1ARGA

Aspartate aminotransferase, phospho-5'-pyridoxyl aspartate complex
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Changing the reaction specificity of a pyridoxal-5'-phosphate-dependent enzyme.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (aminotransferase)
total genus 139
structure length 396
sequence length 396
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1995-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1argA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1argA01
1QJ3A 1BJOA 1IAYA 4WB0A 1WSTA 4PIWA 2DKJA 4F5LA 2BKWA 3ISLA 3HLMA 1M32A 3EUCA 4JE5A 5EQCA 5FT8A 3WCNA 4KXKA 1FC4A 4F5FA 3DRDA 1WYUB 1AHYA 2CINA 4WYGA 5HXXA 3EZSA 1ELUA 3AENA 4RJYA 1D2FA 4ADCA 3Q8NA 9AATA 4UHMA 2W7MA 1G4VA 3GWPA 4LNJA 4WLHA 2HZPA 1FG3A 2CB1A 3FDDA 2WKAA 4JEZA 1UU1A 4RAEA 4WYEA 1X2AA 1LKCA 4A6UA 2HORA 5EUEA 1C9CA 5EIGB 1G7WA 1AY5A 1WYVB 4LNLA 1DJUA 2VIAA 1YIZA 2W8JA 4Y0DA 2W7IA 2V0YA 3GSBA 4JEWA 3NU7A 4A0RA 3PD6A 2AY3A 2W7KA 4DBCA 7AATA 3JWAA 4BA4A 3H7FA 3LV2A 4R8DA 1YNUA 4ITXA 3FD0A 5D5SA 4AZKA 1JF9A 2X5FA 3IF2A 3GBXA 2V1PA 2XBNA 3DR7A 4O6ZA 2DKBA 4GDYA 1DTYA 5G4JA 3RQ1A 3VK3A 3D6KA 4ADBA 4WBTA 4HVKA 1SFFA 3LVMA 2YRIA 1DGEA 3M5UA 1WYUA 1GC4A 2FN6A 3WKSA 3GETA 3I16A 1AY8A 4LW4A 1PMMA 1AJSA 3FVUA 1PG8A 2AY4A 1ECXA 3NYSA 1B4XA 1TOJA 1C4KA 1UU0A 1JS3A 1BJ4A 3MAUA 1V2DA 1MDXA 4KAMA 1AKCA 5EIGA 1OATA 1PFFA 2JJHA 3FZ8A 1WYVA 3HBXA 1AKBA 3KGWA 1KMKA 5M4DA 1ARGA 1CL2A 1MAPA 3PAAA 3ELPA 3F6TA 2VGSA 4IY7A 4ISYA 4JF1A 3BS8A 2G6WA 2X3LA 2VMPA 3I5TA 3RUYA 4F4EA 3FFRA 1B9HA 1ASMA 2BYLA 2HUIA 1CZCA 4CBRA 1BT4A 3AATA 2QLRA 1RVUA 3COGA 3MC6A 4Q76A 3B46A 2YKVA 1D7UA 1SF2A 1I48A 4R5FA 5D95A 4AO4A 2JJEA 2QBTA 4EMYA 4JEYA 3PDBB 1ASAA 1LC8A 1LC7A 2NMPA 4ATPA 3QHXA 1FG7A 1KL2A 4ITGA 3JWBA 3JZLA 1GC0A 1C0NA 5K8BA 1ARHA 2VMVA 2VMSA 3G7QA 1KKJA 1IX6A 1OHWA 2Z9VA 4UOYA 4F5MA 3P6KA 3ZRQA 2ZY5A 2CJHA 2ZY2A 1RV3A 1AIBA 2VIBA 1I43A 4XQ2A 2HUFA 1M0PA 1AMSA 5M4BA 2VMUA 3DR4A 4LNMA 2AY1A 3DYDA 1W7MA 2BI3A 3CQ6A 2AY5A 3G8MA 1C7OA 3NDNA 4U2HA 3UWCA 3ACZA 2FNIA 2D7YA 1B9IA 3E2ZB 4WXBA 8AATA 1M6SA 1AKAA 2YRRA 3NNKA 4ZAHA 5E3KA 2YHKA 2W8TA 1QIRA 3VP6A 3AELA 2BI2A 3DXVA 4CXRA 2Z67A 3MC6C 3PDBA 4OYTA 3MAFB 1B5OA 2BIEA 5DJ1A 3LWSA 2VGZA 1DFOA 4JEVA 4BHDA 3QN6A 3R4TA 4P3MA 1TOKA 2BIAA 2BI5A 1AY4A 4JE5D 2VMZA 2QMAA 5G2QA 2YCTA 3EI7A 1KKPA 2XH1A 1V72A 2YKXA 3JTXA 5DX5A 3GZCA 3FDBA 3WLXA 3ZRRA 4JF0A 1LK9A 1AMRA 2JISA 1ASBA 1BJWA 4OT8A 3AEMA 1SVVA 4PFNA 3WX9A 3H14A 4GE7A 4CVQA 1E5EA 1GCKA 3QBOA 2D64A 3A9YA 3LY1A 4Y0IA 5EFSA 1S0AA 1YIYA 2BYJA 4MQQA 4PFFA 4WLJA 1WKGA 1V2EA 2W7DA 1EQBA 3UAKA 1AHFA 3E2ZA 1GEXA 3FQ8A 5E5IA 4XJMA 4H51A 4U1TA 1BKGA 3FSLA 2VI9A 1CQ7A 4K2IA 1Z3ZA 3N0LA 4TN4A 3I4JA 1T3IA 1VEFA 2VMWA 3BB8A 2VMQA 2CH1A 3MAFA 3MBBA 3TQXA 2ZJGA 4ZWMA 1UKJA 2AY2A 1M7YA 3HL2A 3MEBA 3K28A 4OTLA 3DXWA 1MAQA 3W1IA 1MDZA 4Q75A 4EFFA 1ASFA 4DQ6A 1OXOA 2VMYA 3NRAA 4BA5A 3LVKA 1TOGA 2ORDA 4F5JA 4W91A 4LW2A 2CFBA 2BHXA 2ZYJA 3FVSA 3GZDA 3OP7A 2R0TA 4N0WA 3AEMC 4MGRA 2DGLA 1QZ9A 2C7TA 2FNUA 2PB2A 3E6GA 3GJUA 1CZEA 1SZSA 1ZODA 4EU1A 3OKSA 4OMAA 3EIAA 2OATA 4CBSA 1YJYA 4CXQA 1GEYA 3EI5A 3EI6A 4W1XA 5FT4A 2CSTA 4OCAA 4A0HA 4OC9A 2VMXA 2HP1A 3VAXA 2R5EA 3E2FA 1X0MA 1C7GA 3A2BA 1ASCA 4RJ0A 2YOBA 4Y0HA 1GDEA 2W7LA 3T32A 3BCAA 2EZ1A 5EAAA 2E7JA 5EUDA 3N75A 4XEWA 3AEJA 2JJGA 4ZWVA 3QI6A 1M0QA 2O7CA 3GR9A 4LC3A 1H0CA 2VGTA 4Q31A 4W8IA 4E3RA 1YAAA 2W7EA 3NUBA 1ASNA 4RITA 4ZLVA 2VMNA 4WD2A 1QISA 1LC5A 4A6TA 3F0HA 2ZY3A 3QGUA 1H1CA 4TMRA 2VI8A 4R5ZA 5FT6A 2EH6A 2CTZA 1ASGA 1M0OA 2AEUA 4WYDA 4AO9A 1IX8A 3CQ4A 4IXZA 4UHOA 4F5HA 5EAVA 3ZRPA 1OHVA 4RM1A 1M0NA 1VP4A 2PO3A 4ADDA 3GZDC 3VK4A 1ORDA 4F5IA 2HUUA 1O69A 2VGVA 1ZOBA 2EZ2A 3CQ5A 3HQTA 3VK2A 1O61A 1BQAA 1ELQA 3PIUA 1W3UA 1YOOA 4IXSA 1BS0A 3RBLA 1BW0A 4I8AA 1ZC9A 3K40A 4JEXA 1GEWA 4AZJA 2D5YA 4XJOA 3WKRA 3L8AA 4W5KA 3E2YA 3W1JA 2GB3A 4WYAA 1WKHA 1DKAA 3FVXA 1LS3A 2Z9WA 1GD9A 3BV0A 4L0OA 4A0FA 1E5FA 1S09A 2GMSA 5G4IA 1CS1A 3PDXA 4EB7A 1JG8A 4A72A 1P3WA 2D61A 5F8VA 2R5CB 4XAUA 3PA9A 1BJOB 2VGUA 3AEJC 3N5MA 3CBFA 3AOWA 4WB0B 2VMTA 3WY7A 1CQ6A 3ZZJA 4K2BA 4B9BA 2O1BA 3FZ6A 4E3QA 1XEYA 1M4NA 4IW7A 1VJOA 4XJLA 2E7UA 1ASEA 1CJ0A 5IWQA 4ZDOA 3WGBA 2AATA 1Z7DA 2QB2A 2AY6A 1MLZA 4K2MA 2Z9XA 3BCBA 3MKJA 5BJ4A 1AHXA 1V2FA 4M2MA 2ZSLA 4RIZA 1AMQA 4AOAA 1G4XA 3EI9A 2Z1YA 4PVFA 2C0RA 3BN1A 3B1EA 5LHAA 2D65A 2EGYA 2ZSMA 1G7XA 3JW9A 3DZZA 1TPLA 1UU2A 2VMOA 3LVJA 3NX3A 4BMKA 4ZM4A 3TCMA 2CJDA 4ZDLA 2ZC0A 1N2TA 3II0A 1B5PA 2EPJA 1I41A 1YJSA 3ZZKA 4B98A 3PJ0A 4RLGA 3W1HA 4MKJA 2Q7WA 3ASBA 2BI9A 4XK1A 4IYOB 3UE8A 2C81A 2R5CA 3IHJA 1KMJA 2W7FA 3EIBA 4Q6RA 3TATA 2JG2A 3DU4A 3PPLA 3HDOA 1IBJA 4AH3A 1I29A 1EJIA 2PB0A 1S06A 4MY5A 3BWOA 2JJFA 2WK8A 2R2NA 4QGRA 5M46A 5G09A 3QPGA 1QITA 2JGTA 2VLHA 1AAWA 3G0TA 2E7IA 1XI9A 4WP0A 2X5DA 2BIGA 1MLYA 2HOZA 1AJSB 4KYOA 5DB5A 1IX7A 1ARTA 4F5GA 1BQDA 1PMOA 4GSAA 4TV7A 5FT5A 1DJEA 4ZSYA 4E1OA 3FFHA 4GEBA 1O4SA 4W1VA 1BJNA 3RBFA 2OQXA 2O0RA 2HOXA 3TFTA 3CAIA 3AV7A 2BWPA 1IUGA 1TOEA 2CJGA 4EB5A 4MKKA 4IYOA 1TARA 4IXOA 1TASA 1TATA 1W7LA 1D7RA 2VMRA 3ASAA 5TF5A 1EG5A 1WYTB 5EUNA 2ZP7A 2W7HA 2OKJA 5M49A 2GMUA 3RCHB 5F9SA 1AIAA 4OBUA 3P1TA 2ZY4A 4WYFA 1RVYA 2CY8A 4ZDPA 4HF8A 5G0AA 4WXFA 1TOIA 4M2KA 1GC2A 1CL1A 1D7VA 1GBNA 2AY9A 2YKUA 5LH9A 3WCOA 2ZUKA 4FL0A 2YCPA 1ASDA 3ATHA 3DODA 4RKCA 4UQVA 4GE4A 2DR1A 1LW5A 2VYCA 1N8PA 2W7JA 2FYFA 1C7NA 1AMAA 3B1DA 1OHYA 5J8QA 3R9AA 4R2NA 4UHNA 2Z20A 3FTBA 1Y4IA 3KE3A 3A9ZA 3AEOA 1SZUA 1SZKA 4DGTA 4MSOA 3HVYA 1W23A 3B8XA 1U08A 2W8VA 4ATQA 3BWNA 1JS6A 1N31A 3PGYA 3FZ7A 4FFCA 3BCXA 4ZASA 3NYUA 3B1CA 1WYTA 2HOYA 3KGXA 2D63A 4ADEA 3EZ1A 1DGDA 1RV4A 2D7ZA 2BWOA 2F8JA 5E4ZA 1SPAA 1X28A 3RCHA 3ECDA 3TFUA 2W8WA 3NU8A 2X8UA 2WK7A 3KKIA 2YKYA 2GSAA 2DGKA 2Z61A 3NTJA 3A8UX 2FQ6A 3F9TA 4NOGA 4WYCA 1LW4A 3NYTA 4ZM3A 4P7YA 2W7GA 3VOMA 4OBVA 4RKDA 1IAXA 2QA3A 2VGWA 1AAMA 1KL1A 1GC3A 5G2PA 3K7YA 1S07A 2AY8A 3A9XA 3MADA 5AX8A 1S08A 1AJRA 1AHEA 2WK9A 3JU7A 3L44A 4GE9A 4WXGA 2GQNA 4BQ0A 2OGEA 2CANA 1X29A 1AHGA 3FQ7A 5HHYA 4E77A 1MGVA 1AX4A 3WZFA 4F5KA 4M2JA 1DJ9A 2YCNA 4MQRA 3HT4A 2CH2A 2DOUA 4N0BA 4A0GA 5JAYA 2TPLA 5DJ9A 2D66A 1D7SA 2W8UA 3BC8A 3QM2A 4GRXA 3FQAA 4IX8A 3USFA 2FM1A 3AENB 2HP2A 1B8GA 1CQ8A 3E9KA 3FRKA 3FCRA 5HDMA 1ASLA 5I92A 2AEVA 2AY7A 3DC1A 1IJIA 1YJZA 1ARIA 3WGCA 1J32A 1AICA 2RFVA 3HMUA 1OXPA 2VLFA 1QGNA 2EO5A 1W7NA 2E54A 1MDOA 1O62A 2Z1ZA 3BWNC 3E77A 3LVLB 3NUIA 4A6RA 5BJ3A 4J5UA 4A00A 3LG0A 2OGAA 1ARSA 2BWNA 2Z9UA 4XJPA 1QJ5A 3FKDA 4MQPA 2DGMA 4ZSWA 3RI6A 2QB3A 1J04A 3PD6B 4J8LA 3EI8A 3AOVA 3ELEA 4W1WA 2OKKA 2BI1A 2C44A 3AEPA 1IVRA 5C6UA
