4ZAHA

Crystal structure of sugar aminotransferase wece with external aldimine vii from escherichia coli k-12
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
377
structure length
370
Chain Sequence
HMIPFNAPPVVGTELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALLLDIQPGDEVIMPSYTFVSTANAFVLRGAKIVFVDVRPDTMNIDETLIEAAITDKTRVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMSTYKGRALGTIGHIGCFSFHETKNYTAGGEGGATLINDKALIERAEIIREKGTNRSQKYTWRDIGSSYLMSDLQAAYLWAQLEAADRINQQRLALWQNYYDALAPLAKAGRIELPSIPDGCVQNAHMFYIKLRDIDDRSALINFLKEAEIMAVFHYIPLHGCPAGEHFGEFHGEDRYTTKESERLLRLPLFYNLSPVNQRTVIATLLNYFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords dTDP-4-amino-4,6-dideoxygalactose transaminase
publication title Structural Basis for the Stereochemical Control of Amine Installation in Nucleotide Sugar Aminotransferases.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transferase
total genus 132
structure length 370
sequence length 377
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.6.1.59: dTDP-4-amino-4,6-dideoxygalactose transaminase.
pdb deposition date 2015-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01041 DegT_DnrJ_EryC1 DegT/DnrJ/EryC1/StrS aminotransferase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4zahA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4zahA02
3BS8A 4OYTA 4ZLVA 4TN4A 2W7DA 4B9BA 1CQ7A 5EUNA 2GMUA 4WB0B 1J32A 2X3LA 1X28A 2RFVA 2HUUA 1WKGA 4A00A 4AO9A 8AATA 2QB3A 1ASEA 1QIRA 3FKDA 4UQVA 1YJZA 2AY7A 2YRIA 2Z1YA 1KMKA 3ELEA 3N0LA 3RUYA 3GBXA 3ZRPA 1DTYA 1AY4A 1CZEA 2HP1A 2VGTA 2PB2A 3A8UX 4GE4A 4R5ZA 3LV2A 1X29A 3B46A 1OHWA 1OHVA 2VGZA 4J8LA 2D5YA 3E2ZB 3ZRRA 4JF0A 2YHKA 4WP0A 1I48A 1GCKA 3BN1A 5DB5A 1AMRA 1ASFA 1MLYA 2AY9A 2D7ZA 1N31A 5M4DA 3WGBA 3FDDA 1KKJA 2W7FA 4A0GA 2JJGA 1D7SA 3QGUA 3QPGA 1QZ9A 3K7YA 1GDEA 3E6GA 3B1CA 1U08A 2C0RA 4JEZA 4XQ2A 1D7UA 1AY5A 1Y4IA 3NUIA 4CBSA 2W7EA 2VLFA 3NYSA 3QBOA 2OKJA 2FYFA 1PMMA 4Y0HA 4ADCA 2VYCA 4ZDOA 4KYOA 1WYVB 2HORA 3RI6A 4IXOA 4LW2A 3AENA 1IJIA 2ZY5A 3T32A 3FD0A 5DJ9A 1ASLA 1N2TA 1KL1A 2BKWA 3ECDA 3JWBA 3I4JA 4W5KA 2YCTA 4WYGA 3MBBA 4LC3A 2R5CB 4RAEA 1GC4A 5G0AA 4OT8A 3B8XA 1ASMA 1J04A 3JZLA 4FFCA 4M2JA 3WLXA 1OHYA 2D61A 4ZDLA 1C4KA 1W23A 1G4VA 4KAMA 3BWNC 1W7NA 3BCBA 4I8AA 3JU7A 4IY7A 1H1CA 3W1HA 3WY7A 4F5IA 2ZSMA 3ASAA 2EH6A 2CB1A 1IUGA 3HDOA 1BJOB 1S09A 4JF1A 2AEUA 3VP6A 2GMSA 4F5MA 1BJWA 1M7YA 5EUEA 1M6SA 2VI9A 1WYTB 1BQAA 1B8GA 4ZDPA 4AO4A 2BI1A 4WYFA 1ARGA 4P7YA 5I92A 3BWOA 2WK9A 1C7GA 3WCOA 3TATA 1M0NA 2DGKA 1BW0A 3AOVA 3MKJA 1AHXA 1CZCA 2Z20A 1MGVA 4AZJA 1KL2A 3P6KA 2E54A 4PIWA 1KMJA 1OXOA 3GJUA 4RJ0A 1BJNA 1IX7A 3LWSA 3DXVA 4ITGA 1AKAA 2R5EA 2AY4A 3BB8A 4GE9A 5BJ3A 1DGEA 3I5TA 2R5CA 1LC8A 2BI5A 3G0TA 4W1WA 1SPAA 1B5OA 4P3MA 3DRDA 4LNMA 2VMVA 1W3UA 4OMAA 3E9KA 4A0FA 2ZSLA 4KXKA 2BYLA 2YKYA 4M2KA 5JAYA 1E5EA 1SZUA 2BWOA 1JS6A 3WGCA 3B1DA 2CANA 4RKDA 3VK3A 4XJLA 1N8PA 1AMAA 2QBTA 2ZUKA 4Y0IA 2ZY4A 3FFRA 3AEPA 4OTLA 1BJ4A 4CXQA 5G2PA 1AJRA 7AATA 3DYDA 1PMOA 2Z67A 3BWNA 4W1XA 1D2FA 2BWPA 2X5DA 4Q31A 1AJSA 1ELQA 2CSTA 4FL0A 4W8IA 3RBFA 4WXGA 3ZZKA 1GC3A 3GR9A 5DX5A 1AKBA 1BS0A 3A9XA 3W1JA 3IHJA 1G7XA 3NYTA 1LS3A 3NTJA 4ADBA 4PVFA 2VMOA 3NUBA 4F5JA 1OATA 2JISA 3FZ6A 3JW9A 1D7VA 1EJIA 4MQQA 1X0MA 5AX8A 3EZ1A 1JS3A 1IVRA 4A6RA 3IF2A 2C44A 3KKIA 3PJ0A 4IX8A 4XEWA 4AZKA 1EQBA 1B4XA 2ORDA 3L8AA 2HOZA 3KGXA 1UU0A 2D66A 4ZSWA 2X8UA 3RCHA 3RQ1A 3USFA 2HOYA 4CBRA 4MQRA 3EI5A 4EB5A 1GC0A 2BIAA 1S06A 3D6KA 1AX4A 4JEXA 3A2BA 3DODA 1AHFA 5FT8A 1RVYA 1TOIA 4TMRA 3FRKA 1MLZA 4XJMA 3VOMA 1DFOA 5G09A 1SF2A 1TARA 3AELA 3HL2A 1QJ3A 2O1BA 1AIAA 3LVLB 2AY6A 3UAKA 4OBVA 2VMRA 4WYAA 3R9AA 3DXWA 2DR1A 3Q8NA 3L44A 4F5HA 2ZY3A 4IXSA 2VMZA 2VMWA 1VJOA 3CQ4A 3HBXA 3BCAA 3PDXA 5LH9A 3F0HA 3EI6A 3MADA 3NX3A 3W1IA 5G2QA 2V0YA 4A0RA 3PDBA 3AOWA 3NU7A 4LW4A 4NOGA 5K8BA 4GDYA 4N0WA 4DGTA 2HUFA 2Z61A 1ARHA 2W8VA 1M4NA 3CAIA 5G4IA 1KKPA 2OATA 4WB0A 2DKJA 2YKUA 4BA4A 4RITA 3ACZA 3VAXA 1MAQA 3LVMA 1IAYA 1D7RA 2VMQA 3NDNA 4ZWVA 4WYEA 3DR7A 1T3IA 2ZC0A 3ATHA 2FNUA 2HZPA 2W7LA 3TCMA 1O69A 1RVUA 1WYUB 1ASGA 2VGUA 4EB7A 5BJ4A 1IAXA 4JEVA 3COGA 1LW5A 3A9YA 3FVUA 4IYOB 4BA5A 2O0RA 2R2NA 3OKSA 4AOAA 1DKAA 1M0OA 4JE5A 3FVXA 2O7CA 3HT4A 4U2HA 3LVJA 3NRAA 4BQ0A 2C81A 3E2ZA 1IX8A 3GZCA 1YNUA 1ASDA 4LNLA 1LK9A 3H14A 2HP2A 4XAUA 2D65A 4W1VA 1ORDA 2CJDA 2VGWA 1GBNA 5M46A 3FTBA 2OQXA 1GEYA 3NNKA 1SZKA 3OP7A 1AMQA 1FG7A 2NMPA 4WYDA 2EZ2A 4F5LA 1B5PA 2QLRA 2BI9A 2CH2A 2D7YA 4A6TA 3BV0A 3PD6B 3MAFB 5LHAA 4K2BA 1DJUA 1WYVA 4UHOA 3ISLA 1TOKA 1CJ0A 5HHYA 3H7FA 2AATA 1SFFA 3E2YA 2C7TA 4B98A 2CJHA 3ZRQA 4LNJA 2Z1ZA 1EG5A 4WD2A 3JTXA 4XJOA 4UHMA 4WLJA 3F6TA 3K28A 3EZSA 3FQ7A 1DJEA 2WK7A 4ADDA 5EIGB 2YKVA 4GSAA 4ATPA 2CH1A 1CQ8A 4XK1A 3PGYA 4HF8A 1AHYA 1AAWA 5EAVA 1SZSA 1E5FA 1XEYA 3DZZA 3I16A 1VEFA 2VMUA 4M2MA 1GC2A 1MAPA 4K2MA 1ECXA 1TOGA 2W7JA 3FVSA 2W7IA 3F9TA 1YJYA 2BIEA 1RV4A 3AEMC 1JG8A 4XJPA 1BJOA 2DOUA 2PO3A 1V2FA 3GWPA 2PB0A 1WYTA 4IXZA 1I29A 4OCAA 1ZODA 5FT5A 4F5KA 2FM1A 1ASCA 4Q6RA 2YCNA 3TFUA 4EU1A 3EI8A 3FZ7A 3RBLA 1O62A 4DQ6A 2VI8A 1WKHA 4QGRA 1ASAA 1W7MA 1MDXA 1BQDA 5C6UA 1W7LA 3MAUA 5E3KA 4F5GA 1TOJA 2W8TA 1LKCA 1M32A 1IBJA 2W8WA 3DR4A 1V72A 1ELUA 5M4BA 4E3RA 1ASBA 2AY3A 3PPLA 3ELPA 3FZ8A 4RLGA 4U1TA 1YJSA 4Q75A 1GEXA 4F4EA 2GQNA 3JWAA 4N0BA 2OGEA 3M5UA 1SVVA 1GD9A 4RIZA 5EIGA 1G4XA 1FG3A 1H0CA 3QN6A 3TFTA 4JE5D 4WXBA 2BI3A 2W7MA 2AY8A 4CXRA 1BKGA 4GEBA 1CQ6A 1OXPA 1X2AA 2EGYA 2JJEA 3A9ZA 3HQTA 3WCNA 1ARSA 2VMXA 2VIAA 1LW4A 4JEWA 1GEWA 2DGMA 1MDOA 1DGDA 1VP4A 4UOYA 1CS1A 3AEMA 2VMTA 3G7QA 3N75A 1V2DA 2VIBA 3QM2A 1O4SA 2JJHA 3LG0A 2JGTA 1IX6A 4UHNA 5IWQA 3DU4A 3UWCA 2R0TA 3AEJC 1YOOA 3AENB 3FDBA 3MC6C 1ASNA 4IW7A 2QB2A 1QGNA 2DGLA 3G8MA 1S07A 2WK8A 4A6UA 4E77A 2W7GA 5G4JA 5HXXA 1TASA 1CL1A 1M0PA 2WKAA 3K40A 1DJ9A 2FQ6A 3EI7A 4R8DA 1JF9A 3FCRA 1C7OA 2Z9VA 4O6ZA 2VLHA 2BHXA 1V2EA 2BIGA 3BC8A 3CQ5A 4H51A 1I43A 4R5FA 4ZAHA 1ZOBA 5F9SA 1QITA 