2VIA A;  1EQB A;  2HUU A;  3PAA A;  4JEY A;  4BA5 A;  2OGA A;  3MAU A;  3CQ5 A;  3BWN C;  2BIA A;  3FD0 A;  3H14 A;  3MC6 A;  1G4V A;  1ZOB A;  3N75 A;  3II0 A;  8AAT A;  2VMO A;  4GE7 A;  4N0W A;  2CST A;  2CJD A;  2D7Y A;  2Z1Z A;  2ZJG A;  3GZC A;  1AY5 A;  1GD9 A;  3H7F A;  1ASG A;  1WYV A;  1OHW A;  4IY7 A;  2YRI A;  2AY2 A;  4ZDL A;  1C9C A;  1CL2 A;  3FFH A;  3VP6 A;  1IX8 A;  1RVU A;  1X2A A;  1SZU A;  4ZDP A;  2HOR A;  3P1T A;  1AAW A;  2PB0 A;  3EI9 A;  1LC7 A;  4IX8 A;  4OBU A;  3DXV A;  4WYD A;  4A0R A;  3VOM A;  4W1X A;  1ARS A;  2EH6 A;  1TPL A;  2R5E A;  4WP0 A;  1RV4 A;  1BW0 A;  1QIS A;  2D66 A;  1PMM A;  3VK2 A;  4ADE A;  3LWS A;  1AKC A;  1X28 A;  2AY7 A;  3FQ8 A;  1YAA A;  3ASB A;  3LV2 A;  1ARI A;  2QA3 A;  1AMA A;  2VLF A;  3BCX A;  2ZY2 A;  3CBF A;  5HDM A;  3RQ1 A;  1IJI A;  1FG3 A;  1N2T A;  2GB3 A;  3WCO A;  2EZ2 A;  5HXX A;  1IX7 A;  2VYC A;  2EPJ A;  4W91 A;  4WXB A;  2Z67 A;  5FT6 A;  4ISY A;  4K2M A;  5DJ9 A;  4ZM4 A;  1AAM A;  1IUG A;  1C7O A;  4MQP A;  1W7L A;  1IAX A;  5DJ1 A;  1UU1 A;  3ZRP A;  3R4T A;  5J8Q A;  3VK4 A;  1OXP A;  1CZE A;  3B46 A;  3GSB A;  3AEM C;  3PPL A;  4EFF A;  2BIE A;  2DR1 A;  4WXG A;  3TCM A;  4JE5 D;  1B4X A;  1AIB A;  4W5K A;  2D65 A;  3B1C A;  1LKC A;  2WKA A;  1X29 A;  1GC3 A;  2BIG A;  4AO4 A;  1GBN A;  1G7W A;  3JTX A;  2W8U A;  3FVS A;  4CBS A;  3EI6 A;  2CH1 A;  2FYF A;  5TF5 A;  3L44 A;  3EIB A;  3GBX A;  1CQ7 A;  2AEU A;  2HOY A;  4HVK A;  2W7F A;  1FG7 A;  2TPL A;  3RI6 A;  2W8W A;  1I43 A;  4Y0D A;  4EB5 A;  2ZYJ A;  3AEP A;  3DOD A;  1VJO A;  2BHX A;  1GDE A;  4J8L A;  4ZM3 A;  4RJY A;  1TAS A;  1PG8 A;  4MKK A;  2EO5 A;  4UOY A;  5FT8 A;  5JAY A;  2Z9U A;  4E3Q A;  2AY9 A;  3QN6 A;  3COG A;  1LC5 A;  3FCR A;  5DB5 A;  2W7L A;  4MKJ A;  4LC3 A;  4JF1 A;  1M0O A;  1ORD A;  2BYJ A;  3MKJ A;  3FDB A;  4UHO A;  4XJM A;  2AAT A;  1ASN A;  2QMA A;  1BKG A;  3LVJ A;  4TV7 A;  4BQ0 A;  1VEF A;  5BJ4 A;  3BCB A;  1Z7D A;  4E77 A;  1DGE A;  2YRR A;  3B1E A;  5G4J A;  2W8T A;  1I48 A;  2Z9V A;  3USF A;  1AY4 A;  3AEJ A;  4R8D A;  1M4N A;  4CXQ A;  3AV7 A;  2E7I A;  1YOO A;  2CB1 A;  4Y0I A;  4MSO A;  4A6T A;  3JU7 A;  1C7G A;  1YIY A;  2OGE A;  3CAI A;  4ADC A;  3NYU A;  3F9T A;  4IXO A;  1P3W A;  3E9K A;  4WB0 B;  3G8M A;  4WXF A;  3DR7 A;  2R5C B;  3IF2 A;  4W1V A;  1CQ8 A;  1ARG A;  1TOK A;  2VMR A;  3JZL A;  1ASD A;  2CH2 A;  2AY5 A;  2ZC0 A;  3UWC A;  4F5L A;  1WYU A;  1WKH A;  5EIG B;  4W8I A;  2BWO A;  1EJI A;  2D63 A;  2W7I A;  2W7H A;  3UE8 A;  3Q8N A;  2VMV A;  4AO9 A;  1S0A A;  3QHX A;  4ATP A;  4GE9 A;  4GDY A;  2X5F A;  1BS0 A;  2VGS A;  4JEZ A;  4ZDO A;  4XJP A;  2BI1 A;  1IVR A;  2YKX A;  4FL0 A;  4UQV A;  2R5C A;  3VK3 A;  3FKD A;  2AEV A;  3F6T A;  2Z1Y A;  4RIT A;  3FVU A;  4XEW A;  4Q75 A;  4M2M A;  2D61 A;  1RV3 A;  5EIG A;  2W7G A;  3BCA A;  4L0O A;  1YJS A;  4WYC A;  4AZK A;  3D6K A;  1D7R A;  4J5U A;  1AY8 A;  4K2B A;  1D7S A;  1GEW A;  1ASA A;  2VMS A;  