chains in the Genus database with same CATH superfamily
1QJ3A 1BJOA 1IAYA 4WB0A 1WSTA 4PIWA 2DKJA 4F5LA 2BKWA 3ISLA 3HLMA 1M32A 3EUCA 4JE5A 5EQCA 5FT8A 3WCNA 4KXKA 1FC4A 4F5FA 3DRDA 1WYUB 1AHYA 2CINA 4WYGA 5HXXA 2KFPA 3EZSA 1ELUA 3AENA 4RJYA 1D2FA 4ADCA 3Q8NA 9AATA 4UHMA 2W7MA 1G4VA 3GWPA 4LNJA 4WLHA 2HZPA 1FG3A 2CB1A 3FDDA 2WKAA 4JEZA 1UU1A 4RAEA 4WYEA 1X2AA 1LKCA 4A6UA 2HORA 5EUEA 1C9CA 5EIGB 1G7WA 1AY5A 4H63Q 1WYVB 4LNLA 1DJUA 2VIAA 1YIZA 2W8JA 4Y0DA 2W7IA 2V0YA 3GSBA 4JEWA 3NU7A 4A0RA 3PD6A 2AY3A 2W7KA 4DBCA 7AATA 3JWAA 4BA4A 3H7FA 3LV2A 4R8DA 1YNUA 4ITXA 3FD0A 5D5SA 4AZKA 5KTBA 1JF9A 2X5FA 3IF2A 3H9XA 3GBXA 2V1PA 2XBNA 3DR7A 4O6ZA 2DKBA 4GDYA 1DTYA 5G4JA 3RQ1A 3VK3A 3D6KA 4ADBA 4WBTA 4HVKA 1SFFA 3LVMA 2YRIA 1DGEA 3M5UA 1WYUA 1GC4A 2FN6A 3WKSA 3GETA 3I16A 1AY8A 4LW4A 1PMMA 1AJSA 3FVUA 1PG8A 2AY4A 1ECXA 3NYSA 1B4XA 1TOJA 1C4KA 1UU0A 1JS3A 1BJ4A 3MAUA 1V2DA 1MDXA 4KAMA 1AKCA 5EIGA 1OATA 1PFFA 2JJHA 3FZ8A 1WYVA 3HBXA 1AKBA 3KGWA 1KMKA 5M4DA 1ARGA 1CL2A 1MAPA 3PAAA 3ELPA 3F6TA 2VGSA 4IY7A 4ISYA 4JF1A 3BS8A 2G6WA 2X3LA 2VMPA 3I5TA 3RUYA 4F4EA 3FFRA 1B9HA 1ASMA 2BYLA 2HUIA 1CZCA 4CBRA 1BT4A 3AATA 2QLRA 1RVUA 3COGA 3MC6A 4Q76A 3B46A 2YKVA 1D7UA 1SF2A 1I48A 4R5FA 5D95A 4AO4A 2JJEA 2QBTA 4EMYA 4JEYA 3PDBB 1ASAA 1LC8A 1LC7A 2NMPA 4ATPA 3QHXA 1FG7A 1KL2A 4ITGA 3JWBA 3JZLA 1GC0A 1C0NA 5K8BA 1ARHA 2VMVA 2VMSA 3G7QA 1KKJA 1IX6A 1OHWA 2Z9VA 4UOYA 4F5MA 3P6KA 3ZRQA 2ZY5A 2CJHA 2ZY2A 1RV3A 1AIBA 2VIBA 1I43A 4XQ2A 2HUFA 1M0PA 1AMSA 5M4BA 2VMUA 3DR4A 3N7NA 4LNMA 2AY1A 3DYDA 1W7MA 2BI3A 3CQ6A 2AY5A 3G8MA 1C7OA 3NDNA 4U2HA 3UWCA 3ACZA 2FNIA 2D7YA 1B9IA 3E2ZB 4WXBA 8AATA 1M6SA 1AKAA 2YRRA 3NNKA 4ZAHA 5E3KA 2YHKA 2W8TA 1QIRA 3VP6A 3AELA 2FKIA 2BI2A 3DXVA 4CXRA 2Z67A 3MC6C 3PDBA 4OYTA 3MAFB 1B5OA 2BIEA 5DJ1A 3LWSA 2VGZA 1DFOA 4JEVA 4BHDA 3QN6A 3R4TA 4P3MA 1TOKA 2BIAA 2BI5A 1AY4A 4JE5D 2VMZA 2QMAA 5G2QA 2YCTA 3EI7A 1KKPA 2XH1A 1V72A 2YKXA 3JTXA 5DX5A 3GZCA 3FDBA 3WLXA 3ZRRA 4JF0A 1LK9A 1AMRA 2JISA 1ASBA 1BJWA 4OT8A 3AEMA 1SVVA 4PFNA 2A1VA 3WX9A 3H14A 4GE7A 4CVQA 1E5EA 1GCKA 3QBOA 2D64A 3A9YA 3LY1A 4Y0IA 5EFSA 1S0AA 1YIYA 2BYJA 4MQQA 4PFFA 4WLJA 1WKGA 1V2EA 2W7DA 1EQBA 3UAKA 1AHFA 3E2ZA 1GEXA 3FQ8A 5E5IA 4XJMA 4H51A 4U1TA 1BKGA 3FSLA 2VI9A 1CQ7A 4K2IA 1Z3ZA 3N0LA 4TN4A 3I4JA 1T3IA 1VEFA 2VMWA 3BB8A 2VMQA 2CH1A 3MAFA 3MBBA 3TQXA 2ZJGA 4ZWMA 1UKJA 2AY2A 1M7YA 3HL2A 3MEBA 3K28A 4OTLA 3DXWA 1MAQA 3W1IA 1MDZA 4Q75A 4EFFA 1ASFA 4DQ6A 1OXOA 2VMYA 3NRAA 4BA5A 3LVKA 1TOGA 2ORDA 4F5JA 4W91A 4LW2A 2CFBA 2BHXA 2ZYJA 3FVSA 3GZDA 3OP7A 2R0TA 4N0WA 3AEMC 4MGRA 2DGLA 1QZ9A 2C7TA 2FNUA 2PB2A 3E6GA 3GJUA 1CZEA 1SZSA 1ZODA 4EU1A 3OKSA 4OMAA 3EIAA 2OATA 4CBSA 1YJYA 4CXQA 1GEYA 3EI5A 3EI6A 4W1XA 5FT4A 2CSTA 4OCAA 4A0HA 4OC9A 2VMXA 2HP1A 3VAXA 2R5EA 3E2FA 1X0MA 1C7GA 3A2BA 1ASCA 4RJ0A 2YOBA 4Y0HA 1GDEA 2W7LA 3T32A 3BCAA 2EZ1A 5EAAA 2E7JA 5EUDA 3N75A 4XEWA 3AEJA 2JJGA 3N4RA 4ZWVA 3QI6A 1M0QA 2O7CA 3GR9A 4LC3A 1H0CA 2VGTA 4Q31A 4W8IA 4E3RA 1YAAA 2W7EA 3NUBA 1ASNA 4RITA 4ZLVA 2VMNA 4WD2A 1QISA 1LC5A 4A6TA 3F0HA 2ZY3A 3QGUA 1H1CA 4TMRA 2VI8A 4R5ZA 5FT6A 2EH6A 2CTZA 1ASGA 1M0OA 2AEUA 4WYDA 4AO9A 1IX8A 3CQ4A 4IXZA 4UHOA 4F5HA 5EAVA 3ZRPA 1OHVA 4RM1A 1M0NA 1KAFA 1VP4A 2PO3A 4ADDA 3GZDC 3VK4A 1ORDA 4F5IA 2HUUA 1O69A 2VGVA 1ZOBA 2EZ2A 3CQ5A 3HQTA 3VK2A 1O61A 1BQAA 1ELQA 3PIUA 1W3UA 1YOOA 4IXSA 1BS0A 3RBLA 1BW0A 4I8AA 1ZC9A 3K40A 4JEXA 1GEWA 4AZJA 2D5YA 4XJOA 3WKRA 3L8AA 4W5KA 3E2YA 3W1JA 2GB3A 4WYAA 1WKHA 1DKAA 3FVXA 1LS3A 2Z9WA 1GD9A 3BV0A 4L0OA 4A0FA 1E5FA 1S09A 2GMSA 5G4IA 1CS1A 3PDXA 4EB7A 1JG8A 4A72A 1P3WA 2D61A 5F8VA 2R5CB 4XAUA 3PA9A 1BJOB 2VGUA 3AEJC 3N5MA 3CBFA 3AOWA 4WB0B 2VMTA 3WY7A 1CQ6A 3ZZJA 4K2BA 4B9BA 2O1BA 3FZ6A 4E3QA 1XEYA 1M4NA 4IW7A 1VJOA 4XJLA 2E7UA 1ASEA 1CJ0A 5IWQA 4ZDOA 3WGBA 2AATA 1Z7DA 2QB2A 2AY6A 1MLZA 4K2MA 2Z9XA 3BCBA 3MKJA 5BJ4A 1AHXA 1V2FA 4M2MA 2ZSLA 4RIZA 1AMQA 4AOAA 1G4XA 3EI9A 2Z1YA 4PVFA 2C0RA 3BN1A 3B1EA 5LHAA 2G7JA 2D65A 2EGYA 2ZSMA 1G7XA 3JW9A 3DZZA 1TPLA 1UU2A 2VMOA 3LVJA 3NX3A 4BMKA 4ZM4A 3TCMA 2CJDA 4ZDLA 3N4XA 2ZC0A 1N2TA 3II0A 1B5PA 2EPJA 1I41A 1YJSA 3ZZKA 4B98A 3PJ0A 4RLGA 3W1HA 4MKJA 2Q7WA 3ASBA 2BI9A 4XK1A 4IYOB 3UE8A 2C81A 2R5CA 3IHJA 1KMJA 2W7FA 3EIBA 4Q6RA 3TATA 2JG2A 3DU4A 3PPLA 3HDOA 1IBJA 4AH3A 2EYQA 1I29A 1EJIA 2PB0A 1S06A 4MY5A 3BWOA 2JJFA 2WK8A 2R2NA 4QGRA 5M46A 5G09A 3QPGA 1QITA 2JGTA 2VLHA 1AAWA 3G0TA 2E7IA 1XI9A 4WP0A 2X5DA 2BIGA 1MLYA 2HOZA 1AJSB 4KYOA 5DB5A 1IX7A 1ARTA 4F5GA 1BQDA 1PMOA 4GSAA 4TV7A 5FT5A 1DJEA 4ZSYA 4E1OA 3FFHA 4GEBA 1O4SA 4W1VA 1BJNA 3RBFA 2OQXA 2O0RA 2HOXA 3TFTA 3CAIA 3AV7A 2BWPA 1IUGA 1TOEA 2CJGA 4EB5A 4MKKA 4IYOA 1TARA 4IXOA 1TASA 1TATA 1W7LA 1D7RA 2VMRA 3ASAA 5TF5A 1EG5A 1WYTB 5EUNA 2ZP7A 2W7HA 2OKJA 5M49A 4K05A 2GMUA 3RCHB 5F9SA 1AIAA 4OBUA 3P1TA 2ZY4A 4WYFA 1RVYA 2CY8A 4ZDPA 4HF8A 5G0AA 4WXFA 1TOIA 4M2KA 1GC2A 1CL1A 1D7VA 1GBNA 2AY9A 2YKUA 5LH9A 3WCOA 2ZUKA 4FL0A 2YCPA 1ASDA 3ATHA 3DODA 4RKCA 4UQVA 4GE4A 2DR1A 1LW5A 2VYCA 1N8PA 2W7JA 2FYFA 1C7NA 1AMAA 3B1DA 1OHYA 5J8QA 3R9AA 4R2NA 4UHNA 2Z20A 3FTBA 1Y4IA 3KE3A 3A9ZA 3AEOA 1SZUA 1SZKA 4DGTA 4MSOA 3HVYA 1W23A 