4GRXA 4WYCA 3PA9A 4JEYA 4ZASA 3II0A 5DJ1A 3HVYA 3WX9A 2E7UA 5FT6A 2JG2A 4EFFA 4ZM3A 2CJGA 1M0QA 1TOEA 5FT4A 2HOXA 2VMSA 4AH3A 4MGRA 1ARTA 4E1OA 3E77A 1AICA 3MEBA 2D63A 4A0HA 2XBNA 4OBUA 1BT4A 4WLHA 2YRRA 2QMAA 3VK4A 4E3QA 3FQ8A 2HUIA 2VGVA 2GSAA 2VMPA 2W8JA 3KE3A 2CINA 2E7JA 3DC1A 1LC7A 3KGWA 3PAAA 5HDMA 4K2IA 2BWNA 3HLMA 5EQCA 2YCPA 3E2FA 1AAMA 2Z9XA 5D95A 4HVKA 2OKKA 5D5SA 1FC4A 1WSTA 2AY1A 3LY1A 3QI6A 3WKSA 4TV7A 2FNIA 2ZP7A 1YAAA 4RKCA 1Z7DA 1LC5A 5F8VA 2AY5A 3AEJA 2YOBA 3MC6A 2EPJA 1B9IA 1CL2A 2W7KA 4Q76A 3WZFA 2BI2A 2VMYA 2GB3A 2DKBA 2EZ1A 2VMNA 1MDZA 5TF5A 4RM1A 3AV7A 3WKRA 4WBTA 2X5FA 4CVQA 4ITXA 4ZM4A 1B9HA 4BMKA 1PFFA 1WYUA 3GSBA 1O61A 3R4TA 1C9CA 2AEVA 4PFNA 3N5MA 4ZWMA 1ZC9A 4IYOA 5EFSA 3FFHA 1S08A 2CFBA 2TPLA 1AHGA 1ARIA 1TPLA 4MKJA 3GZDC 4J5UA 1G7WA 1AJSB 1UKJA 2QA3A 9AATA 4L0OA 2Q7WA 2ZY2A 1YIZA 4PFFA 2F8JA 2ZYJA 1XI9A 4ISYA 4MQPA 5E5IA 1QISA 4R2NA 3PIUA 2OGAA 3EIAA 2W7HA 1AIBA 2CTZA 2VGSA 5EUDA 2EO5A 3TQXA 1TATA 1AMSA 3EI9A 3PD6A 4MKKA 3MAFA 4OC9A 5E4ZA 3AATA 2ZJGA 3RCHB 1UU2A 3P1TA 1C0NA 2CY8A 1P3WA 1PG8A 2G6WA 4GE7A 3VK2A 3FSLA 3QHXA 2W8UA 1AKCA 2Z9UA 2V1PA 3LVKA 4MSOA 4W91A 5EAAA 4F5FA 1YIYA 4BHDA 3B1EA 4WXFA 4ATQA 2FN6A 3ZZJA 1RV3A 5M49A 1AHEA 3FQAA 2D64A 2AY2A 2Z9WA 4EMYA 4ZSYA 3GETA 1UU1A 3HMUA 4RJYA 2E7IA 1QJ5A 4A72A 3CQ6A 1I41A 1Z3ZA 4MY5A 5J8QA 1C7NA 3NYUA 2XH1A 4Y0DA 3CBFA 3EIBA 3AEOA 1AY8A 3NU8A 2YKXA 3GZDA 4ADEA 2JJFA 3BCXA 3PDBB 3UE8A 1S0AA 2BYJA 3EUCA 3ASBA 4DBCA
chains in the Genus database with same CATH superfamily
3BS8A 4OYTA 4ZLVA 4TN4A 2W7DA 4B9BA 1CQ7A 5EUNA 2GMUA 4WB0B 1J32A 2X3LA 1X28A 2RFVA 2HUUA 1WKGA 4A00A 4AO9A 8AATA 2QB3A 1ASEA 1QIRA 3FKDA 4UQVA 1YJZA 2AY7A 2YRIA 2Z1YA 1KMKA 3ELEA 3N0LA 3RUYA 3GBXA 3ZRPA 1DTYA 1AY4A 1CZEA 2HP1A 2VGTA 2PB2A 3A8UX 4GE4A 4R5ZA 3LV2A 1X29A 3B46A 1OHWA 1OHVA 2VGZA 4J8LA 2D5YA 3E2ZB 3ZRRA 4JF0A 2YHKA 4WP0A 1I48A 1GCKA 3BN1A 5DB5A 1AMRA 1ASFA 1MLYA 2AY9A 2D7ZA 1N31A 5M4DA 3WGBA 3FDDA 1KKJA 2W7FA 4A0GA 2JJGA 1D7SA 3QGUA 3QPGA 1QZ9A 3K7YA 1GDEA 3E6GA 3B1CA 1U08A 2C0RA 3N7NA 4JEZA 4XQ2A 1D7UA 1AY5A 1Y4IA 3NUIA 4CBSA 2W7EA 2VLFA 3NYSA 3QBOA 2OKJA 2FYFA 1PMMA 4Y0HA 4ADCA 2VYCA 4ZDOA 4KYOA 1WYVB 2HORA 3RI6A 4IXOA 4LW2A 3AENA 1IJIA 2ZY5A 3T32A 3FD0A 5DJ9A 1ASLA 1N2TA 1KL1A 2BKWA 3ECDA 3JWBA 3I4JA 4W5KA 2YCTA 4WYGA 3MBBA 4LC3A 2R5CB 4RAEA 1GC4A 5G0AA 4OT8A 3B8XA 1ASMA 1J04A 3JZLA 4FFCA 4M2JA 3WLXA 1OHYA 2D61A 4ZDLA 1C4KA 1W23A 1G4VA 4KAMA 3BWNC 1W7NA 3BCBA 4I8AA 3JU7A 4IY7A 1H1CA 3W1HA 3WY7A 4F5IA 2ZSMA 3ASAA 2EH6A 2CB1A 1IUGA 3HDOA 1BJOB 1S09A 4JF1A 2AEUA 3VP6A 2GMSA 4F5MA 1BJWA 1M7YA 5EUEA 1M6SA 2VI9A 1WYTB 1BQAA 1B8GA 4ZDPA 4AO4A 2BI1A 4WYFA 1ARGA 4P7YA 5I92A 3BWOA 2WK9A 1C7GA 3WCOA 3TATA 1M0NA 2DGKA 1BW0A 3AOVA 3MKJA 1AHXA 1CZCA 2Z20A 1MGVA 4AZJA 1KL2A 3P6KA 2E54A 4PIWA 1KMJA 1OXOA 3GJUA 3N4RA 4RJ0A 1BJNA 1IX7A 3LWSA 3DXVA 4ITGA 1AKAA 2R5EA 2AY4A 3BB8A 4GE9A 5BJ3A 1DGEA 3I5TA 2R5CA 1LC8A 2BI5A 3G0TA 4W1WA 1SPAA 1B5OA 4P3MA 3DRDA 4LNMA 2VMVA 1W3UA 3H9XA 4OMAA 3E9KA 4A0FA 2ZSLA 4KXKA 2BYLA 2YKYA 4M2KA 5JAYA 1E5EA 1SZUA 2BWOA 1JS6A 3WGCA 3B1DA 2CANA 4RKDA 3VK3A 4XJLA 1N8PA 1AMAA 2QBTA 2ZUKA 4Y0IA 2ZY4A 3FFRA 3AEPA 4OTLA 1BJ4A 4CXQA 5G2PA 1AJRA 7AATA 3DYDA 1PMOA 2Z67A 3BWNA 4W1XA 1D2FA 2BWPA 2X5DA 4Q31A 1AJSA 1ELQA 2CSTA 4FL0A 4W8IA 3RBFA 4WXGA 3ZZKA 1GC3A 3GR9A 5DX5A 1AKBA 1BS0A 3A9XA 3W1JA 3IHJA 1G7XA 3NYTA 1LS3A 3NTJA 4ADBA 4PVFA 2VMOA 3NUBA 4F5JA 1OATA 2JISA 3FZ6A 3JW9A 1D7VA 1EJIA 4MQQA 1X0MA 5AX8A 3EZ1A 1JS3A 1IVRA 4A6RA 3IF2A 2C44A 3KKIA 3PJ0A 4IX8A 4XEWA 4AZKA 1EQBA 1B4XA 2ORDA 3L8AA 2HOZA 3KGXA 1UU0A 2D66A 4ZSWA 2G7JA 2X8UA 3RCHA 3RQ1A 3USFA 2HOYA 4CBRA 4MQRA 3EI5A 4EB5A 1GC0A 2BIAA 1S06A 3D6KA 1AX4A 4JEXA 3A2BA 3DODA 1AHFA 5FT8A 1RVYA 1TOIA 4TMRA 3FRKA 1MLZA 4XJMA 3VOMA 1DFOA 5G09A 1SF2A 1TARA 3AELA 3HL2A 1QJ3A 2O1BA 1AIAA 3LVLB 2AY6A 3UAKA 4OBVA 2VMRA 4WYAA 3R9AA 3DXWA 2DR1A 3Q8NA 3L44A 4F5HA 2ZY3A 4IXSA 2VMZA 2VMWA 1VJOA 3CQ4A 3HBXA 2EYQA 3BCAA 3PDXA 5LH9A 3F0HA 1KAFA 3EI6A 3MADA 3NX3A 3W1IA 5G2QA 2V0YA 4A0RA 3PDBA 3AOWA 3NU7A 4LW4A 4NOGA 5K8BA 4GDYA 4N0WA 4DGTA 2HUFA 2Z61A 1ARHA 2W8VA 1M4NA 3CAIA 5G4IA 1KKPA 2OATA 4WB0A 2DKJA 2YKUA 4BA4A 4RITA 3ACZA 3VAXA 1MAQA 3LVMA 1IAYA 1D7RA 2VMQA 3NDNA 4ZWVA 4WYEA 3DR7A 1T3IA 2ZC0A 3ATHA 2FNUA 2HZPA 2W7LA 3TCMA 1O69A 1RVUA 1WYUB 1ASGA 2VGUA 4EB7A 5BJ4A 1IAXA 4JEVA 3COGA 1LW5A 3A9YA 3FVUA 4IYOB 4BA5A 2O0RA 2R2NA 3OKSA 4AOAA 3N4XA 1DKAA 1M0OA 4JE5A 3FVXA 2O7CA 3HT4A 4U2HA 3LVJA 3NRAA 4BQ0A 2KFPA 2C81A 3E2ZA 1IX8A 3GZCA 1YNUA 1ASDA 4LNLA 1LK9A 3H14A 2HP2A 4XAUA 2D65A 4W1VA 1ORDA 2CJDA 2VGWA 1GBNA 5M46A 2QSRA 3FTBA 2OQXA 1GEYA 3NNKA 1SZKA 3OP7A 1AMQA 1FG7A 2NMPA 4WYDA 2EZ2A 4F5LA 1B5PA 2QLRA 2BI9A 2CH2A 2D7YA 4A6TA 3BV0A 3PD6B 3MAFB 5LHAA 4K2BA 1DJUA 1WYVA 4UHOA 3ISLA 1TOKA 1CJ0A 5HHYA 3H7FA 2AATA 1SFFA 3E2YA 2C7TA 4B98A 2CJHA 2A1VA 3ZRQA 4LNJA 2Z1ZA 1EG5A 4WD2A 3JTXA 4XJOA 4UHMA 4WLJA 3F6TA 3K28A 3EZSA 3FQ7A 1DJEA 2WK7A 4ADDA 5EIGB 2YKVA 4GSAA 4ATPA 2CH1A 1CQ8A 4XK1A 3PGYA 4HF8A 1AHYA 1AAWA 5EAVA 1SZSA 1E5FA 1XEYA 3DZZA 3I16A 1VEFA 2VMUA 4M2MA 1GC2A 1MAPA 4K2MA 1ECXA 1TOGA 2W7JA 3FVSA 2W7IA 3F9TA 1YJYA 2BIEA 1RV4A 3AEMC 1JG8A 4XJPA 1BJOA 2DOUA 2PO3A 1V2FA 3GWPA 2PB0A 1WYTA 4IXZA 1I29A 4OCAA 1ZODA 5FT5A 4F5KA 2FM1A 1ASCA 4Q6RA 2YCNA 3TFUA 4EU1A 3EI8A 3FZ7A 3RBLA 1O62A 4DQ6A 2VI8A 1WKHA 4QGRA 1ASAA 1W7MA 1MDXA 1BQDA 5C6UA 1W7LA 3MAUA 5E3KA 4F5GA 1TOJA 2W8TA 1LKCA 1M32A 1IBJA 2W8WA 3DR4A 1V72A 1ELUA 5M4BA 4E3RA 1ASBA 2AY3A 3PPLA 3ELPA 3FZ8A 4RLGA 4U1TA 1YJSA 4Q75A 1GEXA 4F4EA 2GQNA 3JWAA 4N0BA 2OGEA 3M5UA 1SVVA 1GD9A 4RIZA 5EIGA 1G4XA 1FG3A 1H0CA 3QN6A 3TFTA 4JE5D 4WXBA 2BI3A 2W7MA 2AY8A 4CXRA 1BKGA 2WB6A 4GEBA 1CQ6A 1OXPA 1X2AA 2EGYA 2JJEA 3A9ZA 3HQTA 3WCNA 1ARSA 2VMXA 2VIAA 1LW4A 4JEWA 1GEWA 2DGMA 1MDOA 1DGDA 1VP4A 4UOYA 1CS1A 3AEMA 2VMTA 3G7QA 3N75A 1V2DA 2VIBA 3QM2A 1O4SA 2JJHA 3LG0A 4H63Q 2JGTA 1IX6A 4UHNA 5IWQA 3DU4A 3UWCA 2R0TA 3AEJC 1YOOA 3AENB 3FDBA 3MC6C 1ASNA 4IW7A 