3KE3 A;  1CQ6 A;  4OC9 A;  3E2Z A;  5LH9 A;  1DKA A;  4F5K A;  3ECD A;  2VGU A;  2YKV A;  3JW9 A;  4BHD A;  4MQR A;  3BWN A;  1O69 A;  1KMK A;  3EZ1 A;  4IW7 A;  3W1H A;  1N8P A;  4LNM A;  4B9B A;  3PDB A;  3AEO A;  3LVK A;  5G2Q A;  2FN6 A;  4Q6R A;  5G09 A;  4LW2 A;  1MDO A;  3E2Y A;  2CFB A;  3K7Y A;  4A0G A;  4OT8 A;  4WD2 A;  1SZK A;  1QZ9 A;  2VMX A;  1H0C A;  1SPA A;  3B8X A;  3PA9 A;  3ASA A;  4CXR A;  1YIZ A;  2VMT A;  1QIT A;  1AHX A;  2Z61 A;  1JS6 A;  4XQ2 A;  4PIW A;  4HF8 A;  5M49 A;  1LC8 A;  3HL2 A;  3MAF B;  1MLY A;  2BYL A;  1IX6 A;  4OYT A;  1AHF A;  2E54 A;  3I4J A;  1LS3 A;  1G4X A;  4R5F A;  1C4K A;  3EZS A;  4LNJ A;  3MC6 C;  1AIC A;  4KXK A;  3PIU A;  2W7K A;  2DGL A;  1ASE A;  1GCK A;  1X0M A;  4M2K A;  1MDX A;  2EZ1 A;  4OTL A;  4M2J A;  1LW5 A;  3T32 A;  3MEB A;  1SFF A;  3B1D A;  2Z20 A;  4IXS A;  3FZ8 A;  3FSL A;  4MGR A;  3ELE A;  4ZAS A;  1O62 A;  2FM1 A;  3GZD A;  3MAF A;  4QGR A;  1IBJ A;  1XEY A;  4XAU A;  2R2N A;  2FNI A;  1ARH A;  1H1C A;  3KGX A;  4F5F A;  2ZY4 A;  4Y0H A;  1C0N A;  2BI5 A;  1W7N A;  1Z3Z A;  4RJ0 A;  2C44 A;  2YCN A;  4GEB A;  3A2B A;  1M6S A;  4N0B A;  4F5I A;  5C6U A;  3WGB A;  4ZWV A;  3P6K A;  4EMY A;  1DTY A;  4MQQ A;  1BJ4 A;  4A6R A;  4IYO B;  2Q7W A;  4WYE A;  2RFV A;  4RIZ A;  1GC4 A;  2VIB A;  4E1O A;  5FT4 A;  2C0R A;  2JIS A;  2PO3 A;  4U1T A;  4ZLV A;  2ZY3 A;  2JJF A;  1KKP A;  2HP2 A;  3TFT A;  4ZAH A;  4WYF A;  1WST A;  2JG2 A;  3PJ0 A;  3WLX A;  1MAQ A;  1CZC A;  2HOZ A;  4P3M A;  3E77 A;  3QM2 A;  5G0A A;  2VGT A;  1N31 A;  1AIA A;  5I92 A;  2XBN A;  2O0R A;  2GMS A;  3WKR A;  1BQD A;  1MGV A;  1ELQ A;  3EI7 A;  4LNL A;  2W8J A;  3WCN A;  3NNK A;  4RLG A;  4IYO A;  2D5Y A;  1WYU B;  2VI8 A;  3K40 A;  1DFO A;  1OHY A;  5EUN A;  3ACZ A;  1ELU A;  4ADB A;  3CQ4 A;  1CL1 A;  2ZSL A;  3WGC A;  1GC2 A;  4EB7 A;  2YOB A;  3AEN B;  2Z9W A;  4BA4 A;  1U08 A;  3HVY A;  4O6Z A;  4JEW A;  2AY8 A;  3DZZ A;  3FRK A;  3FDD A;  1VP4 A;  2VMW A;  3AAT A;  2ZSM A;  3DU4 A;  1IAY A;  4A72 A;  3M5U A;  3BWO A;  3RCH A;  1OAT A;  4K2I A;  1AJS B;  4AZJ A;  1G7X A;  3PD6 B;  1M0N A;  3HT4 A;  4F5G A;  4F5J A;  2X5D A;  4LW4 A;  1D7V A;  1ASL A;  2EGY A;  3E2Z B;  3AEN A;  3K28 A;  2YCP A;  3WZF A;  1AJR A;  2GQN A;  4ZSW A;  1Y4I A;  3JWB A;  1XI9 A;  3BB8 A;  2V1P A;  5EQC A;  1S07 A;  3UAK A;  1RVY A;  2ZUK A;  3NDN A;  3PDB B;  4A6U A;  2DKJ A;  2O1B A;  3EI5 A;  1BQA A;  5EAV A;  4GE4 A;  4WBT A;  3I5T A; 
#chains in the Genus database with same CATH topology