3B8XA 1U08A 2W8VA 4ATQA 3BWNA 1JS6A 1N31A 3PGYA 3FZ7A 4FFCA 3BCXA 4ZASA 3NYUA 3B1CA 1WYTA 2HOYA 3KGXA 2D63A 4ADEA 3EZ1A 1DGDA 1RV4A 2D7ZA 2BWOA 2F8JA 5E4ZA 1SPAA 1X28A 2WB6A 3RCHA 3ECDA 3TFUA 2W8WA 3NU8A 2X8UA 2WK7A 3KKIA 2YKYA 2GSAA 2DGKA 2Z61A 3NTJA 3A8UX 2FQ6A 3F9TA 4NOGA 4WYCA 1LW4A 3NYTA 4ZM3A 4P7YA 2W7GA 3VOMA 4OBVA 4RKDA 1IAXA 2QA3A 2VGWA 1AAMA 1KL1A 1GC3A 5G2PA 3K7YA 1S07A 2AY8A 3A9XA 3MADA 5AX8A 1S08A 1AJRA 1AHEA 2WK9A 3JU7A 3L44A 4GE9A 4WXGA 2GQNA 4BQ0A 2OGEA 2CANA 1X29A 1AHGA 3FQ7A 5HHYA 4E77A 1MGVA 1AX4A 3WZFA 4F5KA 4M2JA 1DJ9A 2YCNA 4MQRA 3HT4A 2CH2A 2DOUA 4N0BA 4A0GA 5JAYA 2TPLA 2QSRA 5DJ9A 2D66A 1D7SA 2W8UA 3BC8A 3QM2A 4GRXA 3FQAA 4IX8A 3USFA 2FM1A 3AENB 2HP2A 1B8GA 1CQ8A 3E9KA 3FRKA 3FCRA 5HDMA 1ASLA 5I92A 2AEVA 2AY7A 3DC1A 1IJIA 1YJZA 1ARIA 3WGCA 1J32A 1AICA 2RFVA 3HMUA 1OXPA 2VLFA 1QGNA 2EO5A 1W7NA 2E54A 1MDOA 1O62A 2Z1ZA 3BWNC 3E77A 3LVLB 3NUIA 4A6RA 5BJ3A 4J5UA 4A00A 3LG0A 2OGAA 3N4SA 1ARSA 2BWNA 2Z9UA 4XJPA 1QJ5A 3FKDA 4MQPA 2DGMA 4ZSWA 3RI6A 2QB3A 1J04A 3PD6B 4J8LA 3EI8A 3AOVA 3ELEA 4W1WA 2OKKA 2BI1A 2C44A 3AEPA 1IVRA 5C6UA
chains in the Genus database with same CATH topology
1QJ3A 1BJOA 1IAYA 4WB0A 1WSTA 4PIWA 2DKJA 4F5LA 2BKWA 3ISLA 3HLMA 1M32A 3EUCA 4JE5A 5EQCA 5FT8A 3WCNA 4KXKA 1FC4A 4F5FA 3DRDA 1WYUB 1AHYA 2CINA 4WYGA 5HXXA 2KFPA 3EZSA 1ELUA 3AENA 4RJYA 1D2FA 4ADCA 3Q8NA 9AATA 4UHMA 2W7MA 1G4VA 3GWPA 4LNJA 4WLHA 2HZPA 1FG3A 2CB1A 3FDDA 2WKAA 4JEZA 1UU1A 4RAEA 4WYEA 1X2AA 1LKCA 4A6UA 2HORA 5EUEA 1C9CA 5EIGB 1G7WA 1AY5A 4H63Q 1WYVB 4LNLA 1DJUA 2VIAA 1YIZA 2W8JA 4Y0DA 2W7IA 2V0YA 3GSBA 4JEWA 3NU7A 4A0RA 3PD6A 2AY3A 2W7KA 4DBCA 7AATA 3JWAA 4BA4A 3H7FA 3LV2A 4R8DA 1YNUA 4ITXA 3FD0A 5D5SA 4AZKA 5KTBA 1JF9A 2X5FA 3IF2A 3H9XA 3GBXA 2V1PA 2XBNA 3DR7A 4O6ZA 2DKBA 4GDYA 1DTYA 5G4JA 3RQ1A 3VK3A 3D6KA 4ADBA 4WBTA 4HVKA 1SFFA 3LVMA 2YRIA 1DGEA 3M5UA 1WYUA 1GC4A 2FN6A 3WKSA 3GETA 3I16A 1AY8A 4LW4A 1PMMA 1AJSA 3FVUA 1PG8A 2AY4A 1ECXA 3NYSA 1B4XA 1TOJA 1C4KA 1UU0A 1JS3A 1BJ4A 3MAUA 1V2DA 1MDXA 4KAMA 1AKCA 5EIGA 1OATA 1PFFA 2JJHA 3FZ8A 1WYVA 3HBXA 1AKBA 3KGWA 1KMKA 5M4DA 1ARGA 1CL2A 1MAPA 3PAAA 3ELPA 3F6TA 2VGSA 4IY7A 4ISYA 4JF1A 3BS8A 2G6WA 2X3LA 2VMPA 3I5TA 3RUYA 4F4EA 3FFRA 1B9HA 1ASMA 2BYLA 2HUIA 1CZCA 4CBRA 1BT4A 3AATA 2QLRA 1RVUA 3COGA 3MC6A 4Q76A 3B46A 2YKVA 1D7UA 1SF2A 1I48A 4R5FA 5D95A 4AO4A 2JJEA 2QBTA 4EMYA 4JEYA 3PDBB 1ASAA 1LC8A 1LC7A 2NMPA 4ATPA 3QHXA 1FG7A 1KL2A 4ITGA 3JWBA 3JZLA 1GC0A 1C0NA 5K8BA 1ARHA 2VMVA 2VMSA 3G7QA 1KKJA 1IX6A 1OHWA 2Z9VA 4UOYA 4F5MA 3P6KA 3ZRQA 2ZY5A 2CJHA 2ZY2A 1RV3A 1AIBA 2VIBA 1I43A 4XQ2A 2HUFA 1M0PA 1AMSA 5M4BA 2VMUA 3DR4A 3N7NA 4LNMA 2AY1A 3DYDA 1W7MA 2BI3A 3CQ6A 2AY5A 3G8MA 1C7OA 3NDNA 4U2HA 3UWCA 3ACZA 2FNIA 2D7YA 1B9IA 3E2ZB 4WXBA 8AATA 1M6SA 1AKAA 2YRRA 3NNKA 4ZAHA 5E3KA 2YHKA 2W8TA 1QIRA 3VP6A 3AELA 2FKIA 2BI2A 3DXVA 4CXRA 2Z67A 3MC6C 3PDBA 4OYTA 3MAFB 1B5OA 2BIEA 5DJ1A 3LWSA 2VGZA 1DFOA 4JEVA 4BHDA 3QN6A 3R4TA 4P3MA 1TOKA 2BIAA 2BI5A 1AY4A 4JE5D 2VMZA 2QMAA 5G2QA 2YCTA 3EI7A 1KKPA 2XH1A 1V72A 2YKXA 3JTXA 5DX5A 3GZCA 3FDBA 3WLXA 3ZRRA 4JF0A 1LK9A 1AMRA 2JISA 1ASBA 1BJWA 4OT8A 3AEMA 1SVVA 4PFNA 2A1VA 3WX9A 3H14A 4GE7A 4CVQA 1E5EA 1GCKA 3QBOA 2D64A 3A9YA 3LY1A 4Y0IA 5EFSA 1S0AA 1YIYA 2BYJA 4MQQA 4PFFA 4WLJA 1WKGA 1V2EA 2W7DA 1EQBA 3UAKA 1AHFA 3E2ZA 1GEXA 3FQ8A 5E5IA 4XJMA 4H51A 4U1TA 1BKGA 3FSLA 2VI9A 1CQ7A 4K2IA 1Z3ZA 3N0LA 4TN4A 3I4JA 1T3IA 1VEFA 2VMWA 3BB8A 2VMQA 2CH1A 3MAFA 3MBBA 3TQXA 2ZJGA 4ZWMA 1UKJA 2AY2A 1M7YA 3HL2A 3MEBA 3K28A 4OTLA 3DXWA 1MAQA 3W1IA 1MDZA 4Q75A 4EFFA 1ASFA 4DQ6A 1OXOA 2VMYA 3NRAA 4BA5A 3LVKA 1TOGA 2ORDA 4F5JA 4W91A 4LW2A 2CFBA 2BHXA 2ZYJA 3FVSA 3GZDA 3OP7A 2R0TA 4N0WA 3AEMC 4MGRA 2DGLA 1QZ9A 2C7TA 2FNUA 2PB2A 3E6GA 3GJUA 1CZEA 1SZSA 1ZODA 4EU1A 3OKSA 4OMAA 3EIAA 2OATA 4CBSA 1YJYA 4CXQA 1GEYA 3EI5A 3EI6A 4W1XA 5FT4A 2CSTA 4OCAA 4A0HA 4OC9A 2VMXA 2HP1A 3VAXA 2R5EA 3E2FA 1X0MA 1C7GA 3A2BA 1ASCA 4RJ0A 2YOBA 4Y0HA 1GDEA 2W7LA 3T32A 3BCAA 2EZ1A 5EAAA 2E7JA 5EUDA 3N75A 4XEWA 3AEJA 2JJGA 3N4RA 4ZWVA 3QI6A 1M0QA 2O7CA 3GR9A 4LC3A 1H0CA 2VGTA 4Q31A 4W8IA 4E3RA 1YAAA 2W7EA 3NUBA 1ASNA 4RITA 4ZLVA 2VMNA 4WD2A 1QISA 1LC5A 4A6TA 3F0HA 2ZY3A 3QGUA 1H1CA 4TMRA 2VI8A 4R5ZA 5FT6A 2EH6A 2CTZA 1ASGA 1M0OA 2AEUA 4WYDA 4AO9A 1IX8A 3CQ4A 4IXZA 4UHOA 4F5HA 5EAVA 3ZRPA 1OHVA 4RM1A 1M0NA 1VP4A 2PO3A 4ADDA 3GZDC 3VK4A 1ORDA 4F5IA 2HUUA 1O69A 2VGVA 1ZOBA 2EZ2A 3CQ5A 3HQTA 3VK2A 1O61A 1BQAA 1ELQA 3PIUA 1W3UA 1YOOA 4IXSA 1BS0A 3RBLA 1BW0A 4I8AA 1ZC9A 3K40A 4JEXA 1GEWA 4AZJA 2D5YA 4XJOA 3WKRA 3L8AA 4W5KA 3E2YA 3W1JA 2GB3A 4WYAA 1WKHA 1DKAA 3FVXA 1LS3A 2Z9WA 1GD9A 3BV0A 4L0OA 4A0FA 1E5FA 1S09A 2GMSA 5G4IA 1CS1A 3PDXA 4EB7A 1JG8A 4A72A 1P3WA 2D61A 5F8VA 2R5CB 4XAUA 3PA9A 1BJOB 2VGUA 3AEJC 3N5MA 3CBFA 3AOWA 4WB0B 2VMTA 3WY7A 1CQ6A 3ZZJA 4K2BA 4B9BA 2O1BA 3FZ6A 4E3QA 1XEYA 1M4NA 4IW7A 1VJOA 4XJLA 2E7UA 1ASEA 1CJ0A 5IWQA 4ZDOA 3WGBA 2AATA 1Z7DA 2QB2A 2AY6A 1MLZA 4K2MA 2Z9XA 3BCBA 3MKJA 5BJ4A 1AHXA 1V2FA 4M2MA 2ZSLA 4RIZA 1AMQA 4AOAA 1G4XA 3EI9A 2Z1YA 4PVFA 2C0RA 3BN1A 3B1EA 5LHAA 2G7JA 2D65A 2EGYA 2ZSMA 1G7XA 3JW9A 3DZZA 1TPLA 1UU2A 2VMOA 3LVJA 3NX3A 4BMKA 4ZM4A 3TCMA 2CJDA 4ZDLA 3N4XA 2ZC0A 1N2TA 3II0A 1B5PA 2EPJA 1I41A 1YJSA 3ZZKA 4B98A 3PJ0A 4RLGA 3W1HA 4MKJA 2Q7WA 3ASBA 2BI9A 4XK1A 4IYOB 3UE8A 2C81A 2R5CA 3IHJA 1KMJA 2W7FA 3EIBA 4Q6RA 3TATA 2JG2A 3DU4A 3PPLA 3HDOA 1IBJA 4AH3A 2EYQA 1I29A 1EJIA 2PB0A 1S06A 4MY5A 3BWOA 2JJFA 2WK8A 2R2NA 4QGRA 5M46A 5G09A 3QPGA 1QITA 2JGTA 2VLHA 1AAWA 3G0TA 2E7IA 1XI9A 4WP0A 2X5DA 2BIGA 1MLYA 2HOZA 1AJSB 4KYOA 5DB5A 1IX7A 1ARTA 4F5GA 1BQDA 1PMOA 4GSAA 4TV7A 5FT5A 1DJEA 4ZSYA 4E1OA 3FFHA 4GEBA 1O4SA 4W1VA 1BJNA 3RBFA 2OQXA 2O0RA 2HOXA 3TFTA 3CAIA 3AV7A 2BWPA 1IUGA 1TOEA 2CJGA 4EB5A 4MKKA 4IYOA 1TARA 4IXOA 1TASA 1TATA 1W7LA 1D7RA 2VMRA 3ASAA 5TF5A 1EG5A 1WYTB 5EUNA 2ZP7A 2W7HA 2OKJA 5M49A 4K05A 2GMUA 3RCHB 5F9SA 1AIAA 4OBUA 3P1TA 2ZY4A 4WYFA 1RVYA 2CY8A 4ZDPA 4HF8A 5G0AA 4WXFA 1TOIA 4M2KA 1GC2A 1CL1A 1D7VA 1GBNA 2AY9A 2YKUA 5LH9A 3WCOA 2ZUKA 4FL0A 2YCPA 1ASDA 3ATHA 3DODA 4RKCA 4UQVA 4GE4A 2DR1A 1LW5A 2VYCA 1N8PA 2W7JA 2FYFA 1C7NA 1AMAA 3B1DA 1OHYA 5J8QA 3R9AA 4R2NA 4UHNA 2Z20A 3FTBA 1Y4IA 3KE3A 3A9ZA 3AEOA 1SZUA 1SZKA 4DGTA 4MSOA 3HVYA 1W23A 3B8XA 1U08A 2W8VA 4ATQA 3BWNA 1JS6A 1N31A 3PGYA 3FZ7A 4FFCA 3BCXA 4ZASA 3NYUA 3B1CA 1WYTA 2HOYA 3KGXA 2D63A 4ADEA 3EZ1A 1DGDA 1RV4A 2D7ZA 2BWOA 2F8JA 5E4ZA 1SPAA 1X28A 2WB6A 3RCHA 3ECDA 3TFUA 2W8WA 3NU8A 2X8UA 2WK7A 3KKIA 2YKYA 2GSAA 2DGKA 2Z61A 3NTJA 3A8UX 2FQ6A 3F9TA 4NOGA 4WYCA 1LW4A 3NYTA 4ZM3A 4P7YA 2W7GA 3VOMA 4OBVA 4RKDA 1IAXA 2QA3A 2VGWA 1AAMA 1KL1A 1GC3A 5G2PA 3K7YA 1S07A 2AY8A 3A9XA 3MADA 5AX8A 1S08A 1AJRA 1AHEA 2WK9A 3JU7A 3L44A 4GE9A 4WXGA 2GQNA 4BQ0A 2OGEA 2CANA 1X29A 1AHGA 3FQ7A 5HHYA 4E77A 1MGVA 1AX4A 3WZFA 4F5KA 4M2JA 1DJ9A 2YCNA 4MQRA 3HT4A 2CH2A 2DOUA 4N0BA 4A0GA 5JAYA 2TPLA 2QSRA 5DJ9A 2D66A 1D7SA 2W8UA 3BC8A 3QM2A 4GRXA 3FQAA 4IX8A 3USFA 2FM1A 3AENB 2HP2A 1B8GA 1CQ8A 3E9KA 3FRKA 3FCRA 5HDMA 1ASLA 5I92A 2AEVA 2AY7A 3DC1A 1IJIA 1YJZA 1ARIA 3WGCA 1J32A 1AICA 2RFVA 3HMUA 1OXPA 2VLFA 1QGNA 2EO5A 1W7NA 2E54A 1MDOA 1O62A 2Z1ZA 3BWNC 3E77A 3LVLB 3NUIA 4A6RA 5BJ3A 4J5UA 4A00A 3LG0A 2OGAA 3N4SA 1ARSA 2BWNA 2Z9UA 4XJPA 1QJ5A 3FKDA 4MQPA 2DGMA 4ZSWA 3RI6A 2QB3A 1J04A 3PD6B 4J8LA 3EI8A 3AOVA 3ELEA 4W1WA 2OKKA 2BI1A 2C44A 3AEPA 1IVRA 5C6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJ3 A;  1BJO A;  1IAY A;  4WB0 A;  1WST A;  4PIW A;  2DKJ A;  4F5L A;  2BKW A;  3ISL A;  3HLM A;  1M32 A;  3EUC A;  4JE5 A;  5EQC A;  5FT8 A;  3WCN A;  4KXK A;  1FC4 A;  4F5F A;  3DRD A;  1WYU B;  1AHY A;  2CIN A;  4WYG A;  5HXX A;  3EZS A;  1ELU A;  3AEN A;  4RJY A;  1D2F A;  4ADC A;  3Q8N A;  9AAT A;  4UHM A;  2W7M A;  1G4V A;  3GWP A;  4LNJ A;  4WLH A;  2HZP A;  1FG3 A;  2CB1 A;  3FDD A;  2WKA A;  4JEZ A;  1UU1 A;  4RAE A;  4WYE A;  1X2A A;  1LKC A;  4A6U A;  2HOR A;  5EUE A;  1C9C A;  5EIG B;  1G7W A;  1AY5 A;  1WYV B;  4LNL A;  1DJU A;  2VIA A;  1YIZ A;  2W8J A;  4Y0D A;  2W7I A;  2V0Y A;  3GSB A;  4JEW A;  3NU7 A;  4A0R A;  3PD6 A;  2AY3 A;  2W7K A;  4DBC A;  7AAT A;  3JWA A;  4BA4 A;  3H7F A;  3LV2 A;  4R8D A;  1YNU A;  4ITX A;  3FD0 A;  5D5S A;  4AZK A;  1JF9 A;  2X5F A;  3IF2 A;  3GBX A;  2V1P A;  2XBN A;  3DR7 A;  4O6Z A;  2DKB A;  4GDY A;  1DTY A;  5G4J A;  3RQ1 A;  3VK3 A;  3D6K A;  4ADB A;  4WBT A;  4HVK A;  1SFF A;  3LVM A;  2YRI A;  1DGE A;  3M5U A;  1WYU A;  1GC4 A;  2FN6 A;  3WKS A;  3GET A;  3I16 A;  1AY8 A;  4LW4 A;  1PMM A;  1AJS A;  3FVU A;  1PG8 A;  2AY4 A;  1ECX A;  3NYS A;  1B4X A;  1TOJ A;  1C4K A;  1UU0 A;  1JS3 A;  1BJ4 A;  3MAU A;  1V2D A;  1MDX A;  4KAM A;  1AKC A;  5EIG A;  1OAT A;  1PFF A;  2JJH A;  3FZ8 A;  1WYV A;  3HBX A;  1AKB A;  3KGW A;  1KMK A;  5M4D A;  1ARG A;  1CL2 A;  1MAP A;  3PAA A;  3ELP A;  3F6T A;  2VGS A;  4IY7 A;  4ISY A;  4JF1 A;  3BS8 A;  2G6W A;  2X3L A;  2VMP A;  3I5T A;  3RUY A;  4F4E A;  3FFR A;  1B9H A;  1ASM A;  2BYL A;  2HUI A;  1CZC A;  4CBR A;  1BT4 A;  3AAT A;  2QLR A;  1RVU A;  3COG A;  3MC6 A;  4Q76 A;  3B46 A;  2YKV A;  1D7U A;  1SF2 A;  1I48 A;  4R5F A;  5D95 A;  4AO4 A;  2JJE A;  2QBT A;  4EMY A;  4JEY A;  3PDB B;  1ASA A;  1LC8 A;  1LC7 A;  2NMP A;  4ATP A;  3QHX A;  1FG7 A;  1KL2 A;  4ITG A;  3JWB A;  3JZL A;  1GC0 A;  1C0N A;  5K8B A;  1ARH A;  2VMV A;  2VMS A;  3G7Q A;  1KKJ A;  1IX6 A;  1OHW A;  2Z9V A;  4UOY A;  4F5M A;  3P6K A;  3ZRQ A;  2ZY5 A;  2CJH A;  2ZY2 A;  1RV3 A;  1AIB A;  2VIB A;  1I43 A;  4XQ2 A;  2HUF A;  1M0P A;  1AMS A;  5M4B A;  2VMU A;  3DR4 A;  4LNM A;  2AY1 A;  3DYD A;  1W7M A;  2BI3 A;  3CQ6 A;  2AY5 A;  3G8M A;  1C7O A;  3NDN A;  4U2H A;  3UWC A;  3ACZ A;  2FNI A;  2D7Y A;  1B9I A;  3E2Z B;  4WXB A;  8AAT A;  1M6S A;  1AKA A;  2YRR A;  3NNK A;  4ZAH A;  5E3K A;  2YHK A;  2W8T A;  1QIR A;  3VP6 A;  3AEL A;  2BI2 A;  3DXV A;  4CXR A;  2Z67 A;  3MC6 C;  3PDB A;  4OYT A;  3MAF B;  1B5O A;  2BIE A;  5DJ1 A;  3LWS A;  2VGZ A;  1DFO A;  4JEV A;  4BHD A;  3QN6 A;  3R4T A;  4P3M A;  1TOK A;  2BIA A;  2BI5 A;  1AY4 A;  4JE5 D;  2VMZ A;  2QMA A;  5G2Q A;  2YCT A;  3EI7 A;  1KKP A;  2XH1 A;  1V72 A;  2YKX A;  3JTX A;  5DX5 A;  3GZC A;  3FDB A;  3WLX A;  3ZRR A;  4JF0 A;  1LK9 A;  1AMR A;  2JIS A;  1ASB A;  1BJW A;  4OT8 A;  3AEM A;  1SVV A;  4PFN A;  3WX9 A;  3H14 A;  4GE7 A;  4CVQ A;  1E5E A;  1GCK A;  3QBO A;  2D64 A;  3A9Y A;  3LY1 A;  4Y0I A;  5EFS A;  1S0A A;  1YIY A;  2BYJ A;  4MQQ A;  4PFF A;  4WLJ A;  1WKG A;  1V2E A;  2W7D A;  1EQB A;  3UAK A;  1AHF A;  3E2Z A;  1GEX A;  3FQ8 A;  5E5I A;  4XJM A;  4H51 A;  4U1T A;  1BKG A;  3FSL A;  2VI9 A;  1CQ7 A;  4K2I A;  1Z3Z A;  3N0L A;  4TN4 A;  3I4J A;  1T3I A;  1VEF A;  2VMW A;  3BB8 A;  2VMQ A;  2CH1 A;  3MAF A;  3MBB A;  3TQX A;  2ZJG A;  4ZWM A;  1UKJ A;  2AY2 A;  1M7Y A;  3HL2 A;  3MEB A;  3K28 A;  4OTL A;  3DXW A;  1MAQ A;  3W1I A;  1MDZ A;  4Q75 A;  4EFF A;  1ASF A;  4DQ6 A;  1OXO A;  2VMY A;  3NRA A;  4BA5 A;  3LVK A;  1TOG A;  2ORD A;  4F5J A;  4W91 A;  4LW2 A;  2CFB A;  2BHX A;  2ZYJ A;  3FVS A;  3GZD A;  3OP7 A;  2R0T A;  4N0W A;  3AEM C;  4MGR A;  2DGL A;  1QZ9 A;  2C7T A;  2FNU A;  2PB2 A;  3E6G A;  3GJU A;  1CZE A;  1SZS A;  1ZOD A;  4EU1 A;  3OKS A;  4OMA A;  3EIA A;  2OAT A;  4CBS A;  1YJY A;  4CXQ A;  1GEY A;  3EI5 A;  3EI6 A;  4W1X A;  5FT4 A;  2CST A;  4OCA A;  4A0H A;  4OC9 A;  2VMX A;  2HP1 A;  3VAX A;  2R5E A;  3E2F A;  1X0M A;  1C7G A;  3A2B A;  1ASC A;  4RJ0 A;  2YOB A;  4Y0H A;  1GDE A;  2W7L A;  3T32 A;  3BCA A;  2EZ1 A;  5EAA A;  2E7J A;  5EUD A;  3N75 A;  4XEW A;  3AEJ A;  2JJG A;  4ZWV A;  3QI6 A;  1M0Q A;  2O7C A;  3GR9 A;  4LC3 A;  1H0C A;  2VGT A;  4Q31 A;  4W8I A;  4E3R A;  1YAA A;  2W7E A;  3NUB