2QB2A 1QGNA 2DGLA 3G8MA 1S07A 2WK8A 4A6UA 4E77A 2W7GA 5G4JA 5HXXA 1TASA 1CL1A 1M0PA 2WKAA 3K40A 1DJ9A 2FQ6A 3EI7A 4R8DA 1JF9A 3FCRA 1C7OA 2Z9VA 4O6ZA 2VLHA 2BHXA 1V2EA 2BIGA 3BC8A 3CQ5A 4H51A 1I43A 4R5FA 4ZAHA 1ZOBA 5F9SA 1QITA 4GRXA 4WYCA 3PA9A 4JEYA 4ZASA 3II0A 5DJ1A 3HVYA 3WX9A 2E7UA 5FT6A 2JG2A 4EFFA 4ZM3A 2CJGA 1M0QA 1TOEA 5FT4A 2HOXA 2VMSA 4AH3A 4MGRA 1ARTA 4E1OA 3E77A 1AICA 3MEBA 2D63A 4A0HA 2XBNA 4OBUA 1BT4A 4WLHA 2YRRA 2QMAA 3VK4A 4E3QA 3FQ8A 2HUIA 2VGVA 2GSAA 2VMPA 2W8JA 3KE3A 2CINA 2E7JA 3DC1A 1LC7A 3KGWA 3PAAA 5HDMA 4K2IA 2BWNA 3HLMA 5EQCA 2YCPA 3E2FA 1AAMA 2Z9XA 5D95A 4HVKA 2OKKA 5D5SA 1FC4A 1WSTA 2AY1A 3LY1A 3QI6A 3WKSA 4TV7A 2FNIA 2ZP7A 1YAAA 4RKCA 1Z7DA 1LC5A 5F8VA 2AY5A 3AEJA 2YOBA 3MC6A 2EPJA 1B9IA 1CL2A 2W7KA 4Q76A 2FKIA 3WZFA 2BI2A 2VMYA 2GB3A 2DKBA 2EZ1A 2VMNA 1MDZA 5TF5A 4RM1A 3AV7A 3WKRA 4WBTA 2X5FA 4CVQA 4ITXA 4ZM4A 1B9HA 4BMKA 1PFFA 1WYUA 3GSBA 1O61A 3R4TA 1C9CA 2AEVA 4PFNA 3N5MA 4ZWMA 4K05A 1ZC9A 4IYOA 5EFSA 3FFHA 1S08A 2CFBA 2TPLA 1AHGA 1ARIA 1TPLA 4MKJA 3GZDC 4J5UA 1G7WA 1AJSB 1UKJA 2QA3A 9AATA 4L0OA 2Q7WA 2ZY2A 1YIZA 4PFFA 2F8JA 2ZYJA 1XI9A 4ISYA 4MQPA 5E5IA 1QISA 4R2NA 3PIUA 2OGAA 3EIAA 2W7HA 1AIBA 2CTZA 2VGSA 5EUDA 2EO5A 3TQXA 1TATA 1AMSA 3EI9A 3PD6A 4MKKA 3MAFA 4OC9A 5E4ZA 3AATA 2ZJGA 3RCHB 1UU2A 3P1TA 1C0NA 2CY8A 1P3WA 1PG8A 2G6WA 4GE7A 3VK2A 3FSLA 3QHXA 2W8UA 1AKCA 2Z9UA 2V1PA 3LVKA 4MSOA 4W91A 5EAAA 4F5FA 1YIYA 4BHDA 3B1EA 4WXFA 4ATQA 2FN6A 3ZZJA 1RV3A 5M49A 1AHEA 3FQAA 2D64A 2AY2A 2Z9WA 4EMYA 4ZSYA 3GETA 1UU1A 3HMUA 4RJYA 3N4SA 2E7IA 1QJ5A 4A72A 3CQ6A 1I41A 1Z3ZA 4MY5A 5J8QA 1C7NA 3NYUA 2XH1A 4Y0DA 3CBFA 3EIBA 5KTBA 3AEOA 1AY8A 3NU8A 2YKXA 3GZDA 4ADEA 2JJFA 3BCXA 3PDBB 3UE8A 1S0AA 2BYJA 3EUCA 3ASBA 4DBCA
chains in the Genus database with same CATH topology
3BS8A 4OYTA 4ZLVA 4TN4A 2W7DA 4B9BA 1CQ7A 5EUNA 2GMUA 4WB0B 1J32A 2X3LA 1X28A 2RFVA 2HUUA 1WKGA 4A00A 4AO9A 8AATA 2QB3A 1ASEA 1QIRA 3FKDA 4UQVA 1YJZA 2AY7A 2YRIA 2Z1YA 1KMKA 3ELEA 3N0LA 3RUYA 3GBXA 3ZRPA 1DTYA 1AY4A 1CZEA 2HP1A 2VGTA 2PB2A 3A8UX 4GE4A 4R5ZA 3LV2A 1X29A 3B46A 1OHWA 1OHVA 2VGZA 4J8LA 2D5YA 3E2ZB 3ZRRA 4JF0A 2YHKA 4WP0A 1I48A 1GCKA 3BN1A 5DB5A 1AMRA 1ASFA 1MLYA 2AY9A 2D7ZA 1N31A 5M4DA 3WGBA 3FDDA 1KKJA 2W7FA 4A0GA 2JJGA 1D7SA 3QGUA 3QPGA 1QZ9A 3K7YA 1GDEA 3E6GA 3B1CA 1U08A 2C0RA 3N7NA 4JEZA 4XQ2A 1D7UA 1AY5A 1Y4IA 3NUIA 4CBSA 2W7EA 2VLFA 3NYSA 3QBOA 2OKJA 2FYFA 1PMMA 4Y0HA 4ADCA 2VYCA 4ZDOA 4KYOA 1WYVB 2HORA 3RI6A 4IXOA 4LW2A 3AENA 1IJIA 2ZY5A 3T32A 3FD0A 5DJ9A 1ASLA 1N2TA 1KL1A 2BKWA 3ECDA 3JWBA 3I4JA 4W5KA 2YCTA 4WYGA 3MBBA 4LC3A 2R5CB 4RAEA 1GC4A 5G0AA 4OT8A 3B8XA 1ASMA 1J04A 3JZLA 4FFCA 4M2JA 3WLXA 1OHYA 2D61A 4ZDLA 1C4KA 1W23A 1G4VA 4KAMA 3BWNC 1W7NA 3BCBA 4I8AA 3JU7A 4IY7A 1H1CA 3W1HA 3WY7A 4F5IA 2ZSMA 3ASAA 2EH6A 2CB1A 1IUGA 3HDOA 1BJOB 1S09A 4JF1A 2AEUA 3VP6A 2GMSA 4F5MA 1BJWA 1M7YA 5EUEA 1M6SA 2VI9A 1WYTB 1BQAA 1B8GA 4ZDPA 4AO4A 2BI1A 4WYFA 1ARGA 4P7YA 5I92A 3BWOA 2WK9A 1C7GA 3WCOA 3TATA 1M0NA 2DGKA 1BW0A 3AOVA 3MKJA 1AHXA 1CZCA 2Z20A 1MGVA 4AZJA 1KL2A 3P6KA 2E54A 4PIWA 1KMJA 1OXOA 3GJUA 3N4RA 4RJ0A 1BJNA 1IX7A 3LWSA 3DXVA 4ITGA 1AKAA 2R5EA 2AY4A 3BB8A 4GE9A 5BJ3A 1DGEA 3I5TA 2R5CA 1LC8A 2BI5A 3G0TA 4W1WA 1SPAA 1B5OA 4P3MA 3DRDA 4LNMA 2VMVA 1W3UA 3H9XA 4OMAA 3E9KA 4A0FA 2ZSLA 4KXKA 2BYLA 2YKYA 4M2KA 5JAYA 1E5EA 1SZUA 2BWOA 1JS6A 3WGCA 3B1DA 2CANA 4RKDA 3VK3A 4XJLA 1N8PA 1AMAA 2QBTA 2ZUKA 4Y0IA 2ZY4A 3FFRA 3AEPA 4OTLA 1BJ4A 4CXQA 5G2PA 1AJRA 7AATA 3DYDA 1PMOA 2Z67A 3BWNA 4W1XA 1D2FA 2BWPA 2X5DA 4Q31A 1AJSA 1ELQA 2CSTA 4FL0A 4W8IA 3RBFA 4WXGA 3ZZKA 1GC3A 3GR9A 5DX5A 1AKBA 1BS0A 3A9XA 3W1JA 3IHJA 1G7XA 3NYTA 1LS3A 3NTJA 4ADBA 4PVFA 2VMOA 3NUBA 4F5JA 1OATA 2JISA 3FZ6A 3JW9A 1D7VA 1EJIA 4MQQA 1X0MA 5AX8A 3EZ1A 1JS3A 1IVRA 4A6RA 3IF2A 2C44A 3KKIA 3PJ0A 4IX8A 4XEWA 4AZKA 1EQBA 1B4XA 2ORDA 3L8AA 2HOZA 3KGXA 1UU0A 2D66A 4ZSWA 2G7JA 2X8UA 3RCHA 3RQ1A 3USFA 2HOYA 4CBRA 4MQRA 3EI5A 4EB5A 1GC0A 2BIAA 1S06A 3D6KA 1AX4A 4JEXA 3A2BA 3DODA 1AHFA 5FT8A 1RVYA 1TOIA 4TMRA 3FRKA 1MLZA 4XJMA 3VOMA 1DFOA 5G09A 1SF2A 1TARA 3AELA 3HL2A 1QJ3A 2O1BA 1AIAA 3LVLB 2AY6A 3UAKA 4OBVA 2VMRA 4WYAA 3R9AA 3DXWA 2DR1A 3Q8NA 3L44A 4F5HA 2ZY3A 4IXSA 2VMZA 2VMWA 1VJOA 3CQ4A 3HBXA 2EYQA 3BCAA 3PDXA 5LH9A 3F0HA 3EI6A 3MADA 3NX3A 3W1IA 5G2QA 2V0YA 4A0RA 3PDBA 3AOWA 3NU7A 4LW4A 4NOGA 5K8BA 4GDYA 4N0WA 4DGTA 2HUFA 2Z61A 1ARHA 2W8VA 1M4NA 3CAIA 5G4IA 1KKPA 2OATA 4WB0A 2DKJA 2YKUA 4BA4A 4RITA 3ACZA 3VAXA 1MAQA 3LVMA 1IAYA 1D7RA 2VMQA 3NDNA 4ZWVA 4WYEA 3DR7A 1T3IA 2ZC0A 3ATHA 2FNUA 2HZPA 2W7LA 3TCMA 1O69A 1RVUA 1WYUB 1ASGA 2VGUA 4EB7A 5BJ4A 1IAXA 4JEVA 3COGA 1LW5A 3A9YA 3FVUA 4IYOB 4BA5A 2O0RA 2R2NA 3OKSA 4AOAA 3N4XA 1DKAA 1M0OA 4JE5A 3FVXA 2O7CA 3HT4A 4U2HA 3LVJA 3NRAA 4BQ0A 2KFPA 2C81A 3E2ZA 1IX8A 3GZCA 1YNUA 1ASDA 4LNLA 1LK9A 3H14A 2HP2A 4XAUA 2D65A 4W1VA 1ORDA 2CJDA 2VGWA 1GBNA 5M46A 2QSRA 3FTBA 2OQXA 1GEYA 3NNKA 1SZKA 3OP7A 1AMQA 1FG7A 2NMPA 4WYDA 2EZ2A 4F5LA 1B5PA 2QLRA 2BI9A 2CH2A 2D7YA 4A6TA 3BV0A 3PD6B 3MAFB 5LHAA 4K2BA 1DJUA 1WYVA 4UHOA 3ISLA 1TOKA 1CJ0A 5HHYA 3H7FA 2AATA 1SFFA 3E2YA 2C7TA 4B98A 2CJHA 2A1VA 3ZRQA 4LNJA 2Z1ZA 1EG5A 4WD2A 3JTXA 4XJOA 4UHMA 4WLJA 3F6TA 3K28A 3EZSA 3FQ7A 1DJEA 2WK7A 4ADDA 5EIGB 2YKVA 4GSAA 4ATPA 2CH1A 1CQ8A 4XK1A 3PGYA 4HF8A 1AHYA 1AAWA 5EAVA 1SZSA 1E5FA 1XEYA 3DZZA 3I16A 1VEFA 2VMUA 4M2MA 1GC2A 1MAPA 4K2MA 1ECXA 1TOGA 2W7JA 3FVSA 2W7IA 3F9TA 1YJYA 2BIEA 1RV4A 3AEMC 1JG8A 4XJPA 1BJOA 2DOUA 2PO3A 1V2FA 3GWPA 2PB0A 1WYTA 4IXZA 1I29A 4OCAA 1ZODA 5FT5A 4F5KA 2FM1A 1ASCA 4Q6RA 2YCNA 3TFUA 4EU1A 3EI8A 3FZ7A 3RBLA 1O62A 4DQ6A 2VI8A 1WKHA 4QGRA 1ASAA 1W7MA 1MDXA 1BQDA 5C6UA 1W7LA 3MAUA 5E3KA 4F5GA 1TOJA 2W8TA 1LKCA 1M32A 1IBJA 2W8WA 3DR4A 1V72A 1ELUA 5M4BA 4E3RA 1ASBA 2AY3A 3PPLA 3ELPA 3FZ8A 4RLGA 4U1TA 1YJSA 4Q75A 1GEXA 4F4EA 2GQNA 3JWAA 4N0BA 2OGEA 3M5UA 1SVVA 1GD9A 4RIZA 5EIGA 1G4XA 1FG3A 1H0CA 3QN6A 3TFTA 4JE5D 4WXBA 2BI3A 2W7MA 2AY8A 4CXRA 1BKGA 2WB6A 4GEBA 1CQ6A 1OXPA 1X2AA 2EGYA 2JJEA 