 1ASM A;  3TFU A;  1AJS A;  3A9X A;  3FVX A;  2QB3 A;  3N5M A;  3PD6 A;  3HLM A;  4OCA A;  2CAN A;  3GJU A;  1AMR A;  1KKJ A;  3GET A;  3A9Z A;  1BT4 A;  3FQA A;  3LG0 A;  4WLH A;  2BI3 A;  4JEV A;  2FQ6 A;  4R2N A;  1W3U A;  1SF2 A;  3CQ6 A;  1QJ5 A;  3N4X A;  3HDO A;  1LW4 A;  3BN1 A;  3FTB A;  3ZZJ A;  1B8G A;  3NUI A;  3NU7 A;  3ELP A;  5D5S A;  2VI9 A;  4OMA A;  4CBR A;  4RM1 A;  2VLH A;  1AHY A;  3ATH A;  4JEX A;  5F8V A;  1B5O A;  1O61 A;  1QIR A;  2HP1 A;  5EUE A;  1YJY A;  4WYG A;  3TQX A;  4DBC A;  4BMK A;  2W8V A;  1DJ9 A;  4ZWM A;  3ZRQ A;  4KAM A;  1M7Y A;  2F8J A;  1YJZ A;  4B98 A;  2AY1 A;  1D2F A;  4Q76 A;  4AOA A;  3HBX A;  1ASF A;  2E7J A;  1BJO B;  5DX5 A;  4RKC A;  3NX3 A;  2GMU A;  2O7C A;  3OKS A;  1ZOD A;  3MAD A;  2OKK A;  1I29 A;  4CVQ A;  3BS8 A;  3QBO A;  1QJ3 A;  1SZS A;  4KYO A;  1DGD A;  1OXO A;  3HMU A;  2WK9 A;  4A00 A;  2CY8 A;  4P7Y A;  4DGT A;  1AMQ A;  2GSA A;  3FZ7 A;  3GR9 A;  3FZ6 A;  2BWP A;  2AY6 A;  2AY4 A;  4UHN A;  5M4D A;  2HUI A;  4A0H A;  1JG8 A;  1T3I A;  2HOX A;  1BJO A;  1KL2 A;  1AKA A;  2JJG A;  1UU2 A;  1AKB A;  2QLR A;  3AOV A;  3RBL A;  5E4Z A;  3FFR A;  9AAT A;  1GEX A;  1V72 A;  3AEM A;  5M4B A;  3ZZK A;  1S06 A;  1B9H A;  3EUC A;  4F5M A;  3DR4 A;  4DQ6 A;  4Q31 A;  2XH1 A;  4U2H A;  1FC4 A;  2ZY5 A;  3IHJ A;  5E5I A;  2X8U A;  2HUF A;  4PFN A;  2KFP A;  1ASB A;  1I41 A;  1M32 A;  3N0L A;  3QI6 A;  5G4I A;  5EUD A;  4RKD A;  4H51 A;  5IWQ A;  1M0P A;  1W7M A;  1JF9 A;  3OP7 A;  4WLJ A;  4XK1 A;  5AX8 A;  3GZD C;  1SVV A;  1AHE A;  1UU0 A;  2BI2 A;  2WK7 A;  5HHY A;  3DRD A;  5K8B A;  2CJH A;  4W1W A;  3G0T A;  1LK9 A;  5M46 A;  1TAR A;  1TOI A;  1TAT A;  2DGM A;  2W7J A;  2DOU A;  4F5H A;  2DKB A;  1MDZ A;  2CIN A;  3FQ7 A;  2VMU A;  4FFC A;  5LHA A;  5FT5 A;  4GSA A;  1D7U A;  4OBV A;  1S08 A;  2YCT A;  1EG5 A;  4XJO A;  1GEY A;  2OKJ A;  1GC0 A;  3LVM A;  4UHM A;  3W1J A;  2VMQ A;  2ZP7 A;  1UKJ A;  3GWP A;  3RCH B;  4H63 Q;  4I8A A;  1C7N A;  3A9Y A;  4JE5 A;  2QSR A;  3NRA A;  3PGY A;  2VGZ A;  1M0Q A;  5E3K A;  1DJE A;  1TOG A;  2CTZ A;  1BJN A;  3E2F A;  2OAT A;  3F0H A;  1ECX A;  2D64 A;  4A0F A;  1MLZ A;  1TOJ A;  2VGV A;  3E6G A;  2W7M A;  3VAX A;  2VGW A;  1WYT B;  2OQX A;  4WYA A;  3NTJ A;  3EI8 A;  4EU1 A;  3I16 A;  1ART A;  1O4S A;  2W7E A;  3AOW A;  2CJG A;  3KKI A;  2X3L A;  1ZC9 A;  4NOG A;  4IXZ A;  3L8A A;  1J04 A;  2BI9 A;  4RAE A;  2W7D A;  2NMP A;  3DC1 A;  4ITX A;  5G2P A;  3AEJ C;  3QPG A;  2V0Y A;  1W23 A;  1V2D A;  1PFF A;  4ITG A;  5KTB A;  1YNU A;  4TMR A;  3NU8 A;  2VMY A;  3KGW A;  1J32 A;  3G7Q A;  2HZP A;  1WYT A;  3DYD A;  2QB2 A;  2ORD A;  2YHK A;  3TAT A;  4PFF A;  3W1I A;  3NYT A;  2VMZ A;  1KAF A;  3RUY A;  3WY7 A;  3PDX A;  2VMP A;  2QBT A;  2VMN A;  2JGT A;  2YKU A;  3ISL A;  3ZRR A;  5BJ3 A;  3NUB A;  1B9I A;  2DGK A;  1AX4 A;  2AY3 A;  3BV0 A;  3EIA A;  3JWA A;  5EAA A;  4F4E A;  4E3R A;  2BWN A;  1KMJ A;  2FNU A;  2C7T A;  3BC8 A;  1S09 A;  4R5Z A;  1JS3 A;  1OHV A;  3WX9 A;  7AAT A;  4MY5 A;  1CS1 A;  1PMO A;  2YKY A;  2JJH A;  3DXW A;  2Z9X A;  5D95 A;  1MAP A;  2C81 A;  2D7Z A;  2R0T A;  4XJL A;  1BJW A;  1KL1 A;  3MBB A;  2BKW A;  4WB0 A;  2JJE A;  1V2F A;  1E5F A;  3LVL B;  3WKS A;  2WK8 A;  1AHG A;  3AEL A;  2E7U A;  4JF0 A;  1V2E A;  1WYV B;  5EFS A;  1AMS A;  1WKG A;  4AH3 A;  2G6W A;  3LY1 A;  4ADD A;  4ATQ A;  1B5P A;  3A8U X;  4ZSY A;  3RBF A;  3HQT