A;  1ASN A;  4RIT A;  4ZLV A;  2VMN A;  4WD2 A;  1QIS A;  1LC5 A;  4A6T A;  3F0H A;  2ZY3 A;  3QGU A;  1H1C A;  4TMR A;  2VI8 A;  4R5Z A;  5FT6 A;  2EH6 A;  2CTZ A;  1ASG A;  1M0O A;  2AEU A;  4WYD A;  4AO9 A;  1IX8 A;  3CQ4 A;  4IXZ A;  4UHO A;  4F5H A;  5EAV A;  3ZRP A;  1OHV A;  4RM1 A;  1M0N A;  1VP4 A;  2PO3 A;  4ADD A;  3GZD C;  3VK4 A;  1ORD A;  4F5I A;  2HUU A;  1O69 A;  2VGV A;  1ZOB A;  2EZ2 A;  3CQ5 A;  3HQT A;  3VK2 A;  1O61 A;  1BQA A;  1ELQ A;  3PIU A;  1W3U A;  1YOO A;  4IXS A;  1BS0 A;  3RBL A;  1BW0 A;  4I8A A;  1ZC9 A;  3K40 A;  4JEX A;  1GEW A;  4AZJ A;  2D5Y A;  4XJO A;  3WKR A;  3L8A A;  4W5K A;  3E2Y A;  3W1J A;  2GB3 A;  4WYA A;  1WKH A;  1DKA A;  3FVX A;  1LS3 A;  2Z9W A;  1GD9 A;  3BV0 A;  4L0O A;  4A0F A;  1E5F A;  1S09 A;  2GMS A;  5G4I A;  1CS1 A;  3PDX A;  4EB7 A;  1JG8 A;  4A72 A;  1P3W A;  2D61 A;  5F8V A;  2R5C B;  4XAU A;  3PA9 A;  1BJO B;  2VGU A;  3AEJ C;  3N5M A;  3CBF A;  3AOW A;  4WB0 B;  2VMT A;  3WY7 A;  1CQ6 A;  3ZZJ A;  4K2B A;  4B9B A;  2O1B A;  3FZ6 A;  4E3Q A;  1XEY A;  1M4N A;  4IW7 A;  1VJO A;  4XJL A;  2E7U A;  1ASE A;  1CJ0 A;  5IWQ A;  4ZDO A;  3WGB A;  2AAT A;  1Z7D A;  2QB2 A;  2AY6 A;  1MLZ A;  4K2M A;  2Z9X A;  3BCB A;  3MKJ A;  5BJ4 A;  1AHX A;  1V2F A;  4M2M A;  2ZSL A;  4RIZ A;  1AMQ A;  4AOA A;  1G4X A;  3EI9 A;  2Z1Y A;  4PVF A;  2C0R A;  3BN1 A;  3B1E A;  5LHA A;  2D65 A;  2EGY A;  2ZSM A;  1G7X A;  3JW9 A;  3DZZ A;  1TPL A;  1UU2 A;  2VMO A;  3LVJ A;  3NX3 A;  4BMK A;  4ZM4 A;  3TCM A;  2CJD A;  4ZDL A;  2ZC0 A;  1N2T A;  3II0 A;  1B5P A;  2EPJ A;  1I41 A;  1YJS A;  3ZZK A;  4B98 A;  3PJ0 A;  4RLG A;  3W1H A;  4MKJ A;  2Q7W A;  3ASB A;  2BI9 A;  4XK1 A;  4IYO B;  3UE8 A;  2C81 A;  2R5C A;  3IHJ A;  1KMJ A;  2W7F A;  3EIB A;  4Q6R A;  3TAT A;  2JG2 A;  3DU4 A;  3PPL A;  3HDO A;  1IBJ A;  4AH3 A;  1I29 A;  1EJI A;  2PB0 A;  1S06 A;  4MY5 A;  3BWO A;  2JJF A;  2WK8 A;  2R2N A;  4QGR A;  5M46 A;  5G09 A;  3QPG A;  1QIT A;  2JGT A;  2VLH A;  1AAW A;  3G0T A;  2E7I A;  1XI9 A;  4WP0 A;  2X5D A;  2BIG A;  1MLY A;  2HOZ A;  1AJS B;  4KYO A;  5DB5 A;  1IX7 A;  1ART A;  4F5G A;  1BQD A;  1PMO A;  4GSA A;  4TV7 A;  5FT5 A;  1DJE A;  4ZSY A;  4E1O A;  3FFH A;  4GEB A;  1O4S A;  4W1V A;  1BJN A;  3RBF A;  2OQX A;  2O0R A;  2HOX A;  3TFT A;  3CAI A;  3AV7 A;  2BWP A;  1IUG A;  1TOE A;  2CJG A;  4EB5 A;  4MKK A;  4IYO A;  1TAR A;  4IXO A;  1TAS A;  1TAT A;  1W7L A;  1D7R A;  2VMR A;  3ASA A;  5TF5 A;  1EG5 A;  1WYT B;  5EUN A;  2ZP7 A;  2W7H A;  2OKJ A;  5M49 A;  2GMU A;  3RCH B;  5F9S A;  1AIA A;  4OBU A;  3P1T A;  2ZY4 A;  4WYF A;  1RVY A;  2CY8 A;  4ZDP A;  4HF8 A;  5G0A A;  4WXF A;  1TOI A;  4M2K A;  1GC2 A;  1CL1 A;  1D7V A;  1GBN A;  2AY9 A;  2YKU A;  5LH9 A;  3WCO A;  2ZUK A;  4FL0 A;  2YCP A;  1ASD A;  3ATH A;  3DOD A;  4RKC A;  4UQV A;  4GE4 A;  2DR1 A;  1LW5 A;  2VYC A;  1N8P A;  2W7J A;  2FYF A;  1C7N A;  1AMA A;  3B1D A;  1OHY A;  5J8Q A;  3R9A A;  4R2N A;  4UHN A;  2Z20 A;  3FTB A;  1Y4I A;  3KE3 A;  3A9Z A;  3AEO A;  1SZU A;  1SZK A;  4DGT A;  4MSO A;  3HVY A;  1W23 A;  3B8X A;  1U08 A;  2W8V A;  4ATQ A;  3BWN A;  1JS6 A;  1N31 A;  3PGY A;  3FZ7 A;  4FFC A;  3BCX A;  4ZAS A;  3NYU A;  3B1C A;  1WYT A;  2HOY A;  3KGX A;  2D63 A;  4ADE A;  3EZ1 A;  1DGD A;  1RV4 A;  2D7Z A;  2BWO A;  2F8J A;  5E4Z A;  1SPA A;  1X28 A;  3RCH A;  3ECD A;  3TFU A;  2W8W A;  3NU8 A;  2X8U A;  2WK7 A;  3KKI A;  2YKY A;  2GSA A;  2DGK A;  2Z61 A;  3NTJ A;  3A8U X;  2FQ6 A;  3F9T A;  4NOG A;  4WYC A;  1LW4 A;  3NYT A;  4ZM3 A;  4P7Y A;  2W7G A;  3VOM A;  4OBV A;  4RKD A;  1IAX A;  2QA3 A;  2VGW A;  1AAM A;  1KL1 A;  1GC3 A;  5G2P A;  3K7Y A;  1S07 A;  2AY8 A;  3A9X A;  3MAD A;  5AX8 A;  1S08 A;  1AJR A;  1AHE A;  2WK9 A;  3JU7 A;  3L44 A;  4GE9 A;  4WXG A;  2GQN A;  4BQ0 A;  2OGE A;  2CAN A;  1X29 A;  1AHG A;  3FQ7 A;  5HHY A;  4E77 A;  1MGV A;  1AX4 A;  3WZF A;  4F5K A;  4M2J A;  1DJ9 A;  2YCN A;  4MQR A;  3HT4 A;  2CH2 A;  2DOU A;  4N0B A;  4A0G A;  5JAY A;  2TPL A;  5DJ9 A;  2D66 A;  1D7S A;  2W8U A;  3BC8 A;  3QM2 A;  4GRX A;  3FQA A;  4IX8 A;  3USF A;  2FM1 A;  3AEN B;  2HP2 A;  1B8G A;  1CQ8 A;  3E9K A;  3FRK A;  3FCR A;  5HDM A;  1ASL A;  5I92 A;  2AEV A;  2AY7 A;  3DC1 A;  1IJI A;  1YJZ A;  1ARI A;  3WGC A;  1J32 A;  1AIC A;  2RFV A;  3HMU A;  1OXP A;  2VLF A;  1QGN A;  2EO5 A;  1W7N A;  2E54 A;  1MDO A;  1O62 A;  2Z1Z A;  3BWN C;  3E77 A;  3LVL B;  3NUI A;  4A6R A;  5BJ3 A;  4J5U A;  4A00 A;  3LG0 A;  2OGA A;  1ARS A;  2BWN A;  2Z9U A;  4XJP A;  1QJ5 A;  3FKD A;  4MQP A;  2DGM A;  4ZSW A;  3RI6 A;  2QB3 A;  1J04 A;  3PD6 B;  4J8L A;  3EI8 A;  3AOV A;  3ELE A;  4W1W A;  2OKK A;  2BI1 A;  2C44 A;  3AEP A;  1IVR A;  5C6U A; 
#chains in the Genus database with same CATH topology
 1QJ3 A;  1BJO A;  1IAY A;  4WB0 A;  1WST A;  4PIW A;  2DKJ A;  4F5L A;  2BKW A;  3ISL A;  3HLM A;  1M32 A;  3EUC A;  4JE5 A;  5EQC A;  5FT8 A;  3WCN A;  4KXK A;  1FC4 A;  4F5F A;  3DRD A;  1WYU B;  1AHY A;  2CIN A;  4WYG A;  5HXX A;  2KFP A;  3EZS A;  1ELU A;  3AEN A;  4RJY A;  1D2F A;  4ADC A;  3Q8N A;  9AAT A;  4UHM A;  2W7M A;  1G4V A;  3GWP A;  4LNJ A;  4WLH A;  2HZP A;  1FG3 A;  2CB1 A;  3FDD A;  2WKA A;  4JEZ A;  1UU1 A;  4RAE A;  4WYE A;  1X2A A;  1LKC A;  4A6U A;  2HOR A;  5EUE A;  1C9C A;  5EIG B;  1G7W A;  1AY5 A;  4H63 Q;  1WYV B;  4LNL A;  1DJU A;  2VIA A;  1YIZ A;  2W8J A;  4Y0D A;  2W7I A;  2V0Y A;  3GSB A;  4JEW A;  3NU7 A;  4A0R A;  3PD6 A;  2AY3 A;  2W7K A;  4DBC A;  7AAT A;  3JWA A;  4BA4 A;  3H7F A;  3LV2 A;  4R8D A;  1YNU A;  4ITX A;  3FD0 A;  5D5S A;  4AZK A;  5KTB A;  1JF9 A;  2X5F A;  3IF2 A;  3H9X A;  3GBX A;  2V1P A;  2XBN A;  3DR7 A;  4O6Z A;  2DKB A;  4GDY A;  1DTY A;  5G4J A;  3RQ1 A;  3VK3 A;  3D6K A;  4ADB A;  4WBT A;  4HVK A;  1SFF A;  3LVM