3A9ZA 3HQTA 3WCNA 1ARSA 2VMXA 2VIAA 1LW4A 4JEWA 1GEWA 2DGMA 1MDOA 1DGDA 1VP4A 4UOYA 1CS1A 3AEMA 2VMTA 3G7QA 3N75A 1V2DA 2VIBA 3QM2A 1O4SA 2JJHA 3LG0A 4H63Q 2JGTA 1IX6A 4UHNA 5IWQA 3DU4A 3UWCA 2R0TA 3AEJC 1YOOA 3AENB 3FDBA 3MC6C 1ASNA 4IW7A 2QB2A 1QGNA 2DGLA 3G8MA 1S07A 2WK8A 4A6UA 4E77A 2W7GA 5G4JA 5HXXA 1TASA 1CL1A 1M0PA 2WKAA 3K40A 1DJ9A 2FQ6A 3EI7A 4R8DA 1JF9A 3FCRA 1C7OA 2Z9VA 4O6ZA 2VLHA 2BHXA 1V2EA 2BIGA 3BC8A 3CQ5A 4H51A 1I43A 4R5FA 4ZAHA 1ZOBA 5F9SA 1QITA 4GRXA 4WYCA 3PA9A 4JEYA 4ZASA 3II0A 5DJ1A 3HVYA 3WX9A 2E7UA 5FT6A 2JG2A 4EFFA 4ZM3A 2CJGA 1M0QA 1TOEA 5FT4A 2HOXA 2VMSA 4AH3A 4MGRA 1ARTA 4E1OA 3E77A 1AICA 3MEBA 2D63A 4A0HA 2XBNA 4OBUA 1BT4A 4WLHA 2YRRA 2QMAA 3VK4A 4E3QA 3FQ8A 2HUIA 2VGVA 2GSAA 2VMPA 2W8JA 3KE3A 2CINA 2E7JA 3DC1A 1LC7A 3KGWA 3PAAA 5HDMA 4K2IA 2BWNA 3HLMA 5EQCA 2YCPA 3E2FA 1AAMA 2Z9XA 5D95A 4HVKA 2OKKA 5D5SA 1FC4A 1WSTA 2AY1A 3LY1A 3QI6A 3WKSA 4TV7A 2FNIA 2ZP7A 1YAAA 4RKCA 1Z7DA 1LC5A 5F8VA 2AY5A 3AEJA 2YOBA 3MC6A 2EPJA 1B9IA 1CL2A 2W7KA 4Q76A 2FKIA 3WZFA 2BI2A 2VMYA 2GB3A 2DKBA 2EZ1A 2VMNA 1MDZA 5TF5A 4RM1A 3AV7A 3WKRA 4WBTA 2X5FA 4CVQA 4ITXA 4ZM4A 1B9HA 4BMKA 1PFFA 1WYUA 3GSBA 1O61A 3R4TA 1C9CA 2AEVA 4PFNA 3N5MA 4ZWMA 4K05A 1ZC9A 4IYOA 5EFSA 3FFHA 1S08A 2CFBA 2TPLA 1AHGA 1ARIA 1TPLA 4MKJA 3GZDC 4J5UA 1G7WA 1AJSB 1UKJA 2QA3A 9AATA 4L0OA 2Q7WA 2ZY2A 1YIZA 4PFFA 2F8JA 2ZYJA 1XI9A 4ISYA 4MQPA 5E5IA 1QISA 4R2NA 3PIUA 2OGAA 3EIAA 2W7HA 1AIBA 2CTZA 2VGSA 5EUDA 2EO5A 3TQXA 1TATA 1AMSA 3EI9A 3PD6A 4MKKA 3MAFA 4OC9A 5E4ZA 3AATA 2ZJGA 3RCHB 1UU2A 3P1TA 1C0NA 2CY8A 1P3WA 1PG8A 2G6WA 4GE7A 3VK2A 3FSLA 3QHXA 2W8UA 1AKCA 2Z9UA 2V1PA 3LVKA 4MSOA 4W91A 5EAAA 4F5FA 1YIYA 4BHDA 3B1EA 4WXFA 4ATQA 2FN6A 3ZZJA 1RV3A 5M49A 1AHEA 3FQAA 2D64A 2AY2A 2Z9WA 4EMYA 4ZSYA 3GETA 1UU1A 3HMUA 4RJYA 3N4SA 2E7IA 1QJ5A 4A72A 3CQ6A 1I41A 1Z3ZA 4MY5A 5J8QA 1C7NA 3NYUA 2XH1A 4Y0DA 3CBFA 3EIBA 5KTBA 3AEOA 1AY8A 3NU8A 2YKXA 3GZDA 4ADEA 2JJFA 3BCXA 3PDBB 3UE8A 1S0AA 2BYJA 3EUCA 3ASBA 4DBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BS8 A;  4OYT A;  4ZLV A;  4TN4 A;  2W7D A;  4B9B A;  1CQ7 A;  5EUN A;  2GMU A;  4WB0 B;  1J32 A;  2X3L A;  1X28 A;  2RFV A;  2HUU A;  1WKG A;  4A00 A;  4AO9 A;  8AAT A;  2QB3 A;  1ASE A;  1QIR A;  3FKD A;  4UQV A;  1YJZ A;  2AY7 A;  2YRI A;  2Z1Y A;  1KMK A;  3ELE A;  3N0L A;  3RUY A;  3GBX A;  3ZRP A;  1DTY A;  1AY4 A;  1CZE A;  2HP1 A;  2VGT A;  2PB2 A;  3A8U X;  4GE4 A;  4R5Z A;  3LV2 A;  1X29 A;  3B46 A;  1OHW A;  1OHV A;  2VGZ A;  4J8L A;  2D5Y A;  3E2Z B;  3ZRR A;  4JF0 A;  2YHK A;  4WP0 A;  1I48 A;  1GCK A;  3BN1 A;  5DB5 A;  1AMR A;  1ASF A;  1MLY A;  2AY9 A;  2D7Z A;  1N31 A;  5M4D A;  3WGB A;  3FDD A;  1KKJ A;  2W7F A;  4A0G A;  2JJG A;  1D7S A;  3QGU A;  3QPG A;  1QZ9 A;  3K7Y A;  1GDE A;  3E6G A;  3B1C A;  1U08 A;  2C0R A;  4JEZ A;  4XQ2 A;  1D7U A;  1AY5 A;  1Y4I A;  3NUI A;  4CBS A;  2W7E A;  2VLF A;  3NYS A;  3QBO A;  2OKJ A;  2FYF A;  1PMM A;  4Y0H A;  4ADC A;  2VYC A;  4ZDO A;  4KYO A;  1WYV B;  2HOR A;  3RI6 A;  4IXO A;  4LW2 A;  3AEN A;  1IJI A;  2ZY5 A;  3T32 A;  3FD0 A;  5DJ9 A;  1ASL A;  1N2T A;  1KL1 A;  2BKW A;  3ECD A;  3JWB A;  3I4J A;  4W5K A;  2YCT A;  4WYG A;  3MBB A;  4LC3 A;  2R5C B;  4RAE A;  1GC4 A;  5G0A A;  4OT8 A;  3B8X A;  1ASM A;  1J04 A;  3JZL A;  4FFC A;  4M2J A;  3WLX A;  1OHY A;  2D61 A;  4ZDL A;  1C4K A;  1W23 A;  1G4V A;  4KAM A;  3BWN C;  1W7N A;  3BCB A;  4I8A A;  3JU7 A;  4IY7 A;  1H1C A;  3W1H A;  3WY7 A;  4F5I A;  2ZSM A;  3ASA A;  2EH6 A;  2CB1 A;  1IUG A;  3HDO A;  1BJO B;  1S09 A;  4JF1 A;  2AEU A;  3VP6 A;  2GMS A;  4F5M A;  1BJW A;  1M7Y A;  5EUE A;  1M6S A;  2VI9 A;  1WYT B;  1BQA A;  1B8G A;  4ZDP A;  4AO4 A;  2BI1 A;  4WYF A;  1ARG A;  4P7Y A;  5I92 A;  3BWO A;  2WK9 A;  1C7G A;  3WCO A;  3TAT A;  1M0N A;  2DGK A;  1BW0 A;  3AOV A;  3MKJ A;  1AHX A;  1CZC A;  2Z20 A;  1MGV A;  4AZJ A;  1KL2 A;  3P6K A;  2E54 A;  4PIW A;  1KMJ A;  1OXO A;  3GJU A;  4RJ0 A;  1BJN A;  1IX7 A;  3LWS A;  3DXV A;  4ITG A;  1AKA A;  2R5E A;  2AY4 A;  3BB8 A;  4GE9 A;  5BJ3 A;  1DGE A;  3I5T A;  2R5C A;  1LC8 A;  2BI5 A;  3G0T A;  4W1W A;  1SPA A;  1B5O A;  4P3M A;  3DRD A;  4LNM A;  2VMV A;  1W3U A;  4OMA A;  3E9K A;  4A0F A;  2ZSL A;  4KXK A;  2BYL A;  2YKY A;  4M2K A;  5JAY A;  1E5E A;  1SZU A;  2BWO A;  1JS6 A;  3WGC A;  3B1D A;  2CAN A;  4RKD A;  3VK3 A;  4XJL A;  1N8P A;  1AMA A;  2QBT A;  2ZUK A;  4Y0I A;  2ZY4 A;  3FFR A;  3AEP A;  4OTL A;  1BJ4 A;  4CXQ A;  5G2P A;  1AJR A;  7AAT A;  3DYD A;  1PMO A;  2Z67 A;  3BWN A;  4W1X A;  1D2F A;  2BWP A;  2X5D A;  4Q31 A;  1AJS A;  1ELQ A;  2CST A;  4FL0 A;  4W8I A;  3RBF A;  4WXG A;  3ZZK A;  1GC3 A;  3GR9 A;  5DX5 A;  1AKB A;  1BS0 A;  3A9X A;  3W1J A;  3IHJ A;  1G7X A;  3NYT A;  1LS3 A;  3NTJ A;  4ADB A;  4PVF A;  2VMO A;  3NUB A;  4F5J A;  1OAT A;  2JIS A;  3FZ6 A;  3JW9 A;  1D7V A;  1EJI A;  4MQQ A;  1X0M A;  5AX8 A;  3EZ1 A;  1JS3 A;  1IVR A;  4A6R A;  3IF2 A;  2C44 A;  3KKI A;  3PJ0 A;  4IX8 A;  4XEW A;  4AZK A;  1EQB A;  1B4X A;  2ORD A;  3L8A A;  2HOZ A;  3KGX A;  1UU0 A;  2D66 A;  4ZSW A;  2X8U A;  3RCH A;  3RQ1 A;  3USF A;  2HOY A;  4CBR A;  4MQR A;  3EI5 A;  4EB5 A;  1GC0 A;  2BIA A;  1S06 A;  3D6K A;  1AX4 A;  4JEX A;  3A2B A;  3DOD A;  1AHF A;  5FT8 A;  1RVY A;  1TOI A;  4TMR A;  3FRK A;  1MLZ A;  4XJM A;  3VOM A;  1DFO A;  5G09 A;  1SF2 A;  1TAR A;  3AEL A;  3HL2 A;  1QJ3 A;  2O1B A;  1AIA A;  3LVL B;  2AY6 A;  3UAK A;  4OBV A;  2VMR A;  4WYA A;  3R9A A;  3DXW A;  2DR1 A;  3Q8N A;  3L44 A;  4F5H A;  2ZY3 A;  4IXS A;  2VMZ A;  2VMW A;  1VJO A;  3CQ4 A;  3HBX A;  3BCA A;  3PDX A;  5LH9 A;  3F0H A;  3EI6 A;  3MAD A;  3NX3 A;  3W1I A;  5G2Q A;  2V0Y A;  4A0R A;  3PDB A;  3AOW A;  3NU7 A;  4LW4 A;  4NOG A;  5K8B A;  4GDY A;  4N0W A;  4DGT A;  2HUF A;  2Z61 A;  1ARH A;  2W8V A;  1M4N A;  3CAI A;  5G4I A;  1KKP A;  2OAT A;  4WB0 A;  2DKJ A;  2YKU A;  4BA4 A;  4RIT A;  3ACZ A;  3VAX A;  1MAQ A;  3LVM A;  1IAY A;  1D7R A;  2VMQ A;  3NDN A;  4ZWV A;  4WYE A;  3DR7 A;  1T3I A;  2ZC0 A;  3ATH A;  2FNU A;  2HZP A;  2W7L A;  3TCM A;  1O69 A;  1RVU A;  1WYU B;  1ASG A;  2VGU A;  4EB7 A;  5BJ4 A;  1IAX A;  4JEV A;  3COG A;  1LW5 A;  3A9Y A;  3FVU A;  4IYO B;  4BA5 A;  2O0R A;  2R2N A;  3OKS A;  4AOA A;  1DKA A;  1M0O A;  4JE5 A;  3FVX A;  2O7C A;  3HT4 A;  4U2H A;  3LVJ A;  3NRA A;  4BQ0 A;  2C81 A;  3E2Z A;  1IX8 A;  3GZC A;  1YNU A;  1ASD A;  4LNL A;  1LK9 A;  3H14 A;  2HP2 A;  4XAU A;  2D65 A;  4W1V A;  1ORD A;  2CJD A;  2VGW A;  1GBN A;  5M46 A;  3FTB A;  2OQX A;  1GEY A;  3NNK A;  1SZK A;  3OP7 A;  1AMQ A;  1FG7 A;  2NMP A;  4WYD A;  2EZ2 A;  4F5L A;  1B5P A;  2QLR A;  2BI9 A;  2CH2 A;  2D7Y A;  4A6T A;  3BV0 A;  3PD6 B;  3MAF B;  5LHA A;  4K2B A;  1DJU A;  1WYV A;  4UHO A;  3ISL A;  1TOK A;  1CJ0 A;  5HHY A;  3H7F A;  2AAT A;  1SFF A;  3E2Y A;  2C7T A;  4B98 A;  2CJH A;  3ZRQ A;  4LNJ A;  2Z1Z A;  1EG5 A;  4WD2 A;  3JTX A;  4XJO A;  4UHM A;  4WLJ A;  3F6T A;  3K28 A;  3EZS A;  3FQ7 A;  1DJE A;  2WK7 A;  4ADD A;  5EIG B;  2YKV A;  4GSA A;  4ATP A;  2CH1 A;  1CQ8 A;  4XK1 A;  3PGY A;  4HF8 A;  1AHY A;  1AAW A;  5EAV A;  1SZS A;  1E5F A;  1XEY A;  3DZZ A;  3I16 A;  1VEF A;  2VMU A;  4M2M A;  1GC2 A;  1MAP A;  4K2M A;  1ECX A;  1TOG A;  2W7J A;  3FVS A;  2W7I A;  3F9T A;  1YJY A;  2BIE A;  1RV4 A;  3AEM C;  1JG8 A;  4XJP A;  1BJO A;  2DOU A;  2PO3 A;  1V2F A;  3GWP A;  2PB0 A;  1WYT A;  4IXZ A;  1I29 A;  4OCA A;  1ZOD A;  5FT5 A;  4F5K A;  2FM1 A;  1ASC A;  4Q6R A;  2YCN A;  3TFU A;  4EU1 A;  3EI8 A;  3FZ7 A;  3RBL A;  1O62 A;  4DQ6 A;  2VI8 A;  1WKH A;  4QGR A;  1ASA A;  1W7M A;  1MDX A;  1BQD A;  5C6U A;  1W7L A;  3MAU A;  5E3K A;  4F5G A;  1TOJ A;  2W8T A;  1LKC A;  1M32 A;  1IBJ A;  2W8W A;  3DR4 A;  1V72 A;  1ELU A;  5M4B A;  4E3R A;  1ASB A;  2AY3 A;  3PPL A;  3ELP A;  3FZ8 A;  4RLG A;  4U1T A;  1YJS A;  4Q75 A;  1GEX A;  4F4E A;  2GQN A;  3JWA A;  4N0B A;  2OGE A;  3M5U A;  1SVV A;  1GD9 A;  4RIZ A;  5EIG A;  1G4X A;  1FG3 A;  1H0C A;  3QN6 A;  3TFT A;  4JE5 D;  4WXB A;  2BI3 A;  2W7M A;  2AY8 A;  4CXR A;  1BKG A;  4GEB A;  1CQ6 A;  1OXP A;  1X2A A;  2EGY A;  2JJE A;  3A9Z A;  3HQT A;  3WCN A;  1ARS A;  2VMX A;  2VIA A;  1LW4 A;  4JEW A;  1GEW A;  2DGM A;  1MDO A;  1DGD A;  1VP4 A;  4UOY A;  1CS1 A;  3AEM A;  2VMT A;  3G7Q A;  3N75 A;  1V2D A;  2VIB A;  3QM2 A;  1O4S A;  2JJH A;  3LG0 A;  2JGT A;  1IX6 A;  4UHN A;  5IWQ A;  3DU4 A;  3UWC A;  2R0T A;  3AEJ C;  1YOO A;  3AEN B;  3FDB A;  3MC6 C;  1ASN A;  4IW7 A;  2QB2 A;  1QGN A;  2DGL A;  3G8M A;  1S07 A;  2WK8 A;  4A6U A;  4E77 A;  2W7G A;  5G4J A;  5HXX A;  1TAS A;  1CL1 A;  1M0P A;  2WKA A;  3K40 A;  1DJ9 A;  2FQ6 A;  3EI7 A;  4R8D A;  1JF9 A;  3FCR A;  1C7O A;  2Z9V A;  4O6Z A;  2VLH A;  2BHX A;  1V2E A;  2BIG A;  3BC8 A;  3CQ5 A;  4H51 A;  1I43 A;  4R5F A;  4ZAH A;  1ZOB A;  5F9S A;  1QIT A;  4GRX A;  4WYC A;  3PA9 A;  4JEY A;  4ZAS A;  3II0 A;  5DJ1 A;  3HVY A;  3WX9 A;  2E7U A;  5FT6 A;  2JG2 A;  4EFF A;  4ZM3 A;  2CJG A;  1M0Q A;  1TOE A;  5FT4 A;  2HOX A;  2VMS A;  4AH3 A;  4MGR A;  1ART A;  4E1O A;  3E77 A;  1AIC A;  3MEB A;  2D63 A;  4A0H A;  2XBN A;  4OBU A;  1BT4 A;  4WLH A;  2YRR A;  2QMA A;  3VK4 A;  4E3Q A;  3FQ8 A;  2HUI A;  2VGV A;  2GSA A;  2VMP A;  2W8J A;  3KE3 A;  2CIN A;  2E7J A;  3DC1 A;  1LC7 A;  3KGW A;  3PAA A;  5HDM A;  4K2I A;  2BWN A;  3HLM A;  5EQC A;  2YCP A;  3E2F A;  1AAM A;  2Z9X A;  5D95 A;  4HVK A;  2OKK A;  5D5S A;  1FC4 A;  1WST A;  2AY1 A;  3LY1 A;  3QI6 A;  3WKS A;  4TV7 A;  2FNI A;  2ZP7 A;  1YAA A;  4RKC A;  1Z7D A;  1LC5 A;  5F8V A;  2AY5 A;  3AEJ A;  2YOB A;  3MC6 A;  2EPJ A;  1B9I A;  1CL2 A;  2W7K A;  4Q76 A;  3WZF A;  2BI2 A;  2VMY A;  2GB3 A;  2DKB A;  2EZ1 A;  2VMN A;  1MDZ A;  5TF5 A;  4RM1 A;  3AV7 A;  3WKR A;  4WBT A;  2X5F A;  4CVQ A;  4ITX A;  4ZM4 A;  1B9H A;  4BMK A;  1PFF A;  1WYU A;  3GSB A;  1O61 A;  3R4T A;  1C9C A;  2AEV A;  4PFN A;  3N5M A;  4ZWM A;  1ZC9 A;  4IYO A;  5EFS A;  3FFH A;  1S08 A;  2CFB A;  2TPL A;  1AHG A;  1ARI A;  1TPL A;  4MKJ A;  3GZD C;  4J5U A;  1G7W A;  1AJS B;  1UKJ A;  2QA3 A;  9AAT A;  4L0O A;  2Q7W A;  2ZY2 A;  1YIZ A;  4PFF A;  2F8J A;  2ZYJ A;  1XI9 A;  4ISY A;  4MQP A;  5E5I A;  1QIS A;  4R2N A;  3PIU A;  2OGA A;  3EIA A;  2W7H A;  1AIB A;  2CTZ A;  2VGS A;  5EUD A;  2EO5 A;  3TQX A;  1TAT A;  1AMS A;  3EI9 A;  3PD6 A;  4MKK A;  3MAF A;  4OC9 A;  5E4Z A;  3AAT A;  2ZJG A;  3RCH B;  1UU2 A;  3P1T A;  1C0N A;  2CY8 A;  1P3W A;  1PG8 A;  2G6W A;  4GE7 A;  3VK2 A;  3FSL A;  3QHX A;  2W8U A;  1AKC A;  2Z9U A;  2V1P A;  3LVK A;  4MSO A;  4W91 A;  5EAA A;  4F5F A;  1YIY A;  4BHD A;  3B1E A;  4WXF A;  4ATQ A;  2FN6 A;  3ZZJ A;  1RV3 A;  5M49 A;  1AHE A;  3FQA A;  2D64 A;  2AY2 A;  2Z9W A;  4EMY A;  4ZSY A;  3GET A;  1UU1 A;  3HMU A;  4RJY A;  2E7I A;  1QJ5 A;  4A72 A;  3CQ6 A;  1I41 A;  1Z3Z A;  4MY5 A;  5J8Q A;  1C7N A;  3NYU A;  2XH1 A;  4Y0D A;  3CBF A;  3EIB A;  3AEO A;  1AY8 A;  3NU8 A;  2YKX A;  3GZD A;  4ADE A;  2JJF A;  3BCX A;  3PDB B;  3UE8 A;  1S0A A;  2BYJ A;  3EUC A;  3ASB A;  4DBC A; 
#chains in the Genus database with same CATH topology