A;  1DJU A;  3QGU A;  5F9S A;  2PB2 A;  4GRX A;  1CJ0 A;  4TN4 A;  3H9X A;  3NYS A;  1QGN A;  4PVF A;  3R9A A;  1ASC A;  1TOE A;  1E5E A;  2VIA A;  1EQB A;  2HUU A;  3PAA A;  4JEY A;  4BA5 A;  2OGA A;  3MAU A;  3CQ5 A;  3BWN C;  2BIA A;  3FD0 A;  3H14 A;  3MC6 A;  1G4V A;  1ZOB A;  3N75 A;  3II0 A;  8AAT A;  2A1V A;  2VMO A;  4GE7 A;  4N0W A;  2CST A;  2CJD A;  2D7Y A;  2Z1Z A;  2ZJG A;  3GZC A;  1AY5 A;  1GD9 A;  3H7F A;  1ASG A;  1WYV A;  1OHW A;  4IY7 A;  2YRI A;  2AY2 A;  4ZDL A;  1C9C A;  1CL2 A;  3FFH A;  3VP6 A;  1IX8 A;  1RVU A;  1X2A A;  1SZU A;  4ZDP A;  2HOR A;  3P1T A;  1AAW A;  2PB0 A;  3EI9 A;  1LC7 A;  4IX8 A;  4OBU A;  3DXV A;  4WYD A;  4A0R A;  3VOM A;  4W1X A;  1ARS A;  2EH6 A;  1TPL A;  2R5E A;  4WP0 A;  1RV4 A;  1BW0 A;  1QIS A;  2D66 A;  1PMM A;  3VK2 A;  4ADE A;  3LWS A;  1AKC A;  1X28 A;  2AY7 A;  3FQ8 A;  1YAA A;  3ASB A;  3LV2 A;  1ARI A;  2QA3 A;  1AMA A;  2VLF A;  3BCX A;  2ZY2 A;  3CBF A;  5HDM A;  3RQ1 A;  1IJI A;  1FG3 A;  1N2T A;  2GB3 A;  3WCO A;  2EZ2 A;  5HXX A;  1IX7 A;  2VYC A;  3N7N A;  2EPJ A;  4W91 A;  4WXB A;  2Z67 A;  5FT6 A;  4ISY A;  4K2M A;  5DJ9 A;  4ZM4 A;  1AAM A;  1IUG A;  1C7O A;  4MQP A;  1W7L A;  1IAX A;  5DJ1 A;  1UU1 A;  3ZRP A;  3R4T A;  5J8Q A;  3VK4 A;  1OXP A;  1CZE A;  3B46 A;  3GSB A;  3AEM C;  3PPL A;  4EFF A;  2BIE A;  2DR1 A;  4WXG A;  3TCM A;  4JE5 D;  1B4X A;  1AIB A;  4W5K A;  2D65 A;  3B1C A;  1LKC A;  2WKA A;  4K05 A;  1X29 A;  1GC3 A;  2BIG A;  4AO4 A;  1GBN A;  1G7W A;  3JTX A;  2W8U A;  3FVS A;  4CBS A;  3EI6 A;  2CH1 A;  2FYF A;  5TF5 A;  3L44 A;  3EIB A;  3GBX A;  1CQ7 A;  2AEU A;  2HOY A;  4HVK A;  2W7F A;  1FG7 A;  2TPL A;  3RI6 A;  2W8W A;  1I43 A;  4Y0D A;  4EB5 A;  2ZYJ A;  3AEP A;  3DOD A;  1VJO A;  2BHX A;  1GDE A;  4J8L A;  4ZM3 A;  4RJY A;  1TAS A;  1PG8 A;  4MKK A;  2EO5 A;  4UOY A;  5FT8 A;  5JAY A;  2Z9U A;  4E3Q A;  2AY9 A;  3QN6 A;  3COG A;  1LC5 A;  3FCR A;  5DB5 A;  2W7L A;  4MKJ A;  4LC3 A;  4JF1 A;  1M0O A;  1ORD A;  2BYJ A;  3MKJ A;  3FDB A;  4UHO A;  4XJM A;  2AAT A;  1ASN A;  2QMA A;  1BKG A;  3LVJ A;  4TV7 A;  4BQ0 A;  1VEF A;  5BJ4 A;  3BCB A;  1Z7D A;  4E77 A;  1DGE A;  2YRR A;  3B1E A;  5G4J A;  2W8T A;  1I48 A;  2Z9V A;  3USF A;  1AY4 A;  3AEJ A;  4R8D A;  1M4N A;  4CXQ A;  3AV7 A;  2E7I A;  1YOO A;  2CB1 A;  4Y0I A;  4MSO A;  4A6T A;  3JU7 A;  1C7G A;  1YIY A;  2OGE A;  3CAI A;  4ADC A;  3NYU A;  3F9T A;  4IXO A;  1P3W A;  3E9K A;  4WB0 B;  3G8M A;  4WXF A;  3DR7 A;  2R5C B;  3IF2 A;  4W1V A;  1CQ8 A;  1ARG A;  1TOK A;  2VMR A;  3JZL A;  1ASD A;  2CH2 A;  2AY5 A;  2ZC0 A;  3UWC A;  4F5L A;  1WYU A;  1WKH A;  5EIG B;  4W8I A;  2BWO A;  1EJI A;  2D63 A;  2W7I A;  2W7H A;  3UE8 A;  3Q8N A;  2VMV A;  4AO9 A;  1S0A A;  3QHX A;  4ATP A;  4GE9 A;  4GDY A;  2X5F A;  1BS0 A;  2VGS A;  4JEZ A;  4ZDO A;  4XJP A;  2BI1 A;  1IVR A;  2YKX A;  4FL0 A;  4UQV A;  2R5C A;  3VK3 A;  3FKD A;  2AEV A;  3F6T A;  2Z1Y A;  4RIT A;  3FVU A;  4XEW A;  3N4S A;  