2CSTA

Crystal structure of the closed form of chicken cytosolic aspartate aminotransferase at 1.9 angstroms resolution
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
411
structure length
411
Chain Sequence
AASIFAAVPRAPPVAVFKLTADFREDGDSRKVNLGVGAYRTDEGQPWVLPVVRKVEQLIAGDGSLNHEYLPILGLPEFRANASRIALGDDSPAIAQKRVGSVQGLGGTGALRIGAEFLRRWYNGNNNTATPVYVSSPTWENHNSVFMDAGFKDIRTYRYWDAAKRGLDLQGLLDDMEKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQGFASGSLDKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLNPKQVEYMIKEKHIYLMASGRINMCGLTTKNLDYVAKSIHEAVTKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title Crystal structure of the closed form of chicken cytosolic aspartate aminotransferase at 1.9 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase(aminotransferase)
total genus 155
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1994-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2cstA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2cstA01
4IYOA 2VIBA 3GZCA 1JG8A 4IYOB 1WYTA 1WYTB 2VMVA 3HLMA 4OT8A 4CVQA 2AEUA 2ORDA 3BB8A 2BIGA 1G7WA 3DU4A 3L44A 5BJ4A 3ASAA 2GB3A 4ZM3A 1AKBA 3LVLB 3BWOA 2VGUA 4GRXA 4B9BA 2VMRA 1LW5A 1QISA 3AOVA 3EZSA 3Q8NA 1MDXA 2W7JA 3BWNA 5FT8A 2Z9XA 3WKSA 1B8GA 3PDBA 1SZSA 1GDEA 4MQQA 4ZDLA 2EZ1A 4F5IA 1UKJA 3QBOA 1DFOA 1IX6A 2R5EA 4XK1A 4P3MA 4JF0A 4W8IA 4XJMA 1CQ8A 3AEJC 4ATQA 4EMYA 5LH9A 1MAPA 2EPJA 1ASGA 1C9CA 3JWBA 5IWQA 4M2JA 4EFFA 4TN4A 3BV0A 5AX8A 3TATA 4TV7A 4JEYA 2W7EA 1PFFA 1C7GA 4XJOA 3K40A 1V2FA 2QBTA 3WCNA 2BKWA 1BT4A 1WYUA 2AY6A 4J8LA 4E1OA 1BJOB 4LNJA 3KGXA 4PFNA 2AY4A 4OMAA 1GC4A 1AMRA 2AATA 3COGA 3JWAA 1ARHA 3OKSA 3PIUA 3BN1A 4I8AA 2W7LA 2ZY3A 1O69A 4TMRA 5FT6A 1WKHA 3A9XA 2E7JA 1ZODA 4AOAA 2HOXA 4ZDOA 1W3UA 2VMUA 3RI6A 4GEBA 1H0CA 3G8MA 2BYJA 2PB2A 5G4IA 1XI9A 1AJRA 5EFSA 3MC6A 1OHWA 2C7TA 1N31A 1VEFA 2C81A 2VMTA 3NYTA 3PPLA 4J5UA 4JEZA 2JJEA 3MADA 4OBVA 5M49A 1CS1A 4IXOA 4JE5D 3H7FA 1AY8A 5TF5A 3VK4A 3UAKA 2FYFA 2W7DA 3BWNC 2QB3A 4IW7A 3WKRA 5EQCA 4BA5A 3AEMC 1GC3A 1E5EA 4A6TA 1TPLA 3DZZA 3E2YA 4NOGA 4RLGA 2W8JA 5EUDA 3DXWA 1AMQA 2OATA 3KKIA 3HL2A 3W1HA 2R2NA 1DJUA 2NMPA 2CJHA 3BCAA 4JF1A 4W1VA 4Y0HA 1CL1A 8AATA 3QN6A 