A;  2YRI A;  1DGE A;  3M5U A;  1WYU A;  1GC4 A;  2FN6 A;  3WKS A;  3GET A;  3I16 A;  1AY8 A;  4LW4 A;  1PMM A;  1AJS A;  3FVU A;  1PG8 A;  2AY4 A;  1ECX A;  3NYS A;  1B4X A;  1TOJ A;  1C4K A;  1UU0 A;  1JS3 A;  1BJ4 A;  3MAU A;  1V2D A;  1MDX A;  4KAM A;  1AKC A;  5EIG A;  1OAT A;  1PFF A;  2JJH A;  3FZ8 A;  1WYV A;  3HBX A;  1AKB A;  3KGW A;  1KMK A;  5M4D A;  1ARG A;  1CL2 A;  1MAP A;  3PAA A;  3ELP A;  3F6T A;  2VGS A;  4IY7 A;  4ISY A;  4JF1 A;  3BS8 A;  2G6W A;  2X3L A;  2VMP A;  3I5T A;  3RUY A;  4F4E A;  3FFR A;  1B9H A;  1ASM A;  2BYL A;  2HUI A;  1CZC A;  4CBR A;  1BT4 A;  3AAT A;  2QLR A;  1RVU A;  3COG A;  3MC6 A;  4Q76 A;  3B46 A;  2YKV A;  1D7U A;  1SF2 A;  1I48 A;  4R5F A;  5D95 A;  4AO4 A;  2JJE A;  2QBT A;  4EMY A;  4JEY A;  3PDB B;  1ASA A;  1LC8 A;  1LC7 A;  2NMP A;  4ATP A;  3QHX A;  1FG7 A;  1KL2 A;  4ITG A;  3JWB A;  3JZL A;  1GC0 A;  1C0N A;  5K8B A;  1ARH A;  2VMV A;  2VMS A;  3G7Q A;  1KKJ A;  1IX6 A;  1OHW A;  2Z9V A;  4UOY A;  4F5M A;  3P6K A;  3ZRQ A;  2ZY5 A;  2CJH A;  2ZY2 A;  1RV3 A;  1AIB A;  2VIB A;  1I43 A;  4XQ2 A;  2HUF A;  1M0P A;  1AMS A;  5M4B A;  2VMU A;  3DR4 A;  3N7N A;  4LNM A;  2AY1 A;  3DYD A;  1W7M A;  2BI3 A;  3CQ6 A;  2AY5 A;  3G8M A;  1C7O A;  3NDN A;  4U2H A;  3UWC A;  3ACZ A;  2FNI A;  2D7Y A;  1B9I A;  3E2Z B;  4WXB A;  8AAT A;  1M6S A;  1AKA A;  2YRR A;  3NNK A;  4ZAH A;  5E3K A;  2YHK A;  2W8T A;  1QIR A;  3VP6 A;  3AEL A;  2FKI A;  2BI2 A;  3DXV A;  4CXR A;  2Z67 A;  3MC6 C;  3PDB A;  4OYT A;  3MAF B;  1B5O A;  2BIE A;  5DJ1 A;  3LWS A;  2VGZ A;  1DFO A;  4JEV A;  4BHD A;  3QN6 A;  3R4T A;  4P3M A;  1TOK A;  2BIA A;  2BI5 A;  1AY4 A;  4JE5 D;  2VMZ A;  2QMA A;  5G2Q A;  2YCT A;  3EI7 A;  1KKP A;  2XH1 A;  1V72 A;  2YKX A;  3JTX A;  5DX5 A;  3GZC A;  3FDB A;  3WLX A;  3ZRR A;  4JF0 A;  1LK9 A;  1AMR A;  2JIS A;  1ASB A;  1BJW A;  4OT8 A;  3AEM A;  1SVV A;  4PFN A;  2A1V A;  3WX9 A;  3H14 A;  4GE7 A;  4CVQ A;  1E5E A;  1GCK A;  3QBO A;  2D64 A;  3A9Y A;  3LY1 A;  4Y0I A;  5EFS A;  1S0A A;  1YIY A;  2BYJ A;  4MQQ A;  4PFF A;  4WLJ A;  1WKG A;  1V2E A;  2W7D A;  1EQB A;  3UAK A;  1AHF A;  3E2Z A;  1GEX A;  3FQ8 A;  5E5I A;  4XJM A;  4H51 A;  4U1T A;  1BKG A;  3FSL A;  2VI9 A;  1CQ7 A;  4K2I A;  1Z3Z A;  3N0L A;  4TN4 A;  3I4J A;  1T3I A;  1VEF A;  2VMW A;  3BB8 A;  2VMQ A;  2CH1 A;  3MAF A;  3MBB A;  3TQX A;  2ZJG A;  4ZWM A;  1UKJ A;  2AY2 A;  1M7Y A;  3HL2 A;  3MEB A;  3K28 A;  4OTL A;  3DXW A;  1MAQ A;  3W1I A;  1MDZ A;  4Q75 A;  4EFF A;  1ASF A;  4DQ6 A;  1OXO A;  2VMY A;  3NRA A;  4BA5 A;  3LVK A;  1TOG A;  2ORD A;  4F5J A;  4W91 A;  4LW2 A;  2CFB A;  2BHX A;  2ZYJ A;  3FVS A;  3GZD A;  3OP7 A;  2R0T A;  4N0W A;  3AEM C;  4MGR A;  2DGL A;  1QZ9 A;  2C7T A;  2FNU A;  2PB2 A;  3E6G A;  3GJU A;  1CZE A;  1SZS A;  1ZOD A;  4EU1 A;  3OKS A;  4OMA A;  3EIA A;  2OAT A;  4CBS A;  1YJY A;  4CXQ A;  1GEY A;  3EI5 A;  3EI6 A;  4W1X A;  5FT4 A;  2CST A;  4OCA A;  4A0H A;  4OC9 A;  2VMX A;  2HP1 A;  3VAX A;  2R5E A;  3E2F A;  1X0M A;  1C7G A;  3A2B A;  1ASC A;  4RJ0 A;  2YOB A;  4Y0H A;  1GDE A;  2W7L A;  3T32 A;  3BCA A;  2EZ1 A;  5EAA A;  2E7J A;  5EUD A;  3N75 A;  4XEW A;  3AEJ A;  2JJG A;  3N4R A;  4ZWV A;  3QI6 A;  1M0Q A;  2O7C A;  3GR9 A;  4LC3 A;  1H0C A;  2VGT A;  4Q31 A;  4W8I A;  4E3R A;  1YAA A;  2W7E A;  3NUB A;  1ASN A;  4RIT A;  4ZLV A;  2VMN A;  4WD2 A;  1QIS A;  1LC5 A;  4A6T A;  3F0H A;  2ZY3 A;  3QGU A;  1H1C A;  4TMR A;  2VI8 A;  4R5Z A;  5FT6 A;  2EH6 A;  2CTZ A;  1ASG A;  1M0O A;  2AEU A;  4WYD A;  4AO9 A;  1IX8 A;  3CQ4 A;  4IXZ A;  4UHO A;  4F5H A;  5EAV A;  3ZRP A;  1OHV A;  4RM1 A;  1M0N A;  1KAF A;  1VP4 A;  2PO3 A;  4ADD A;  3GZD C;  3VK4 A;  1ORD A;  4F5I A;  2HUU A;  1O69 A;  2VGV A;  1ZOB A;  2EZ2 A;  3CQ5 A;  3HQT A;  3VK2 A;  1O61 A;  1BQA A;  1ELQ A;  3PIU A;  1W3U A;  1YOO A;  4IXS A;  1BS0 A;  3RBL A;  1BW0 A;  4I8A A;  1ZC9 A;  3K40 A;  4JEX A;  1GEW A;  4AZJ A;  2D5Y A;  4XJO A;  3WKR A;  3L8A A;  4W5K A;  3E2Y A;  3W1J A;  2GB3 A;  4WYA A;  1WKH A;  1DKA A;  3FVX A;  1LS3 A;  2Z9W A;  1GD9 A;  3BV0 A;  4L0O A;  4A0F A;  1E5F A;  1S09 A;  2GMS A;  5G4I A;  1CS1 A;  3PDX A;  4EB7 A;  1JG8 A;  4A72 A;  1P3W A;  2D61 A;  5F8V A;  2R5C B;  4XAU A;  3PA9 A;  1BJO B;  2VGU A;  3AEJ C;  3N5M A;  3CBF A;  3AOW A;  4WB0 B;  2VMT A;  3WY7 A;  1CQ6 A;  3ZZJ A;  4K2B A;  4B9B A;  2O1B A;  3FZ6 A;  4E3Q A;  1XEY A;  1M4N A;  4IW7 A;  1VJO A;  4XJL A;  2E7U A;  1ASE A;  1CJ0 A;  5IWQ A;  4ZDO A;  3WGB A;  2AAT A;  1Z7D A;  2QB2 A;  2AY6 A;  1MLZ A;  4K2M A;  2Z9X A;  3BCB A;  3MKJ A;  5BJ4 A;  1AHX A;  1V2F A;  4M2M A;  2ZSL A;  4RIZ A;  1AMQ A;  4AOA A;  1G4X A;  3EI9 A;  2Z1Y A;  4PVF A;  2C0R A;  3BN1 A;  3B1E A;  5LHA A;  2G7J A;  2D65 A;  2EGY A;  2ZSM A;  1G7X A;  3JW9 A;  3DZZ A;  1TPL A;  1UU2 A;  2VMO A;  3LVJ A;  3NX3 A;  4BMK A;  4ZM4 A;  3TCM A;  2CJD A;  4ZDL A;  3N4X A;  2ZC0 A;  1N2T A;  3II0 A;  1B5P A;  2EPJ A;  1I41 A;  1YJS A;  3ZZK A;  4B98 A;  3PJ0 A;  4RLG A;  3W1H A;  4MKJ A;  2Q7W A;  3ASB A;  2BI9 A;  4XK1 A;  4IYO B;  3UE8 A;  2C81 A;  2R5C A;  3IHJ A;  1KMJ A;  2W7F A;  3EIB A;  4Q6R A;  3TAT A;  2JG2 A;  3DU4 A;  3PPL A;  3HDO A;  1IBJ A;  4AH3 A;  2EYQ A;  1I29 A;  1EJI A;  2PB0 A;  1S06 A;  4MY5 A;  3BWO A;  2JJF A;  2WK8 A;  2R2N A;  4QGR A;  5M46 A;  5G09 A;  3QPG A;  1QIT A;  2JGT A;  2VLH A;  1AAW A;  3G0T A;  2E7I A;  1XI9 A;  4WP0 A;  2X5D A;  2BIG A;  1MLY A;  2HOZ A;  1AJS B;  4KYO A;  5DB5 A;  1IX7 A;  1ART A;  4F5G A;  1BQD A;  1PMO A;  4GSA A;  4TV7 A;  5FT5 A;  1DJE A;  4ZSY A;  4E1O A;  3FFH A;  4GEB A;  1O4S A;  4W1V A;  1BJN A;  3RBF A;  2OQX A;  2O0R A;  2HOX A;  3TFT A;  3CAI A;  3AV7 A;  2BWP A;  1IUG A;  1TOE A;  2CJG A;  4EB5 A;  4MKK A;  4IYO A;  1TAR A;  4IXO A;  1TAS A;  1TAT A;  1W7L A;  1D7R A;  2VMR A;  3ASA A;  5TF5 A;  1EG5 A;  1WYT B;  5EUN A;  2ZP7 A;  2W7H A;  2OKJ A;  5M49 A;  4K05 A;  2GMU A;  3RCH B;  5F9S A;  1AIA A;  4OBU A;  3P1T A;  2ZY4 A;  4WYF A;  1RVY A;  2CY8 A;  4ZDP A;  4HF8 A;  5G0A A;  4WXF A;  1TOI A;  4M2K A;  1GC2 A;  1CL1 A;  1D7V A;  1GBN A;  2AY9 A;  2YKU A;  5LH9 A;  3WCO A;  2ZUK A;  4FL0 A;  2YCP A;  1ASD A;  3ATH A;  3DOD A;  4RKC A;  4UQV A;  4GE4 A;  2DR1 A;  1LW5 A;  2VYC A;  1N8P A;  2W7J A;  2FYF A;  1C7N A;  1AMA A;  3B1D A;  1OHY A;  5J8Q A;  3R9A A;  4R2N A;  4UHN A;  2Z20 A;  3FTB A;  1Y4I A;  3KE3 A;  3A9Z A;  3AEO A;  1SZU A;  1SZK A;  4DGT A;  4MSO A;  3HVY A;  1W23 A;  3B8X A;  1U08 A;  2W8V A;  4ATQ A;  3BWN A;  1JS6 A;  1N31 A;  3PGY A;  3FZ7 A;  4FFC A;  3BCX A;  4ZAS A;  3NYU A;  3B1C A;  1WYT A;  2HOY A;  3KGX A;  2D63 A;  4ADE A;  3EZ1 A;  1DGD A;  1RV4 A;  2D7Z A;  2BWO A;  2F8J A;  5E4Z A;  1SPA A;  1X28 A;  2WB6 A;  3RCH A;  3ECD A;  3TFU A;  2W8W A;  3NU8 A;  2X8U A;  2WK7 A;  3KKI A;  2YKY A;  2GSA A;  2DGK A;  2Z61 A;  3NTJ A;  3A8U X;  2FQ6 A;  3F9T A;  4NOG A;  4WYC A;  1LW4 A;  3NYT A;  4ZM3 A;  4P7Y A;  2W7G A;  3VOM A;  4OBV A;  4RKD A;  1IAX A;  2QA3 A;  2VGW A;  1AAM A;  1KL1 A;  1GC3 A;  5G2P A;  3K7Y A;  1S07 A;  2AY8 A;  3A9X A;  3MAD A;  5AX8 A;  1S08 A;  1AJR A;  1AHE A;  2WK9 A;  3JU7 A;  3L44 A;  4GE9 A;  4WXG A;  2GQN A;  4BQ0 A;  2OGE A;  2CAN A;  1X29 A;  1AHG A;  3FQ7 A;  5HHY A;  4E77 A;  1MGV A;  1AX4 A;  3WZF A;  4F5K A;  4M2J A;  1DJ9 A;  2YCN A;  4MQR A;  3HT4 A;  2CH2 A;  2DOU A;  4N0B A;  4A0G A;  5JAY A;  2TPL A;  2QSR A;  5DJ9 A;  2D66 A;  1D7S A;  2W8U A;  3BC8 A;  3QM2 A;  4GRX A;  3FQA A;  4IX8 A;  3USF A;  2FM1 A;  3AEN B;  2HP2 A;  1B8G A;  1CQ8 A;  3E9K A;  3FRK A;  3FCR A;  5HDM A;  1ASL A;  5I92 A;  2AEV A;  2AY7 A;  3DC1 A;  1IJI A;  1YJZ A;  1ARI A;  3WGC A;  1J32 A;  1AIC A;  2RFV A;  3HMU A;  1OXP A;  2VLF A;  1QGN A;  2EO5 A;  1W7N A;  2E54 A;  1MDO A;  1O62 A;  2Z1Z A;  3BWN C;  3E77 A;  3LVL B;  3NUI A;  4A6R A;  5BJ3 A;  4J5U A;  4A00 A;  3LG0 A;  2OGA A;  3N4S A;  1ARS A;  2BWN A;  2Z9U A;  4XJP A;  1QJ5 A;  3FKD A;  4MQP A;  2DGM A;  4ZSW A;  3RI6 A;  2QB3 A;  1J04 A;  3PD6 B;  4J8L A;  3EI8 A;  3AOV A;  3ELE A;  4W1W A;  2OKK A;  2BI1 A;  2C44 A;  3AEP A;  1IVR A;  5C6U A; 
#chains in the Genus database with same CATH homology
 1QJ3 A;  1BJO A;  1IAY A;  4WB0 A;  1WST A;  4PIW A;  2DKJ A;  4F5L A;  2BKW A;  3ISL A;  3HLM A;  1M32 A;  3EUC A;  4JE5 A;  5EQC A;  5FT8 A;  3WCN A;  4KXK A;  1FC4 A;  4F5F A;  3DRD A;  1WYU B;  1AHY A;  2CIN A;  4WYG A;  5HXX A;  2KFP A;  3EZS A;  1ELU A;  3AEN A;  4RJY A;  1D2F A;  4ADC A;  3Q8N A;  9AAT A;  4UHM A;  2W7M A;  1G4V A;  3GWP A;  4LNJ A;  4WLH A;  2HZP A;  1FG3 A;  2CB1 A;  3FDD A;  2WKA A;  4JEZ A;  1UU1 A;  4RAE A;  4WYE A;  1X2A A;  1LKC A;  4A6U A;  2HOR A;  5EUE A;  1C9C A;  5EIG B;  1G7W A;  1AY5 A;  4H63 Q;  1WYV B;  4LNL A;  1DJU A;  2VIA A;  1YIZ A;  2W8J A;  4Y0D A;  2W7I A;  2V0Y A;  3GSB A;  4JEW A;  3NU7 A;  4A0R A;  3PD6 A;  2AY3 A;  2W7K A;  4DBC A;  7AAT A;  3JWA A;  4BA4 A;  3H7F A;  3LV2 A;  4R8D A;  1YNU A;  4ITX A;  3FD0 A;  5D5S A;  4AZK A;  5KTB A;  1JF9 A;  2X5F A;  3IF2 A;  3H9X A;  3GBX A;  2V1P A;  2XBN A;  3DR7 A;  4O6Z A;  2DKB A;  4GDY A;  1DTY A;  5G4J A;  3RQ1 A;  3VK3 A;  3D6K A;  4ADB A;  4WBT A;  4HVK A;  1SFF A;  3LVM A;  2YRI A;  1DGE A;  3M5U A;  1WYU A;  1GC4 A;  2FN6 A;  3WKS A;  3GET A;  3I16 A;  1AY8 A;  4LW4 A;  1PMM A;  1AJS A;  3FVU A;  1PG8 A;  2AY4 A;  1ECX A;  3NYS A;  1B4X A;  1TOJ A;  1C4K A;  1UU0 A;  1JS3 A;  1BJ4 A;  3MAU A;  1V2D A;  1MDX A;  4KAM A;  1AKC A;  5EIG A;  1OAT A;  1PFF A;  2JJH A;  3FZ8 A;  1WYV A;  3HBX A;  1AKB A;  3KGW A;  1KMK A;  5M4D A;  1ARG A;  1CL2 A;  1MAP A;  3PAA A;  3ELP A;  3F6T A;  2VGS A;  4IY7 A;  4ISY A;  4JF1 A;  3BS8 A;  2G6W A;  2X3L A;  2VMP A;  3I5T A;  3RUY A;  4F4E A;  3FFR A;  1B9H A;  1ASM A;  2BYL A;  2HUI A;  1CZC A;  4CBR A;  1BT4 A;  3AAT A;  2QLR A;  1RVU A;  3COG A;  3MC6 A;  4Q76 A;  3B46 A;  2YKV A;  1D7U A;  1SF2 A;  1I48 A;  4R5F A;  5D95 A;  4AO4 A;  2JJE A;  2QBT A;  4EMY A;  4JEY A;  3PDB B;  1ASA A;  1LC8 A;  1LC7 A;  2NMP A;  4ATP A;  3QHX A;  1FG7 A;  1KL2 A;  4ITG A;  3JWB A;  3JZL A;  1GC0 A;  1C0N A;  5K8B A;  1ARH A;  2VMV A;  2VMS A;  3G7Q A;  1KKJ A;  1IX6 A;  1OHW A;  2Z9V A;  4UOY A;  4F5M A;  3P6K A;  3ZRQ A;  2ZY5 A;  2CJH A;  2ZY2 A;  1RV3 A;  1AIB A;  2VIB A;  1I43 A;  4XQ2 A;  2HUF A;  1M0P A;  1AMS A;  5M4B A;  2VMU A;  3DR4 A;  3N7N A;  4LNM A;  2AY1 A;  3DYD A;  1W7M A;  2BI3 A;  3CQ6 A;  2AY5 A;  3G8M A;  1C7O A;  3NDN A;  4U2H A;  3UWC A;  3ACZ A;  2FNI A;  2D7Y A;  1B9I A;  3E2Z B;  4WXB A;  8AAT A;  1M6S A;  1AKA A;  2YRR A;  3NNK A;  4ZAH A;  5E3K A;  2YHK A;  2W8T A;  1QIR A;  3VP6 A;  3AEL A;  2FKI A;  2BI2 A;  3DXV A;  4CXR A;  2Z67 A;  3MC6 C;  3PDB A;  4OYT A;  3MAF B;  1B5O A;  2BIE A;  5DJ1 A;  3LWS A;  2VGZ A;  1DFO A;  4JEV A;  4BHD A;  3QN6 A;  3R4T A;  4P3M A;  1TOK A;  2BIA A;  2BI5 A;  1AY4 A;  4JE5 D;  2VMZ A;  2QMA A;  5G2Q A;  2YCT A;  3EI7 A;  1KKP A;  2XH1 A;  1V72 A;  2YKX A;  3JTX A;  5DX5 A;  3GZC A;  3FDB A;  3WLX A;  3ZRR A;  4JF0 A;  1LK9 A;  1AMR A;  2JIS A;  1ASB A;  1BJW A;  4OT8 A;  3AEM A;  1SVV A;  4PFN A;  2A1V A;  3WX9 A;  3H14 A;  4GE7 A;  4CVQ A;  1E5E A;  1GCK A;  3QBO A;  2D64 A;  3A9Y A;  3LY1 A;  4Y0I A;  5EFS A;  1S0A A;  1YIY A;  2BYJ A;  4MQQ A;  4PFF A;  4WLJ A;  1WKG A;  1V2E A;  2W7D A;  1EQB A;  3UAK A;  1AHF A;  3E2Z A;  1GEX A;  3FQ8 A;  5E5I A;  4XJM A;  4H51 A;  4U1T A;  1BKG A;  3FSL A;  2VI9 A;  1CQ7 A;  4K2I A;  1Z3Z A;  3N0L A;  4TN4 A;  3I4J A;  1T3I A;  1VEF A;  2VMW A;  3BB8 A;  2VMQ A;  2CH1 A;  3MAF A;  3MBB A;  3TQX