4Q75 A;  4M2M A;  2D61 A;  1RV3 A;  5EIG A;  2W7G A;  3BCA A;  4L0O A;  1YJS A;  4WYC A;  4AZK A;  3D6K A;  1D7R A;  4J5U A;  1AY8 A;  4K2B A;  1D7S A;  1GEW A;  1ASA A;  2VMS A;  3KE3 A;  1CQ6 A;  4OC9 A;  3E2Z A;  5LH9 A;  1DKA A;  4F5K A;  3ECD A;  2VGU A;  2YKV A;  3JW9 A;  4BHD A;  4MQR A;  3BWN A;  1O69 A;  1KMK A;  3EZ1 A;  4IW7 A;  3W1H A;  1N8P A;  4LNM A;  4B9B A;  3PDB A;  3AEO A;  3LVK A;  5G2Q A;  2FN6 A;  4Q6R A;  5G09 A;  4LW2 A;  1MDO A;  3E2Y A;  2CFB A;  3K7Y A;  4A0G A;  4OT8 A;  4WD2 A;  1SZK A;  1QZ9 A;  2VMX A;  1H0C A;  1SPA A;  3B8X A;  3PA9 A;  3ASA A;  4CXR A;  1YIZ A;  2VMT A;  1QIT A;  1AHX A;  2Z61 A;  1JS6 A;  4XQ2 A;  4PIW A;  4HF8 A;  5M49 A;  1LC8 A;  3HL2 A;  3MAF B;  1MLY A;  2BYL A;  1IX6 A;  4OYT A;  1AHF A;  2E54 A;  3I4J A;  1LS3 A;  1G4X A;  4R5F A;  1C4K A;  3EZS A;  4LNJ A;  3MC6 C;  1AIC A;  4KXK A;  3PIU A;  2W7K A;  2DGL A;  1ASE A;  1GCK A;  1X0M A;  4M2K A;  1MDX A;  2EZ1 A;  4OTL A;  4M2J A;  1LW5 A;  3T32 A;  3MEB A;  1SFF A;  3B1D A;  2Z20 A;  4IXS A;  3FZ8 A;  3FSL A;  4MGR A;  3ELE A;  4ZAS A;  1O62 A;  2FM1 A;  3GZD A;  3MAF A;  4QGR A;  1IBJ A;  1XEY A;  4XAU A;  2R2N A;  2FNI A;  1ARH A;  1H1C A;  3KGX A;  4F5F A;  2ZY4 A;  4Y0H A;  1C0N A;  2BI5 A;  1W7N A;  1Z3Z A;  4RJ0 A;  2C44 A;  2YCN A;  3N4R A;  4GEB A;  3A2B A;  1M6S A;  4N0B A;  4F5I A;  5C6U A;  3WGB A;  4ZWV A;  3P6K A;  4EMY A;  1DTY A;  4MQQ A;  1BJ4 A;  4A6R A;  4IYO B;  2Q7W A;  4WYE A;  2FKI A;  2RFV A;  4RIZ A;  1GC4 A;  2VIB A;  4E1O A;  5FT4 A;  2C0R A;  2JIS A;  2PO3 A;  4U1T A;  4ZLV A;  2ZY3 A;  2JJF A;  1KKP A;  2HP2 A;  3TFT A;  2EYQ A;  4ZAH A;  4WYF A;  1WST A;  2JG2 A;  3PJ0 A;  3WLX A;  1MAQ A;  1CZC A;  2HOZ A;  4P3M A;  3E77 A;  3QM2 A;  5G0A A;  2VGT A;  1N31 A;  1AIA A;  5I92 A;  2XBN A;  2O0R A;  2GMS A;  3WKR A;  1BQD A;  1MGV A;  1ELQ A;  3EI7 A;  4LNL A;  2W8J A;  3WCN A;  3NNK A;  4RLG A;  4IYO A;  2D5Y A;  1WYU B;  2VI8 A;  3K40 A;  1DFO A;  1OHY A;  5EUN A;  3ACZ A;  1ELU A;  4ADB A;  3CQ4 A;  1CL1 A;  2ZSL A;  3WGC A;  1GC2 A;  4EB7 A;  2YOB A;  3AEN B;  2Z9W A;  4BA4 A;  2G7J A;  1U08 A;  3HVY A;  4O6Z A;  4JEW A;  2AY8 A;  3DZZ A;  3FRK A;  3FDD A;  1VP4 A;  2VMW A;  3AAT A;  2ZSM A;  3DU4 A;  1IAY A;  4A72 A;  3M5U A;  3BWO A;  3RCH A;  1OAT A;  4K2I A;  1AJS B;  4AZJ A;  1G7X A;  3PD6 B;  1M0N A;  3HT4 A;  4F5G A;  4F5J A;  2X5D A;  4LW4 A;  1D7V A;  1ASL A;  2EGY A;  2WB6 A;  3E2Z B;  3AEN A;  3K28 A;  2YCP A;  3WZF A;  1AJR A;  2GQN A;  4ZSW A;  1Y4I A;  3JWB A;  1XI9 A;  3BB8 A;  2V1P A;  5EQC A;  1S07 A;  3UAK A;  1RVY A;  2ZUK A;  3NDN A;  3PDB B;  4A6U A;  2DKJ A;  2O1B A;  3EI5 A;  1BQA A;  5EAV A;  4GE4 A;  4WBT A;  3I5T A; 
#chains in the Genus database with same CATH homology