1UU0A 2EH6A 2O0RA 3LVKA 5FT4A 1CQ7A 1P3WA 4MKKA 1KMKA 1ASEA 4XEWA 2VLFA 3GZDC 3ZZKA 4RJYA 5EAVA 2W8UA 4GE4A 2Z61A 5I92A 3MAFB 1IX7A 2VI9A 3LG0A 4RKDA 3FDDA 1AIAA 3DXVA 4P7YA 3AEPA 4ATPA 1OXOA 3HQTA 3KGWA 1TOEA 2CH2A 1AKAA 2BIAA 2AY9A 3FQ8A 4WLHA 1T3IA 3ZRPA 1DJ9A 3TFUA 3FTBA 1W7MA 3I5TA 2VMXA 2W8VA 3CQ5A 2RFVA 4AZKA 3CBFA 5D95A 1ASNA 4LNLA 4PVFA 1AJSA 2YKXA 1IAXA 3MC6C 2FNUA 2QB2A 4OC9A 2AY1A 4M2MA 1BQAA 1JS3A 2D7YA 2E54A 2X5FA 2Z67A 3A2BA 3ATHA 1C7OA 3BC8A 4XJLA 2X8UA 5K8BA 1O4SA 3GSBA 1MDZA 4ISYA 2BWPA 1D2FA 3GJUA 1AHYA 1LW4A 4W5KA 1ASFA 4BA4A 1ARTA 3NU7A 3P1TA 1MDOA 4WYEA 3F9TA 1C4KA 3ELPA 5JAYA 1PMMA 4AO9A 1X2AA 3NYUA 5DX5A 3A8UX 4R8DA 3USFA 1FG3A 2D65A 1S09A 1BJ4A 4RM1A 3AENB 4B98A 3E9KA 3NUBA 3HMUA 5G0AA 2HZPA 1LKCA 1VP4A 1YJZA 1JF9A 2VMWA 3NU8A 3PAAA 2VGWA 2HORA 2XBNA 4MQPA 4WB0B 2ZY2A 1AAWA 1RVYA 1WYVB 2CB1A 2FQ6A 2VMSA 3H14A 4MSOA 3VK2A 3RCHB 1SFFA 5LHAA 2TPLA 3FD0A 4ZDPA 1RVUA 2JG2A 2YKVA 1N8PA 1AY5A 2CJDA 2E7IA 2JISA 3F0HA 4ADDA 1C0NA 1YIYA 4WYGA 4ZAHA 2ZSLA 1OHVA 5EIGA 5EIGB 1GEYA 4RKCA 3KE3A 3VAXA 2AEVA 4IXSA 4OBUA 2W8WA 4Q76A 2VMNA 2FNIA 3B46A 4ITXA 3TFTA 1YIZA 5FT5A 2BI5A 2DKBA 4ADEA 1TOKA 3CAIA 4O6ZA 3UE8A 1J04A 1MLZA 2YOBA 4A0FA 3FKDA 1TOJA 1M0PA 2GMSA 1TASA 3HVYA 4KYOA 1IAYA 7AATA 1BW0A 2W8TA 4LW4A 4R5FA 1BKGA 3VOMA 1BJOA 1PMOA 4F5FA 1M6SA 4A6RA 1M0QA 1BJNA 1WKGA 3MEBA 1IJIA 4R5ZA 2EZ2A 2AY3A 1G4VA 3LVJA 1TATA 1QIRA 3E2ZB 1GC0A 2EGYA 2YCTA 4AH3A 1DJEA 1SZKA 1D7RA 2D5YA 1BJWA 4DQ6A 2CH1A 3DODA 1W7NA 2D63A 2Z9VA 2YHKA 3E6GA 2BIEA 1BQDA 3BCBA 3GWPA 2VMYA 1CZCA 2WK9A 2ZSMA 3K7YA 1AICA 2CTZA 2VGVA 1H1CA 1KL2A 2HP2A 3N5MA 2VGSA 2V1PA 4GE9A 3FZ6A 3EI7A 4EB5A 1QITA 2BI9A 4R2NA 4AZJA 3WY7A 4FFCA 5E3KA 1ORDA 2Z1ZA 2FM1A 2ZY5A 1U08A 2X5DA 1KKJA 5DJ9A 5E4ZA 4Q6RA 1ARGA 2BI3A 3DR4A 1IUGA 2JJFA 1X29A 3NNKA 5EUEA 4WP0A 5G2PA 1AX4A 1AHXA 3W1IA 5EUNA 1V72A 2Q7WA 4CBRA 2YRRA 3TQXA 2ZP7A 3BS8A 4HF8A 3WX9A 3IHJA 2AY2A 4ITGA 3BCXA 2E7UA 2YCPA 4IXZA 5HHYA 1AHFA 1AIBA 3MAFA 3RBFA 4IY7A 1X0MA 3ELEA 1TOIA 2GMUA 4ZWMA 3MKJA 5D5SA 2YKUA 4K2BA 5F9SA 1J32A 4N0BA 3P6KA 2CFBA 1UU2A 3HBXA 3QI6A 1MLYA 4BHDA 3FFRA 1LS3A 3EI6A 3FVSA 4LW2A 1ZC9A 1GBNA 2VMZA 3NX3A 5HDMA 4DGTA 1AAMA 3FCRA 3FQAA 