A;  2ZJG A;  4ZWM A;  1UKJ A;  2AY2 A;  1M7Y A;  3HL2 A;  3MEB A;  3K28 A;  4OTL A;  3DXW A;  1MAQ A;  3W1I A;  1MDZ A;  4Q75 A;  4EFF A;  1ASF A;  4DQ6 A;  1OXO A;  2VMY A;  3NRA A;  4BA5 A;  3LVK A;  1TOG A;  2ORD A;  4F5J A;  4W91 A;  4LW2 A;  2CFB A;  2BHX A;  2ZYJ A;  3FVS A;  3GZD A;  3OP7 A;  2R0T A;  4N0W A;  3AEM C;  4MGR A;  2DGL A;  1QZ9 A;  2C7T A;  2FNU A;  2PB2 A;  3E6G A;  3GJU A;  1CZE A;  1SZS A;  1ZOD A;  4EU1 A;  3OKS A;  4OMA A;  3EIA A;  2OAT A;  4CBS A;  1YJY A;  4CXQ A;  1GEY A;  3EI5 A;  3EI6 A;  4W1X A;  5FT4 A;  2CST A;  4OCA A;  4A0H A;  4OC9 A;  2VMX A;  2HP1 A;  3VAX A;  2R5E A;  3E2F A;  1X0M A;  1C7G A;  3A2B A;  1ASC A;  4RJ0 A;  2YOB A;  4Y0H A;  1GDE A;  2W7L A;  3T32 A;  3BCA A;  2EZ1 A;  5EAA A;  2E7J A;  5EUD A;  3N75 A;  4XEW A;  3AEJ A;  2JJG A;  3N4R A;  4ZWV A;  3QI6 A;  1M0Q A;  2O7C A;  3GR9 A;  4LC3 A;  1H0C A;  2VGT A;  4Q31 A;  4W8I A;  4E3R A;  1YAA A;  2W7E A;  3NUB A;  1ASN A;  4RIT A;  4ZLV A;  2VMN A;  4WD2 A;  1QIS A;  1LC5 A;  4A6T A;  3F0H A;  2ZY3 A;  3QGU A;  1H1C A;  4TMR A;  2VI8 A;  4R5Z A;  5FT6 A;  2EH6 A;  2CTZ A;  1ASG A;  1M0O A;  2AEU A;  4WYD A;  4AO9 A;  1IX8 A;  3CQ4 A;  4IXZ A;  4UHO A;  4F5H A;  5EAV A;  3ZRP A;  1OHV A;  4RM1 A;  1M0N A;  1VP4 A;  2PO3 A;  4ADD A;  3GZD C;  3VK4 A;  1ORD A;  4F5I A;  2HUU A;  1O69 A;  2VGV A;  1ZOB A;  2EZ2 A;  3CQ5 A;  3HQT A;  3VK2 A;  1O61 A;  1BQA A;  1ELQ A;  3PIU A;  1W3U A;  1YOO A;  4IXS A;  1BS0 A;  3RBL A;  1BW0 A;  4I8A A;  1ZC9 A;  3K40 A;  4JEX A;  1GEW A;  4AZJ A;  2D5Y A;  4XJO A;  3WKR A;  3L8A A;  4W5K A;  3E2Y A;  3W1J A;  2GB3 A;  4WYA A;  1WKH A;  1DKA A;  3FVX A;  1LS3 A;  2Z9W A;  1GD9 A;  3BV0 A;  4L0O A;  4A0F A;  1E5F A;  1S09 A;  2GMS A;  5G4I A;  1CS1 A;  3PDX A;  4EB7 A;  1JG8 A;  4A72 A;  1P3W A;  2D61 A;  5F8V A;  2R5C B;  4XAU A;  3PA9 A;  1BJO B;  2VGU A;  3AEJ C;  3N5M A;  3CBF A;  3AOW A;  4WB0 B;  2VMT A;  3WY7 A;  1CQ6 A;  3ZZJ A;  4K2B A;  4B9B A;  2O1B A;  3FZ6 A;  4E3Q A;  1XEY A;  1M4N A;  4IW7 A;  1VJO A;  4XJL A;  2E7U A;  1ASE A;  1CJ0 A;  5IWQ A;  4ZDO A;  3WGB A;  2AAT A;  1Z7D A;  2QB2 A;  2AY6 A;  1MLZ A;  4K2M A;  2Z9X A;  3BCB A;  3MKJ A;  5BJ4 A;  1AHX A;  1V2F A;  4M2M A;  2ZSL A;  4RIZ A;  1AMQ A;  4AOA A;  1G4X A;  3EI9 A;  2Z1Y A;  4PVF A;  2C0R A;  3BN1 A;  3B1E A;  5LHA A;  2G7J A;  2D65 A;  2EGY A;  2ZSM A;  1G7X A;  3JW9 A;  3DZZ A;  1TPL A;  1UU2 A;  2VMO A;  3LVJ A;  3NX3 A;  4BMK A;  4ZM4 A;  3TCM A;  2CJD A;  4ZDL A;  3N4X A;  2ZC0 A;  1N2T A;  3II0 A;  1B5P A;  2EPJ A;  1I41 A;  1YJS A;  3ZZK A;  4B98 A;  3PJ0 A;  4RLG A;  3W1H A;  4MKJ A;  2Q7W A;  3ASB A;  2BI9 A;  4XK1 A;  4IYO B;  3UE8 A;  2C81 A;  2R5C A;  3IHJ A;  1KMJ A;  2W7F A;  3EIB A;  4Q6R A;  3TAT A;  2JG2 A;  3DU4 A;  3PPL A;  3HDO A;  1IBJ A;  4AH3 A;  2EYQ A;  1I29 A;  1EJI A;  2PB0 A;  1S06 A;  4MY5 A;  3BWO A;  2JJF A;  2WK8 A;  2R2N A;  4QGR A;  5M46 A;  5G09 A;  3QPG A;  1QIT A;  2JGT A;  2VLH A;  1AAW A;  3G0T A;  2E7I A;  1XI9 A;  4WP0 A;  2X5D A;  2BIG A;  1MLY A;  2HOZ A;  1AJS B;  4KYO A;  5DB5 A;  1IX7 A;  1ART A;  4F5G A;  1BQD A;  1PMO A;  4GSA A;  4TV7 A;  5FT5 A;  1DJE A;  4ZSY A;  4E1O A;  3FFH A;  4GEB A;  1O4S A;  4W1V A;  1BJN A;  3RBF A;  2OQX A;  2O0R A;  2HOX A;  3TFT A;  3CAI A;  3AV7 A;  2BWP A;  1IUG A;  1TOE A;  2CJG A;  4EB5 A;  4MKK A;  4IYO A;  1TAR A;  4IXO A;  1TAS A;  1TAT A;  1W7L A;  1D7R A;  2VMR A;  3ASA A;  5TF5 A;  1EG5 A;  1WYT B;  5EUN A;  2ZP7 A;  2W7H A;  2OKJ A;  5M49 A;  4K05 A;  2GMU A;  3RCH B;  5F9S A;  1AIA A;  4OBU A;  3P1T A;  2ZY4 A;  4WYF A;  1RVY A;  2CY8 A;  4ZDP A;  4HF8 A;  5G0A A;  4WXF A;  1TOI A;  4M2K A;  1GC2 A;  1CL1 A;  1D7V A;  1GBN A;  2AY9 A;  2YKU A;  5LH9 A;  3WCO A;  2ZUK A;  4FL0 A;  2YCP A;  1ASD A;  3ATH A;  3DOD A;  4RKC A;  4UQV A;  4GE4 A;  2DR1 A;  1LW5 A;  2VYC A;  1N8P A;  2W7J A;  2FYF A;  1C7N A;  1AMA A;  3B1D A;  1OHY A;  5J8Q A;  3R9A A;  4R2N A;  4UHN A;  2Z20 A;  3FTB A;  1Y4I A;  3KE3 A;  3A9Z A;  3AEO A;  1SZU A;  1SZK A;  4DGT A;  4MSO A;  3HVY A;  1W23 A;  3B8X A;  1U08 A;  2W8V A;  4ATQ A;  3BWN A;  1JS6 A;  1N31 A;  3PGY A;  3FZ7 A;  4FFC A;  3BCX A;  4ZAS A;  3NYU A;  3B1C A;  1WYT A;  2HOY A;  3KGX A;  2D63 A;  4ADE A;  3EZ1 A;  1DGD A;  1RV4 A;  2D7Z A;  2BWO A;  2F8J A;  5E4Z A;  1SPA A;  1X28 A;  2WB6 A;  3RCH A;  3ECD A;  3TFU A;  2W8W A;  3NU8 A;  2X8U A;  2WK7 A;  3KKI A;  2YKY A;  2GSA A;  2DGK A;  2Z61 A;  3NTJ A;  3A8U X;  2FQ6 A;  3F9T A;  4NOG A;  4WYC A;  1LW4 A;  3NYT A;  4ZM3 A;  4P7Y A;  2W7G A;  3VOM A;  4OBV A;  4RKD A;  1IAX A;  2QA3 A;  2VGW A;  1AAM A;  1KL1 A;  1GC3 A;  5G2P A;  3K7Y A;  1S07 A;  2AY8 A;  3A9X A;  3MAD A;  5AX8 A;  1S08 A;  1AJR A;  1AHE A;  2WK9 A;  3JU7 A;  3L44 A;  4GE9 A;  4WXG A;  2GQN A;  4BQ0 A;  2OGE A;  2CAN A;  1X29 A;  1AHG A;  3FQ7 A;  5HHY A;  4E77 A;  1MGV A;  1AX4 A;  3WZF A;  4F5K A;  4M2J A;  1DJ9 A;  2YCN A;  4MQR A;  3HT4 A;  2CH2 A;  2DOU A;  4N0B A;  4A0G A;  5JAY A;  2TPL A;  2QSR A;  5DJ9 A;  2D66 A;  1D7S A;  2W8U A;  3BC8 A;  3QM2 A;  4GRX A;  3FQA A;  4IX8 A;  3USF A;  2FM1 A;  3AEN B;  2HP2 A;  1B8G A;  1CQ8 A;  3E9K A;  3FRK A;  3FCR A;  5HDM A;  1ASL A;  5I92 A;  2AEV A;  2AY7 A;  3DC1 A;  1IJI A;  1YJZ A;  1ARI A;  3WGC A;  1J32 A;  1AIC A;  2RFV A;  3HMU A;  1OXP A;  2VLF A;  1QGN A;  2EO5 A;  1W7N A;  2E54 A;  1MDO A;  1O62 A;  2Z1Z A;  3BWN C;  3E77 A;  3LVL B;  3NUI A;  4A6R A;  5BJ3 A;  4J5U A;  4A00 A;  3LG0 A;  2OGA A;  3N4S A;  1ARS A;  2BWN A;  2Z9U A;  4XJP A;  1QJ5 A;  3FKD A;  4MQP A;  2DGM A;  4ZSW A;  3RI6 A;  2QB3 A;  1J04 A;  3PD6 B;  4J8L A;  3EI8 A;  3AOV A;  3ELE A;  4W1W A;  2OKK A;  2BI1 A;  2C44 A;  3AEP A;  1IVR A;  5C6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...