 3BS8 A;  4OYT A;  4ZLV A;  4TN4 A;  2W7D A;  4B9B A;  1CQ7 A;  5EUN A;  2GMU A;  4WB0 B;  1J32 A;  2X3L A;  1X28 A;  2RFV A;  2HUU A;  1WKG A;  4A00 A;  4AO9 A;  8AAT A;  2QB3 A;  1ASE A;  1QIR A;  3FKD A;  4UQV A;  1YJZ A;  2AY7 A;  2YRI A;  2Z1Y A;  1KMK A;  3ELE A;  3N0L A;  3RUY A;  3GBX A;  3ZRP A;  1DTY A;  1AY4 A;  1CZE A;  2HP1 A;  2VGT A;  2PB2 A;  3A8U X;  4GE4 A;  4R5Z A;  3LV2 A;  1X29 A;  3B46 A;  1OHW A;  1OHV A;  2VGZ A;  4J8L A;  2D5Y A;  3E2Z B;  3ZRR A;  4JF0 A;  2YHK A;  4WP0 A;  1I48 A;  1GCK A;  3BN1 A;  5DB5 A;  1AMR A;  1ASF A;  1MLY A;  2AY9 A;  2D7Z A;  1N31 A;  5M4D A;  3WGB A;  3FDD A;  1KKJ A;  2W7F A;  4A0G A;  2JJG A;  1D7S A;  3QGU A;  3QPG A;  1QZ9 A;  3K7Y A;  1GDE A;  3E6G A;  3B1C A;  1U08 A;  2C0R A;  3N7N A;  4JEZ A;  4XQ2 A;  1D7U A;  1AY5 A;  1Y4I A;  3NUI A;  4CBS A;  2W7E A;  2VLF A;  3NYS A;  3QBO A;  2OKJ A;  2FYF A;  1PMM A;  4Y0H A;  4ADC A;  2VYC A;  4ZDO A;  4KYO A;  1WYV B;  2HOR A;  3RI6 A;  4IXO A;  4LW2 A;  3AEN A;  1IJI A;  2ZY5 A;  3T32 A;  3FD0 A;  5DJ9 A;  1ASL A;  1N2T A;  1KL1 A;  2BKW A;  3ECD A;  3JWB A;  3I4J A;  4W5K A;  2YCT A;  4WYG A;  3MBB A;  4LC3 A;  2R5C B;  4RAE A;  1GC4 A;  5G0A A;  4OT8 A;  3B8X A;  1ASM A;  1J04 A;  3JZL A;  4FFC A;  4M2J A;  3WLX A;  1OHY A;  2D61 A;  4ZDL A;  1C4K A;  1W23 A;  1G4V A;  4KAM A;  3BWN C;  1W7N A;  3BCB A;  4I8A A;  3JU7 A;  4IY7 A;  1H1C A;  3W1H A;  3WY7 A;  4F5I A;  2ZSM A;  3ASA A;  2EH6 A;  2CB1 A;  1IUG A;  3HDO A;  1BJO B;  1S09 A;  4JF1 A;  2AEU A;  3VP6 A;  2GMS A;  4F5M A;  1BJW A;  1M7Y A;  5EUE A;  1M6S A;  2VI9 A;  1WYT B;  1BQA A;  1B8G A;  4ZDP A;  4AO4 A;  2BI1 A;  4WYF A;  1ARG A;  4P7Y A;  5I92 A;  3BWO A;  2WK9 A;  1C7G A;  3WCO A;  3TAT A;  1M0N A;  2DGK A;  1BW0 A;  3AOV A;  3MKJ A;  1AHX A;  1CZC A;  2Z20 A;  1MGV A;  4AZJ A;  1KL2 A;  3P6K A;  2E54 A;  4PIW A;  1KMJ A;  1OXO A;  3GJU A;  3N4R A;  4RJ0 A;  1BJN A;  1IX7 A;  3LWS A;  3DXV A;  4ITG A;  1AKA A;  2R5E A;  2AY4 A;  3BB8 A;  4GE9 A;  5BJ3 A;  1DGE A;  3I5T A;  2R5C A;  1LC8 A;  2BI5 A;  3G0T A;  4W1W A;  1SPA A;  1B5O A;  4P3M A;  3DRD A;  4LNM A;  2VMV A;  1W3U A;  3H9X A;  4OMA A;  3E9K A;  4A0F A;  2ZSL A;  4KXK A;  2BYL A;  2YKY A;  4M2K A;  5JAY A;  1E5E A;  1SZU A;  2BWO A;  1JS6 A;  3WGC A;  3B1D A;  2CAN A;  4RKD A;  3VK3 A;  4XJL A;  1N8P A;  1AMA A;  2QBT A;  2ZUK A;  4Y0I A;  2ZY4 A;  3FFR A;  3AEP A;  4OTL A;  1BJ4 A;  4CXQ A;  5G2P A;  1AJR A;  7AAT A;  3DYD A;  1PMO A;  2Z67 A;  3BWN A;  4W1X A;  1D2F A;  2BWP A;  2X5D A;  4Q31 A;  1AJS A;  1ELQ A;  2CST A;  4FL0 A;  4W8I A;  3RBF A;  4WXG A;  3ZZK A;  1GC3 A;  3GR9 A;  5DX5 A;  1AKB A;  1BS0 A;  3A9X A;  3W1J A;  3IHJ A;  1G7X A;  3NYT A;  1LS3 A;  3NTJ A;  4ADB A;  4PVF A;  2VMO A;  3NUB A;  4F5J A;  1OAT A;  2JIS A;  3FZ6 A;  3JW9 A;  1D7V A;  1EJI A;  4MQQ A;  1X0M A;  5AX8 A;  3EZ1 A;  1JS3 A;  1IVR A;  4A6R A;  3IF2 A;  2C44 A;  3KKI A;  3PJ0 A;  4IX8 A;  4XEW A;  4AZK A;  1EQB A;  1B4X A;  2ORD A;  3L8A A;  2HOZ A;  3KGX A;  1UU0 A;  2D66 A;  4ZSW A;  2G7J A;  2X8U A;  3RCH A;  3RQ1 A;  3USF A;  2HOY A;  4CBR A;  4MQR A;  3EI5 A;  4EB5 A;  1GC0 A;  2BIA A;  1S06 A;  3D6K A;  1AX4 A;  4JEX A;  3A2B A;  3DOD A;  1AHF A;  5FT8 A;  1RVY A;  1TOI A;  4TMR A;  3FRK A;  1MLZ A;  4XJM A;  3VOM A;  1DFO A;  5G09 A;  1SF2 A;  1TAR A;  3AEL A;  3HL2 A;  1QJ3 A;  2O1B A;  1AIA A;  3LVL B;  2AY6 A;  3UAK A;  4OBV A;  2VMR A;  4WYA A;  3R9A A;  3DXW A;  2DR1 A;  3Q8N A;  3L44 A;  4F5H A;  2ZY3 A;  4IXS A;  2VMZ A;  2VMW A;  1VJO A;  3CQ4 A;  3HBX A;  2EYQ A;  3BCA A;  3PDX A;  5LH9 A;  3F0H A;  1KAF A;  3EI6 A;  3MAD A;  3NX3 A;  3W1I A;  5G2Q A;  2V0Y A;  4A0R A;  3PDB A;  3AOW A;  3NU7 A;  4LW4 A;  4NOG A;  5K8B A;  4GDY A;  4N0W A;  4DGT A;  2HUF A;  2Z61 A;  1ARH A;  2W8V A;  1M4N A;  3CAI A;  5G4I A;  1KKP A;  2OAT A;  4WB0 A;  2DKJ A;  2YKU A;  4BA4 A;  4RIT A;  3ACZ A;  3VAX A;  1MAQ A;  3LVM A;  1IAY A;  1D7R A;  2VMQ A;  3NDN A;  4ZWV A;  4WYE A;  3DR7 A;  1T3I A;  2ZC0 A;  3ATH A;  2FNU A;  2HZP A;  2W7L A;  3TCM A;  1O69 A;  1RVU A;  1WYU B;  1ASG A;  2VGU A;  4EB7 A;  5BJ4 A;  1IAX A;  4JEV A;  3COG A;  1LW5 A;  3A9Y A;  3FVU A;  4IYO B;  4BA5 A;  2O0R A;  2R2N A;  3OKS A;  4AOA A;  3N4X A;  1DKA A;  1M0O A;  4JE5 A;  3FVX A;  2O7C A;  3HT4 A;  4U2H A;  3LVJ A;  3NRA A;  4BQ0 A;  2KFP A;  2C81 A;  3E2Z A;  1IX8 A;  3GZC A;  1YNU A;  1ASD A;  4LNL A;  1LK9 A;  3H14 A;  2HP2 A;  4XAU A;  2D65 A;  4W1V A;  1ORD A;  2CJD A;  2VGW A;  1GBN A;  5M46 A;  2QSR A;  3FTB A;  2OQX A;  1GEY A;  3NNK A;  1SZK A;  3OP7 A;  1AMQ A;  1FG7 A;  2NMP A;  4WYD A;  2EZ2 A;  4F5L A;  1B5P A;  2QLR A;  2BI9 A;  2CH2 A;  2D7Y A;  4A6T A;  3BV0 A;  3PD6 B;  3MAF B;  5LHA A;  4K2B A;  1DJU A;  1WYV A;  4UHO A;  3ISL A;  1TOK A;  1CJ0 A;  5HHY A;  3H7F A;  2AAT A;  1SFF A;  3E2Y A;  2C7T A;  4B98 A;  2CJH A;  2A1V A;  3ZRQ A;  4LNJ A;  2Z1Z A;  1EG5 A;  4WD2 A;  3JTX A;  4XJO A;  4UHM A;  4WLJ A;  3F6T A;  3K28 A;  3EZS A;  3FQ7 A;  1DJE A;  2WK7 A;  4ADD A;  5EIG B;  2YKV A;  4GSA A;  4ATP A;  2CH1 A;  1CQ8 A;  4XK1 A;  3PGY A;  4HF8 A;  1AHY A;  1AAW A;  5EAV A;  1SZS A;  1E5F A;  1XEY A;  3DZZ A;  3I16 A;  1VEF A;  2VMU A;  4M2M A;  1GC2 A;  1MAP A;  4K2M A;  1ECX A;  1TOG A;  2W7J A;  3FVS A;  2W7I A;  3F9T A;  1YJY A;  2BIE A;  1RV4 A;  3AEM C;  1JG8 A;  4XJP A;  1BJO A;  2DOU A;  2PO3 A;  1V2F A;  3GWP A;  2PB0 A;  1WYT A;  4IXZ A;  1I29 A;  4OCA A;  1ZOD A;  5FT5 A;  4F5K A;  2FM1 A;  1ASC A;  4Q6R A;  2YCN A;  3TFU A;  4EU1 A;  3EI8 A;  3FZ7 A;  3RBL A;  1O62 A;  4DQ6 A;  2VI8 A;  1WKH A;  4QGR A;  1ASA A;  1W7M A;  1MDX A;  1BQD A;  5C6U A;  1W7L A;  3MAU A;  5E3K A;  4F5G A;  1TOJ A;  2W8T A;  1LKC A;  1M32 A;  1IBJ A;  2W8W A;  3DR4 A;  1V72 A;  1ELU A;  5M4B A;  4E3R A;  1ASB A;  2AY3 A;  3PPL A;  3ELP A;  3FZ8 A;  4RLG A;  4U1T A;  1YJS A;  4Q75 A;  1GEX A;  4F4E A;  2GQN A;  3JWA A;  4N0B A;  2OGE A;  3M5U A;  1SVV A;  1GD9 A;  4RIZ A;  5EIG A;  1G4X A;  1FG3 A;  1H0C A;  3QN6 A;  3TFT A;  4JE5 D;  4WXB A;  2BI3 A;  2W7M A;  2AY8 A;  4CXR A;  1BKG A;  2WB6 A;  4GEB A;  1CQ6 A;  1OXP A;  1X2A A;  2EGY A;  2JJE A;  3A9Z A;  3HQT A;  3WCN A;  1ARS A;  2VMX A;  2VIA A;  1LW4 A;  4JEW A;  1GEW A;  2DGM A;  1MDO A;  1DGD A;  1VP4 A;  4UOY A;  1CS1 A;  3AEM A;  2VMT A;  3G7Q A;  3N75 A;  1V2D A;  2VIB A;  3QM2 A;  1O4S A;  2JJH A;  3LG0 A;  4H63 Q;  2JGT A;  1IX6 A;  4UHN A;  5IWQ A;  3DU4 A;  3UWC A;  2R0T A;  3AEJ C;  1YOO A;  3AEN B;  3FDB A;  3MC6 C;  1ASN A;  4IW7 A;  2QB2 A;  1QGN A;  2DGL A;  3G8M A;  1S07 A;  