 1ASM A;  3TFU A;  1AJS A;  3A9X A;  3FVX A;  2QB3 A;  3N5M A;  3PD6 A;  3HLM A;  4OCA A;  2CAN A;  3GJU A;  1AMR A;  1KKJ A;  3GET A;  3A9Z A;  1BT4 A;  3FQA A;  3LG0 A;  4WLH A;  2BI3 A;  4JEV A;  2FQ6 A;  4R2N A;  1W3U A;  1SF2 A;  3CQ6 A;  1QJ5 A;  3N4X A;  3HDO A;  1LW4 A;  3BN1 A;  3FTB A;  3ZZJ A;  1B8G A;  3NUI A;  3NU7 A;  3ELP A;  5D5S A;  2VI9 A;  4OMA A;  4CBR A;  4RM1 A;  2VLH A;  1AHY A;  3ATH A;  4JEX A;  5F8V A;  1B5O A;  1O61 A;  1QIR A;  2HP1 A;  5EUE A;  1YJY A;  4WYG A;  3TQX A;  4DBC A;  4BMK A;  2W8V A;  1DJ9 A;  4ZWM A;  3ZRQ A;  4KAM A;  1M7Y A;  2F8J A;  1YJZ A;  4B98 A;  2AY1 A;  1D2F A;  4Q76 A;  4AOA A;  3HBX A;  1ASF A;  2E7J A;  1BJO B;  5DX5 A;  4RKC A;  3NX3 A;  2GMU A;  2O7C A;  3OKS A;  1ZOD A;  3MAD A;  2OKK A;  1I29 A;  4CVQ A;  3BS8 A;  3QBO A;  1QJ3 A;  1SZS A;  4KYO A;  1DGD A;  1OXO A;  3HMU A;  2WK9 A;  4A00 A;  2CY8 A;  4P7Y A;  4DGT A;  1AMQ A;  2GSA A;  3FZ7 A;  3GR9 A;  3FZ6 A;  2BWP A;  2AY6 A;  2AY4 A;  4UHN A;  5M4D A;  2HUI A;  4A0H A;  1JG8 A;  1T3I A;  2HOX A;  1BJO A;  1KL2 A;  1AKA A;  2JJG A;  1UU2 A;  1AKB A;  2QLR A;  3AOV A;  3RBL A;  5E4Z A;  3FFR A;  9AAT A;  1GEX A;  1V72 A;  3AEM A;  5M4B A;  3ZZK A;  1S06 A;  1B9H A;  3EUC A;  4F5M A;  3DR4 A;  4DQ6 A;  4Q31 A;  2XH1 A;  4U2H A;  1FC4 A;  2ZY5 A;  3IHJ A;  5E5I A;  2X8U A;  2HUF A;  4PFN A;  2KFP A;  1ASB A;  1I41 A;  1M32 A;  3N0L A;  3QI6 A;  5G4I A;  5EUD A;  4RKD A;  4H51 A;  5IWQ A;  1M0P A;  1W7M A;  1JF9 A;  3OP7 A;  4WLJ A;  4XK1 A;  5AX8 A;  3GZD C;  1SVV A;  1AHE A;  1UU0 A;  2BI2 A;  2WK7 A;  5HHY A;  3DRD A;  5K8B A;  2CJH A;  4W1W A;  3G0T A;  1LK9 A;  5M46 A;  1TAR A;  1TOI A;  1TAT A;  2DGM A;  2W7J A;  2DOU A;  4F5H A;  2DKB A;  1MDZ A;  2CIN A;  3FQ7 A;  2VMU A;  4FFC A;  5LHA A;  5FT5 A;  4GSA A;  1D7U A;  4OBV A;  1S08 A;  2YCT A;  1EG5 A;  4XJO A;  1GEY A;  2OKJ A;  1GC0 A;  3LVM A;  4UHM A;  3W1J A;  2VMQ A;  2ZP7 A;  1UKJ A;  3GWP A;  3RCH B;  4H63 Q;  4I8A A;  1C7N A;  3A9Y A;  4JE5 A;  2QSR A;  3NRA A;  3PGY A;  2VGZ A;  1M0Q A;  5E3K A;  1DJE A;  1TOG A;  2CTZ A;  1BJN A;  3E2F A;  2OAT A;  3F0H A;  1ECX A;  2D64 A;  4A0F A;  1MLZ A;  1TOJ A;  2VGV A;  3E6G A;  2W7M A;  3VAX A;  2VGW A;  1WYT B;  2OQX A;  4WYA A;  3NTJ A;  3EI8 A;  4EU1 A;  3I16 A;  1ART A;  1O4S A;  2W7E A;  3AOW A;  2CJG A;  3KKI A;  2X3L A;  1ZC9 A;  4NOG A;  4IXZ A;  3L8A A;  1J04 A;  2BI9 A;  4RAE A;  2W7D A;  2NMP A;  3DC1 A;  4ITX A;  5G2P A;  3AEJ C;  3QPG A;  2V0Y A;  1W23 A;  1V2D A;  1PFF A;  4ITG A;  5KTB A;  1YNU A;  4TMR A;  3NU8 A;  2VMY A;  3KGW A;  1J32 A;  3G7Q A;  2HZP A;  1WYT A;  3DYD A;  2QB2 A;  2ORD A;  2YHK A;  3TAT A;  4PFF A;  3W1I A;  3NYT A;  2VMZ A;  3RUY A;  3WY7 A;  3PDX A;  2VMP A;  2QBT A;  2VMN A;  2JGT A;  2YKU A;  3ISL A;  3ZRR A;  5BJ3 A;  3NUB A;  1B9I A;  2DGK A;  1AX4 A;  2AY3 A;  3BV0 A;  3EIA A;  3JWA A;  5EAA A;  4F4E A;  4E3R A;  2BWN A;  1KMJ A;  2FNU A;  2C7T A;  3BC8 A;  1S09 A;  4R5Z A;  1JS3 A;  1OHV A;  3WX9 A;  7AAT A;  4MY5 A;  1CS1 A;  1PMO A;  2YKY A;  2JJH A;  3DXW A;  2Z9X A;  5D95 A;  1MAP A;  2C81 A;  2D7Z A;  2R0T A;  4XJL A;  1BJW A;  1KL1 A;  3MBB A;  2BKW A;  4WB0 A;  2JJE A;  1V2F A;  1E5F A;  3LVL B;  3WKS A;  2WK8 A;  1AHG A;  3AEL A;  2E7U A;  4JF0 A;  1V2E A;  1WYV B;  5EFS A;  1AMS A;  1WKG A;  4AH3 A;  2G6W A;  3LY1 A;  4ADD A;  4ATQ A;  1B5P A;  3A8U X;  4ZSY A;  3RBF A;  3HQT A;  1DJU A;  3QGU A;  5F9S A;  2PB2 A;  4GRX A;  1CJ0 A;  4TN4 A;  3H9X A;  3NYS A;  1QGN A;  4PVF A;  3R9A A;  1ASC A;  1TOE A;  1E5E A;  2VIA A;  1EQB A;  2HUU A;  3PAA A;  4JEY A;  4BA5 A;  2OGA A;  3MAU A;  3CQ5 A;  3BWN C;  2BIA A;  3FD0 A;  3H14 A;  3MC6 A;  1G4V A;  1ZOB A;  3N75 A;  3II0 A;  8AAT A;  2A1V A;  2VMO A;  4GE7 A;  4N0W A;  2CST A;  2CJD A;  2D7Y A;  2Z1Z A;  2ZJG A;  3GZC A;  1AY5 A;  1GD9 A;  3H7F A;  1ASG A;  1WYV A;  1OHW A;  4IY7 A;  2YRI A;  2AY2 A;  4ZDL A;  1C9C A;  1CL2 A;  3FFH A;  3VP6 A;  1IX8 A;  1RVU A;  1X2A A;  1SZU A;  4ZDP A;  2HOR A;  3P1T A;  1AAW A;  2PB0 A;  3EI9 A;  1LC7 A;  4IX8 A;  4OBU A;  3DXV A;  4WYD A;  4A0R A;  3VOM A;  4W1X A;  1ARS A;  2EH6 A;  1TPL A;  2R5E A;  4WP0 A;  1RV4 A;  1BW0 A;  1QIS A;  2D66 A;  1PMM A;  3VK2 A;  4ADE A;  3LWS A;  1AKC A;  1X28 A;  2AY7 A;  3FQ8 A;  1YAA A;  3ASB A;  3LV2 A;  1ARI A;  2QA3 A;  1AMA A;  2VLF A;  3BCX A;  2ZY2 A;  3CBF A;  5HDM A;  3RQ1 A;  1IJI A;  1FG3 A;  1N2T A;  2GB3 A;  3WCO A;  2EZ2 A;  5HXX A;  1IX7 A;  2VYC A;  3N7N A;  2EPJ A;  4W91 A;  4WXB A;  2Z67 A;  5FT6 A;  4ISY A;  4K2M A;  5DJ9 A;  4ZM4 A;  1AAM A;  1IUG A;  1C7O A;  4MQP A;  1W7L A;  1IAX A;  5DJ1 A;  1UU1 A;  3ZRP A;  3R4T A;  5J8Q A;  3VK4 A;  1OXP A;  1CZE A;  3B46 A;  3GSB A;  3AEM C;  3PPL A;  4EFF A;  2BIE A;  2DR1 A;  4WXG A;  3TCM A;  4JE5 D;  1B4X A;  1AIB A;  4W5K A;  2D65 A;  3B1C A;  1LKC A;  2WKA A;  4K05 A;  1X29 A;  1GC3 A;  2BIG A;  4AO4 A;  1GBN A;  1G7W A;  3JTX A;  2W8U A;  3FVS A;  4CBS A;  3EI6 A;  2CH1 A;  2FYF A;  5TF5 A;  3L44 A;  3EIB A;  3GBX A;  1CQ7 A;  2AEU A;  2HOY A;  4HVK A;  2W7F A;  1FG7 A;  2TPL A;  3RI6 A;  2W8W A;  1I43 A;  4Y0D A;  4EB5 A;  2ZYJ A;  3AEP A;  3DOD A;  1VJO A;  2BHX A;  1GDE A;  4J8L A;  4ZM3 A;  4RJY A;  1TAS A;  1PG8 A;  4MKK A;  2EO5 A;  4UOY A;  5FT8 A;  5JAY A;  2Z9U A;  4E3Q A;  2AY9 A;  3QN6 A;  3COG A;  1LC5 A;  3FCR A;  5DB5 A;  2W7L A;  4MKJ A;  4LC3 A;  4JF1 A;  1M0O A;  1ORD A;  2BYJ A;  3MKJ A;  3FDB A;  4UHO A;  4XJM A;  2AAT A;  1ASN A;  2QMA A;  1BKG A;  3LVJ A;  4TV7 A;  4BQ0 A;  1VEF A;  5BJ4 A;  3BCB A;  1Z7D A;  4E77 A;  1DGE A;  2YRR A;  3B1E A;  5G4J A;  2W8T A;  1I48 A;  2Z9V A;  3USF A;  1AY4 A;  3AEJ A;  4R8D A;  1M4N A;  4CXQ A;  3AV7 A;  2E7I A;  1YOO A;  2CB1 A;  4Y0I A;  4MSO A;  4A6T A;  3JU7 A;  1C7G A;  1YIY A;  2OGE A;  3CAI A;  4ADC A;  3NYU A;  3F9T A;  4IXO A;  1P3W A;  3E9K A;  4WB0 B;  3G8M A;  4WXF A;  3DR7 A;  2R5C B;  3IF2 A;  4W1V A;  1CQ8 A;  1ARG A;  1TOK A;  2VMR A;  3JZL A;  1ASD A;  2CH2 A;  2AY5 A;  2ZC0 A;  3UWC A;  4F5L A;  1WYU A;  1WKH A;  5EIG B;  4W8I A;  2BWO A;  1EJI A;  2D63 A;  2W7I A;  2W7H A;  3UE8 A;  3Q8N A;  2VMV A;  4AO9 A;  1S0A A;  3QHX A;  4ATP