2WK8 A;  4A6U A;  4E77 A;  2W7G A;  5G4J A;  5HXX A;  1TAS A;  1CL1 A;  1M0P A;  2WKA A;  3K40 A;  1DJ9 A;  2FQ6 A;  3EI7 A;  4R8D A;  1JF9 A;  3FCR A;  1C7O A;  2Z9V A;  4O6Z A;  2VLH A;  2BHX A;  1V2E A;  2BIG A;  3BC8 A;  3CQ5 A;  4H51 A;  1I43 A;  4R5F A;  4ZAH A;  1ZOB A;  5F9S A;  1QIT A;  4GRX A;  4WYC A;  3PA9 A;  4JEY A;  4ZAS A;  3II0 A;  5DJ1 A;  3HVY A;  3WX9 A;  2E7U A;  5FT6 A;  2JG2 A;  4EFF A;  4ZM3 A;  2CJG A;  1M0Q A;  1TOE A;  5FT4 A;  2HOX A;  2VMS A;  4AH3 A;  4MGR A;  1ART A;  4E1O A;  3E77 A;  1AIC A;  3MEB A;  2D63 A;  4A0H A;  2XBN A;  4OBU A;  1BT4 A;  4WLH A;  2YRR A;  2QMA A;  3VK4 A;  4E3Q A;  3FQ8 A;  2HUI A;  2VGV A;  2GSA A;  2VMP A;  2W8J A;  3KE3 A;  2CIN A;  2E7J A;  3DC1 A;  1LC7 A;  3KGW A;  3PAA A;  5HDM A;  4K2I A;  2BWN A;  3HLM A;  5EQC A;  2YCP A;  3E2F A;  1AAM A;  2Z9X A;  5D95 A;  4HVK A;  2OKK A;  5D5S A;  1FC4 A;  1WST A;  2AY1 A;  3LY1 A;  3QI6 A;  3WKS A;  4TV7 A;  2FNI A;  2ZP7 A;  1YAA A;  4RKC A;  1Z7D A;  1LC5 A;  5F8V A;  2AY5 A;  3AEJ A;  2YOB A;  3MC6 A;  2EPJ A;  1B9I A;  1CL2 A;  2W7K A;  4Q76 A;  2FKI A;  3WZF A;  2BI2 A;  2VMY A;  2GB3 A;  2DKB A;  2EZ1 A;  2VMN A;  1MDZ A;  5TF5 A;  4RM1 A;  3AV7 A;  3WKR A;  4WBT A;  2X5F A;  4CVQ A;  4ITX A;  4ZM4 A;  1B9H A;  4BMK A;  1PFF A;  1WYU A;  3GSB A;  1O61 A;  3R4T A;  1C9C A;  2AEV A;  4PFN A;  3N5M A;  4ZWM A;  4K05 A;  1ZC9 A;  4IYO A;  5EFS A;  3FFH A;  1S08 A;  2CFB A;  2TPL A;  1AHG A;  1ARI A;  1TPL A;  4MKJ A;  3GZD C;  4J5U A;  1G7W A;  1AJS B;  1UKJ A;  2QA3 A;  9AAT A;  4L0O A;  2Q7W A;  2ZY2 A;  1YIZ A;  4PFF A;  2F8J A;  2ZYJ A;  1XI9 A;  4ISY A;  4MQP A;  5E5I A;  1QIS A;  4R2N A;  3PIU A;  2OGA A;  3EIA A;  2W7H A;  1AIB A;  2CTZ A;  2VGS A;  5EUD A;  2EO5 A;  3TQX A;  1TAT A;  1AMS A;  3EI9 A;  3PD6 A;  4MKK A;  3MAF A;  4OC9 A;  5E4Z A;  3AAT A;  2ZJG A;  3RCH B;  1UU2 A;  3P1T A;  1C0N A;  2CY8 A;  1P3W A;  1PG8 A;  2G6W A;  4GE7 A;  3VK2 A;  3FSL A;  3QHX A;  2W8U A;  1AKC A;  2Z9U A;  2V1P A;  3LVK A;  4MSO A;  4W91 A;  5EAA A;  4F5F A;  1YIY A;  4BHD A;  3B1E A;  4WXF A;  4ATQ A;  2FN6 A;  3ZZJ A;  1RV3 A;  5M49 A;  1AHE A;  3FQA A;  2D64 A;  2AY2 A;  2Z9W A;  4EMY A;  4ZSY A;  3GET A;  1UU1 A;  3HMU A;  4RJY A;  3N4S A;  2E7I A;  1QJ5 A;  4A72 A;  3CQ6 A;  1I41 A;  1Z3Z A;  4MY5 A;  5J8Q A;  1C7N A;  3NYU A;  2XH1 A;  4Y0D A;  3CBF A;  3EIB A;  5KTB A;  3AEO A;  1AY8 A;  3NU8 A;  2YKX A;  3GZD A;  4ADE A;  2JJF A;  3BCX A;  3PDB B;  3UE8 A;  1S0A A;  2BYJ A;  3EUC A;  3ASB A;  4DBC A; 
#chains in the Genus database with same CATH homology
 3BS8 A;  4OYT A;  4ZLV A;  4TN4 A;  2W7D A;  4B9B A;  1CQ7 A;  5EUN A;  2GMU A;  4WB0 B;  1J32 A;  2X3L A;  1X28 A;  2RFV A;  2HUU A;  1WKG A;  4A00 A;  4AO9 A;  8AAT A;  2QB3 A;  1ASE A;  1QIR A;  3FKD A;  4UQV A;  1YJZ A;  2AY7 A;  2YRI A;  2Z1Y A;  1KMK A;  3ELE A;  3N0L A;  3RUY A;  3GBX A;  3ZRP A;  1DTY A;  1AY4 A;  1CZE A;  2HP1 A;  2VGT A;  2PB2 A;  3A8U X;  4GE4 A;  4R5Z A;  3LV2 A;  1X29 A;  3B46 A;  1OHW A;  1OHV A;  2VGZ A;  4J8L A;  2D5Y A;  3E2Z B;  3ZRR A;  4JF0 A;  2YHK A;  4WP0 A;  1I48 A;  1GCK A;  3BN1 A;  5DB5 A;  1AMR A;  1ASF A;  1MLY A;  2AY9 A;  2D7Z A;  1N31 A;  5M4D A;  3WGB A;  3FDD A;  1KKJ A;  2W7F A;  4A0G A;  2JJG A;  1D7S A;  3QGU A;  3QPG A;  1QZ9 A;  3K7Y A;  1GDE A;  3E6G A;  3B1C A;  1U08 A;  2C0R A;  3N7N A;  4JEZ A;  4XQ2 A;  1D7U A;  1AY5 A;  1Y4I A;  3NUI A;  4CBS A;  2W7E A;  2VLF A;  3NYS A;  3QBO A;  2OKJ A;  2FYF A;  1PMM A;  4Y0H A;  4ADC A;  2VYC A;  4ZDO A;  4KYO A;  1WYV B;  2HOR A;  3RI6 A;  4IXO A;  4LW2 A;  3AEN A;  1IJI A;  2ZY5 A;  3T32 A;  3FD0 A;  5DJ9 A;  1ASL A;  1N2T A;  1KL1 A;  2BKW A;  3ECD A;  3JWB A;  3I4J A;  4W5K A;  2YCT A;  4WYG A;  3MBB A;  4LC3 A;  2R5C B;  4RAE A;  1GC4 A;  5G0A A;  4OT8 A;  3B8X A;  1ASM A;  1J04 A;  3JZL A;  4FFC A;  4M2J A;  3WLX A;  1OHY A;  2D61 A;  4ZDL A;  1C4K A;  1W23 A;  1G4V A;  4KAM A;  3BWN C;  1W7N A;  3BCB A;  4I8A A;  3JU7 A;  4IY7 A;  1H1C A;  3W1H A;  3WY7 A;  4F5I A;  2ZSM A;  3ASA A;  2EH6 A;  2CB1 A;  1IUG A;  3HDO A;  1BJO B;  1S09 A;  4JF1 A;  2AEU A;  3VP6 A;  2GMS A;  4F5M A;  1BJW A;  1M7Y A;  5EUE A;  1M6S A;  2VI9 A;  1WYT B;  1BQA A;  1B8G A;  4ZDP A;  4AO4 A;  2BI1 A;  4WYF A;  1ARG A;  4P7Y A;  5I92 A;  3BWO A;  2WK9 A;  1C7G A;  3WCO A;  3TAT A;  1M0N A;  2DGK A;  1BW0 A;  3AOV A;  3MKJ A;  1AHX A;  1CZC A;  2Z20 A;  1MGV A;  4AZJ A;  1KL2 A;  3P6K A;  2E54 A;  4PIW A;  1KMJ A;  1OXO A;  3GJU A;  3N4R A;  4RJ0 A;  1BJN A;  1IX7 A;  3LWS A;  3DXV A;  4ITG A;  1AKA A;  2R5E A;  2AY4 A;  3BB8 A;  4GE9 A;  5BJ3 A;  1DGE A;  3I5T A;  2R5C A;  1LC8 A;  2BI5 A;  3G0T A;  4W1W A;  1SPA A;  1B5O A;  4P3M A;  3DRD A;  4LNM A;  2VMV A;  1W3U A;  3H9X A;  4OMA A;  3E9K A;  4A0F A;  2ZSL A;  4KXK A;  2BYL A;  2YKY A;  4M2K A;  5JAY A;  1E5E A;  1SZU A;  2BWO A;  1JS6 A;  3WGC A;  3B1D A;  2CAN A;  4RKD A;  3VK3 A;  4XJL A;  1N8P A;  1AMA A;  2QBT A;  2ZUK A;  4Y0I A;  2ZY4 A;  3FFR A;  3AEP A;  4OTL A;  1BJ4 A;  4CXQ A;  5G2P A;  1AJR A;  7AAT A;  3DYD A;  1PMO A;  2Z67 A;  3BWN A;  4W1X A;  1D2F A;  2BWP A;  2X5D A;  4Q31 A;  1AJS A;  1ELQ A;  2CST A;  4FL0 A;  4W8I A;  3RBF A;  4WXG A;  3ZZK A;  1GC3 A;  3GR9 A;  5DX5 A;  1AKB A;  1BS0 A;  3A9X A;  3W1J A;  3IHJ A;  1G7X A;  3NYT A;  1LS3 A;  3NTJ A;  4ADB A;  4PVF A;  2VMO A;  3NUB A;  4F5J A;  1OAT A;  2JIS A;  3FZ6 A;  3JW9 A;  1D7V A;  1EJI A;  4MQQ A;  1X0M A;  5AX8 A;  3EZ1 A;  1JS3 A;  1IVR A;  4A6R A;  3IF2 A;  2C44 A;  3KKI A;  3PJ0 A;  4IX8 A;  4XEW A;  4AZK A;  1EQB A;  1B4X A;  2ORD A;  3L8A A;  2HOZ A;  3KGX A;  1UU0 A;  2D66 A;  4ZSW A;  2G7J A;  2X8U A;  3RCH A;  3RQ1 A;  3USF A;  2HOY A;  4CBR A;  4MQR A;  3EI5 A;  4EB5 A;  1GC0 A;  2BIA A;  1S06 A;  3D6K A;  1AX4 A;  4JEX A;  3A2B A;  3DOD A;  1AHF A;  5FT8 A;  1RVY A;  1TOI A;  4TMR A;  3FRK A;  1MLZ A;  4XJM A;  3VOM A;  1DFO A;  5G09 A;  1SF2 A;  1TAR A;  3AEL A;  3HL2 A;  1QJ3 A;  2O1B A;  1AIA A;  3LVL B;  2AY6 A;  3UAK A;  4OBV A;  2VMR A;  4WYA A;  3R9A A;  3DXW A;  2DR1 A;  3Q8N A;  3L44 A;  4F5H A;  2ZY3 A;  4IXS A;  2VMZ A;  2VMW A;  1VJO A;  3CQ4 A;  3HBX A;  2EYQ A;  3BCA A;  3PDX A;  5LH9 A;  3F0H A;  3EI6 A;  3MAD A;  3NX3 A;  3W1I A;  5G2Q A;  2V0Y A;  4A0R A;  3PDB A;  3AOW A;  3NU7 A;  4LW4 A;  4NOG A;  5K8B A;  4GDY A;  4N0W A;  4DGT A;  2HUF A;  2Z61 A;  1ARH A;  2W8V A;  1M4N A;  3CAI A;  5G4I A;  1KKP A;  2OAT A;  4WB0 A;  2DKJ A;  2YKU A;  4BA4 A;  4RIT A;  3ACZ A;  3VAX A;  1MAQ A;  3LVM A;  1IAY A;  1D7R A;  2VMQ A;  3NDN A;  4ZWV A;  4WYE A;  3DR7 A;  1T3I A;  2ZC0 A;  3ATH A;  2FNU A;  2HZP A;  2W7L A;  3TCM A;  1O69 A;  1RVU A;  1WYU B;  1ASG A;  2VGU A;  4EB7 A;  5BJ4 A;  1IAX A;  4JEV A;  3COG A;  1LW5 A;  3A9Y A;  3FVU A;  4IYO B;  4BA5 A;  2O0R A;  2R2N A;  3OKS A;  4AOA A;  3N4X A;  1DKA A;  1M0O A;  4JE5 A;  3FVX A;  2O7C A;  3HT4 A;  4U2H A;  3LVJ A;  3NRA A;  4BQ0 A;  2KFP A;  2C81 A;  3E2Z A;  1IX8 A;  3GZC A;  1YNU A;  1ASD A;  4LNL A;  1LK9 A;  3H14 A;  2HP2 A;  4XAU A;  2D65 A;  4W1V A;  1ORD A;  2CJD A;  2VGW A;  1GBN A;  5M46 A;  2QSR A;  3FTB A;  2OQX A;  1GEY A;  3NNK A;  1SZK A;  3OP7 A;  1AMQ A;  1FG7 A;  2NMP A;  4WYD A;  2EZ2 A;  4F5L A;  1B5P A;  2QLR A;  2BI9 A;  2CH2 A;  2D7Y A;  4A6T A;  3BV0 A;  3PD6 B;  3MAF B;  5LHA A;  4K2B A;  1DJU A;  1WYV A;  4UHO A;  3ISL A;  1TOK A;  1CJ0 A;  5HHY A;  3H7F A;  2AAT A;  1SFF A;  3E2Y A;  2C7T A;  4B98 A;  2CJH A;  2A1V A;  3ZRQ A;  4LNJ A;  2Z1Z A;  1EG5 A;  4WD2 A;  3JTX A;  4XJO A;  4UHM A;  4WLJ A;  3F6T A;  3K28 A;  3EZS A;  3FQ7 A;  1DJE A;  2WK7 A;  4ADD A;  5EIG B;  2YKV A;  4GSA A;  4ATP A;  2CH1 A;  1CQ8 A;  4XK1 A;  3PGY A;  4HF8 A;  1AHY A;  1AAW A;  5EAV A;  1SZS A;  1E5F A;  1XEY A;  3DZZ A;  3I16 A;  1VEF A;  2VMU A;  4M2M A;  1GC2 A;  1MAP A;  4K2M A;  1ECX A;  1TOG A;  2W7J A;  3FVS A;  2W7I A;  3F9T A;  1YJY A;  2BIE A;  1RV4 A;  3AEM C;  1JG8 A;  4XJP A;  1BJO A;  2DOU A;  2PO3 A;  1V2F A;  3GWP A;  2PB0 A;  1WYT A;  4IXZ A;  1I29 A;  4OCA A;  1ZOD A;  5FT5 A;  4F5K A;  2FM1 A;  1ASC A;  4Q6R A;  2YCN A;  3TFU A;  4EU1 A;  3EI8 A;  3FZ7 A;  3RBL A;  1O62 A;  4DQ6 A;  2VI8 A;  1WKH A;  4QGR A;  1ASA A;  1W7M A;  1MDX A;  1BQD A;  5C6U A;  1W7L A;  3MAU A;  5E3K A;  4F5G A;  1TOJ A;  2W8T A;  1LKC A;  1M32 A;  1IBJ A;  2W8W A;  3DR4 A;  1V72 A;  1ELU A;  5M4B A;  4E3R A;  1ASB A;  2AY3 A;  3PPL A;  3ELP A;  3FZ8 A;  4RLG A;  4U1T A;  1YJS A;  4Q75 A;  1GEX A;  4F4E A;  2GQN A;  3JWA A;  4N0B A;  2OGE A;  3M5U A;  1SVV A;  1GD9 A;  4RIZ A;  5EIG A;  1G4X A;  1FG3 A;  1H0C A;  3QN6 A;  3TFT A;  4JE5 D;  4WXB A;  2BI3 A;  2W7M A;  2AY8 A;  4CXR A;  1BKG A;  2WB6 A;  4GEB A;  1CQ6 A;  1OXP A;  1X2A A;  2EGY A;  2JJE A;  3A9Z A;  3HQT A;  3WCN A;  1ARS A;  2VMX A;  2VIA A;  1LW4 A;  4JEW A;  1GEW A;  2DGM A;  1MDO A;  1DGD A;  1VP4 A;  4UOY A;  1CS1 A;  3AEM A;  2VMT A;  3G7Q A;  3N75 A;  1V2D A;  2VIB A;  3QM2 A;  1O4S A;  2JJH A;  3LG0 A;  4H63 Q;  2JGT A;  1IX6 A;  4UHN A;  5IWQ A;  3DU4 A;  3UWC A;  2R0T A;  3AEJ C;  1YOO A;  3AEN B;  3FDB A;  3MC6 C;  1ASN A;  4IW7 A;  2QB2 A;  1QGN A;  2DGL A;  3G8M A;  1S07 A;  2WK8 A;  4A6U A;  4E77 A;  2W7G A;  5G4J A;  5HXX A;  1TAS A;  1CL1 A;  1M0P A;  2WKA A;  3K40 A;  1DJ9 A;  2FQ6 A;  3EI7 A;  4R8D A;  1JF9 A;  3FCR A;  1C7O A;  2Z9V A;  4O6Z A;  2VLH A;  2BHX A;  1V2E A;  2BIG A;  3BC8 A;  3CQ5 A;  4H51 A;  1I43 A;  4R5F A;  4ZAH A;  1ZOB A;  5F9S A;  1QIT A;  4GRX A;  4WYC A;  3PA9 A;  4JEY A;  4ZAS A;  3II0 A;  5DJ1 A;  3HVY A;  3WX9 A;  2E7U A;  5FT6 A;  2JG2 A;  4EFF A;  4ZM3 A;  2CJG A;  1M0Q A;  1TOE A;  5FT4 A;  2HOX A;  2VMS A;  4AH3 A;  4MGR A;  1ART A;  4E1O A;  3E77 A;  1AIC A;  3MEB A;  2D63 A;  4A0H A;  2XBN A;  4OBU A;  1BT4 A;  4WLH A;  2YRR A;  2QMA A;  3VK4 A;  4E3Q A;  3FQ8 A;  2HUI A;  2VGV A;  2GSA A;  2VMP A;  2W8J A;  3KE3 A;  2CIN A;  2E7J A;  3DC1 A;  1LC7 A;  3KGW A;  3PAA A;  5HDM A;  4K2I A;  2BWN A;  3HLM A;  5EQC A;  2YCP A;  3E2F A;  1AAM A;  2Z9X A;  5D95 A;  4HVK A;  2OKK A;  5D5S A;  1FC4 A;  1WST A;  2AY1 A;  3LY1 A;  3QI6 A;  3WKS A;  4TV7 A;  2FNI A;  2ZP7 A;  1YAA A;  4RKC A;  1Z7D A;  1LC5 A;  5F8V A;  2AY5 A;  3AEJ A;  2YOB A;  3MC6 A;  2EPJ A;  1B9I A;  1CL2 A;  2W7K A;  4Q76 A;  2FKI A;  3WZF A;  2BI2 A;  2VMY A;  2GB3 A;  2DKB A;  2EZ1 A;  2VMN A;  1MDZ A;  5TF5 A;  4RM1 A;  3AV7 A;  3WKR A;  4WBT A;  2X5F A;  4CVQ A;  4ITX A;  4ZM4 A;  1B9H A;  4BMK A;  1PFF A;  1WYU A;  3GSB A;  1O61 A;  3R4T A;  1C9C A;  2AEV A;  4PFN A;  3N5M A;  4ZWM A;  4K05 A;  1ZC9 A;  4IYO A;  5EFS A;  3FFH A;  1S08 A;  2CFB A;  2TPL A;  1AHG A;  1ARI A;  1TPL A;  4MKJ A;  3GZD C;  4J5U A;  1G7W A;  1AJS B;  1UKJ A;  2QA3 A;  9AAT A;  4L0O A;  2Q7W A;  2ZY2 A;  1YIZ A;  4PFF A;  2F8J A;  2ZYJ A;  1XI9 A;  4ISY A;  4MQP A;  5E5I A;  1QIS A;  4R2N A;  3PIU A;  2OGA A;  3EIA A;  2W7H A;  1AIB A;  2CTZ A;  2VGS A;  5EUD A;  2EO5 A;  3TQX A;  1TAT A;  1AMS A;  3EI9 A;  3PD6 A;  4MKK A;  3MAF A;  4OC9 A;  5E4Z A;  3AAT A;  2ZJG A;  3RCH B;  1UU2 A;  3P1T A;  1C0N A;  2CY8 A;  1P3W A;  1PG8 A;  2G6W A;  4GE7 A;  3VK2 A;  3FSL A;  3QHX A;  2W8U A;  1AKC A;  2Z9U A;  2V1P A;  3LVK A;  4MSO A;  4W91 A;  5EAA A;  4F5F A;  1YIY A;  4BHD A;  3B1E A;  4WXF A;  4ATQ A;  2FN6 A;  3ZZJ A;  1RV3 A;  5M49 A;  1AHE A;  3FQA A;  2D64 A;  2AY2 A;  2Z9W A;  4EMY A;  4ZSY A;  3GET A;  1UU1 A;  3HMU A;  4RJY A;  3N4S A;  2E7I A;  1QJ5 A;  4A72 A;  3CQ6 A;  1I41 A;  1Z3Z A;  4MY5 A;  5J8Q A;  1C7N A;  3NYU A;  2XH1 A;  4Y0D A;  3CBF A;  3EIB A;  5KTB A;  3AEO A;  1AY8 A;  3NU8 A;  2YKX A;  3GZD A;  4ADE A;  2JJF A;  3BCX A;  3PDB B;  3UE8 A;  1S0A A;  2BYJ A;  3EUC A;  3ASB A;  4DBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...