A;  4GE9 A;  4GDY A;  2X5F A;  1BS0 A;  2VGS A;  4JEZ A;  4ZDO A;  4XJP A;  2BI1 A;  1IVR A;  2YKX A;  4FL0 A;  4UQV A;  2R5C A;  3VK3 A;  3FKD A;  2AEV A;  3F6T A;  2Z1Y A;  4RIT A;  3FVU A;  4XEW A;  3N4S A;  4Q75 A;  4M2M A;  2D61 A;  1RV3 A;  5EIG A;  2W7G A;  3BCA A;  4L0O A;  1YJS A;  4WYC A;  4AZK A;  3D6K A;  1D7R A;  4J5U A;  1AY8 A;  4K2B A;  1D7S A;  1GEW A;  1ASA A;  2VMS A;  3KE3 A;  1CQ6 A;  4OC9 A;  3E2Z A;  5LH9 A;  1DKA A;  4F5K A;  3ECD A;  2VGU A;  2YKV A;  3JW9 A;  4BHD A;  4MQR A;  3BWN A;  1O69 A;  1KMK A;  3EZ1 A;  4IW7 A;  3W1H A;  1N8P A;  4LNM A;  4B9B A;  3PDB A;  3AEO A;  3LVK A;  5G2Q A;  2FN6 A;  4Q6R A;  5G09 A;  4LW2 A;  1MDO A;  3E2Y A;  2CFB A;  3K7Y A;  4A0G A;  4OT8 A;  4WD2 A;  1SZK A;  1QZ9 A;  2VMX A;  1H0C A;  1SPA A;  3B8X A;  3PA9 A;  3ASA A;  4CXR A;  1YIZ A;  2VMT A;  1QIT A;  1AHX A;  2Z61 A;  1JS6 A;  4XQ2 A;  4PIW A;  4HF8 A;  5M49 A;  1LC8 A;  3HL2 A;  3MAF B;  1MLY A;  2BYL A;  1IX6 A;  4OYT A;  1AHF A;  2E54 A;  3I4J A;  1LS3 A;  1G4X A;  4R5F A;  1C4K A;  3EZS A;  4LNJ A;  3MC6 C;  1AIC A;  4KXK A;  3PIU A;  2W7K A;  2DGL A;  1ASE A;  1GCK A;  1X0M A;  4M2K A;  1MDX A;  2EZ1 A;  4OTL A;  4M2J A;  1LW5 A;  3T32 A;  3MEB A;  1SFF A;  3B1D A;  2Z20 A;  4IXS A;  3FZ8 A;  3FSL A;  4MGR A;  3ELE A;  4ZAS A;  1O62 A;  2FM1 A;  3GZD A;  3MAF A;  4QGR A;  1IBJ A;  1XEY A;  4XAU A;  2R2N A;  2FNI A;  1ARH A;  1H1C A;  3KGX A;  4F5F A;  2ZY4 A;  4Y0H A;  1C0N A;  2BI5 A;  1W7N A;  1Z3Z A;  4RJ0 A;  2C44 A;  2YCN A;  3N4R A;  4GEB A;  3A2B A;  1M6S A;  4N0B A;  4F5I A;  5C6U A;  3WGB A;  4ZWV A;  3P6K A;  4EMY A;  1DTY A;  4MQQ A;  1BJ4 A;  4A6R A;  4IYO B;  2Q7W A;  4WYE A;  2FKI A;  2RFV A;  4RIZ A;  1GC4 A;  2VIB A;  4E1O A;  5FT4 A;  2C0R A;  2JIS A;  2PO3 A;  4U1T A;  4ZLV A;  2ZY3 A;  2JJF A;  1KKP A;  2HP2 A;  3TFT A;  2EYQ A;  4ZAH A;  4WYF A;  1WST A;  2JG2 A;  3PJ0 A;  3WLX A;  1MAQ A;  1CZC A;  2HOZ A;  4P3M A;  3E77 A;  3QM2 A;  5G0A A;  2VGT A;  1N31 A;  1AIA A;  5I92 A;  2XBN A;  2O0R A;  2GMS A;  3WKR A;  1BQD A;  1MGV A;  1ELQ A;  3EI7 A;  4LNL A;  2W8J A;  3WCN A;  3NNK A;  4RLG A;  4IYO A;  2D5Y A;  1WYU B;  2VI8 A;  3K40 A;  1DFO A;  1OHY A;  5EUN A;  3ACZ A;  1ELU A;  4ADB A;  3CQ4 A;  1CL1 A;  2ZSL A;  3WGC A;  1GC2 A;  4EB7 A;  2YOB A;  3AEN B;  2Z9W A;  4BA4 A;  2G7J A;  1U08 A;  3HVY A;  4O6Z A;  4JEW A;  2AY8 A;  3DZZ A;  3FRK A;  3FDD A;  1VP4 A;  2VMW A;  3AAT A;  2ZSM A;  3DU4 A;  1IAY A;  4A72 A;  3M5U A;  3BWO A;  3RCH A;  1OAT A;  4K2I A;  1AJS B;  4AZJ A;  1G7X A;  3PD6 B;  1M0N A;  3HT4 A;  4F5G A;  4F5J A;  2X5D A;  4LW4 A;  1D7V A;  1ASL A;  2EGY A;  2WB6 A;  3E2Z B;  3AEN A;  3K28 A;  2YCP A;  3WZF A;  1AJR A;  2GQN A;  4ZSW A;  1Y4I A;  3JWB A;  1XI9 A;  3BB8 A;  2V1P A;  5EQC A;  1S07 A;  3UAK A;  1RVY A;  2ZUK A;  3NDN A;  3PDB B;  4A6U A;  2DKJ A;  2O1B A;  3EI5 A;  1BQA A;  5EAV A;  4GE4 A;  4WBT A;  3I5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...