4Q75A 1ELQA 2JJGA 2QMAA 1TOGA 4MQRA 3I16A 3MAUA 3QGUA 3EI5A 4K2IA 1O61A 3G7QA 1QZ9A 4ZWVA 2OGEA 1Z3ZA 3R9AA 1GC2A 4WD2A 1AKCA 4WYDA 2W7IA 3RUYA 3N75A 1SPAA 1RV3A 3D6KA 4GSAA 2Z20A 2CANA 3FDBA 3PGYA 1X28A 5EAAA 3JU7A 3LWSA 1S0AA 3AEJA 3R4TA 2PB0A 2VGZA 5DB5A 2DGKA 3ECDA 4CBSA 1QJ3A 4LNMA 2C0RA 2ZC0A 4A00A 1GD9A 4CXRA 3AENA 3B1DA 4ZASA 2HOYA 1WSTA 3EIBA 3A9ZA 1GCKA 3NRAA 2W7KA 4K2MA 3CQ4A 3M5UA 1FG7A 1MAQA 4WB0A 1WYVA 1C7NA 2FN6A 4ZSWA 3G0TA 1BS0A 4HVKA 3HT4A 2BHXA 3RCHA 3JTXA 4KAMA 3NUIA 4RIZA 2Z9WA 3N0LA 1YNUA 4M2KA 1LC8A 1W23A 2GQNA 3VP6A 2CINA 1LK9A 2F8JA 2QA3A 4PFFA 3F6TA 2OQXA 5HXXA 2W7GA 1ASBA 1ASAA 1OATA 1GEWA 1VJOA 3I4JA 1SVVA 3WCOA 3W1JA 2QLRA 2HP1A 3GBXA 4JEXA 4E3RA 2W7FA 2XH1A 2VMOA 1EQBA 3ZRRA 1ASCA 3FZ8A 1YAAA 2OKKA 1Z7DA 2OGAA 2WKAA 3K28A 4F5JA 2JJHA 2BWNA 4F5MA 2YRIA 3AV7A 4N0WA 4XQ2A 2BI1A 3PJ0A 3PDBB 5BJ3A 4A6UA 1I29A 1M4NA 3TCMA 3AEMA 1V2DA 3L8AA 1OHYA 2R5CA 2R5CB 3ISLA 1QGNA 1LC5A 1I43A 2D64A 2HUFA 1D7UA 1EJIA 2HOZA 2VYCA 2Z9UA 3E2ZA 3IF2A 4UOYA 2W7HA 4DBCA 1ASLA 2AY8A 4AO4A 5F8VA 1DGDA 1XEYA 1EG5A 1M7YA 1B4XA 1D7SA 2DGMA 3CQ6A 1ARIA 2BYLA 1RV4A 1S06A 2C44A 2WK8A 3AELA 4XAUA 3E77A 3NDNA 4E77A 1ASDA 2VMPA 4FL0A 3GZDA 5DJ1A 4EU1A 5M46A 4XJPA 1WYUB 3A9YA 3EI8A 4JEVA 2CSTA 2HUUA 3MBBA 4WYAA 4OCAA 4IX8A 2G6WA 3II0A 4RJ0A 1CJ0A 5G09A 1JS6A 3ASBA 4UHOA 3WGCA 3LV2A 2YCNA 3AATA 2VI8A 2CY8A 4WYCA 1CZEA 1ZOBA 2EO5A 4E3QA 4WBTA 1M0NA 1UU1A 2JGTA 4W1XA 4UHNA 4WYFA 1I48A 4ZLVA 3FVUA 2O7CA 3FZ7A 1ARSA 1V2EA 2DKJA 4OYTA 2BI2A 1ECXA 4W91A 4WLJA 4MY5A 3EZ1A 4WXFA 4ADCA 3EIAA 4ZSYA 1B9HA 1S08A 1AY4A 3FQ7A 1IVRA 3VK3A 2HUIA 1D7VA 1YJYA 3AOWA 3JW9A 1M32A 1YOOA 1AMSA 1IBJA 2VGTA 3FSLA 1IX8A 4WXBA 1E5FA 4U2HA 2VIAA 4A0HA 2D66A 4UHMA 1B9IA 2D61A 2CJGA 4A72A 2AY5A 3FVXA 2D7ZA 2R0TA 2WK7A 3QPGA 4JE5A 3ZZJA 4KXKA 3WLXA 3B1EA 2DR1A 1GEXA 3T32A 1AHEA 2Z1YA 3RQ1A 2AY7A 4OTLA 1AMAA 1O62A 4U1TA 3RBLA 1SZUA 3QM2A 4EB7A 4ZM4A 1SF2A 2ZY4A 5M4BA 1B5OA 4H51A 3DRDA 3PA9A 1LC7A 1ELUA 1DKAA 3NTJA 4MGRA 3GETA 4BQ0A 1KL1A 2W7MA 5J8QA 4RAEA 3DYDA 4F5LA 3E2FA 3NYSA 3AEOA 4ADBA 1DTYA 4Y0IA 2ZYJA 1G7XA 4WXGA 4F5KA 3PDXA 1KKPA 3PD6A 3PD6B 9AATA 5E5IA 5G2QA 2VLHA 4MKJA 1CL2A 3LVMA 3QHXA 4F5HA 4W1WA 4GE7A 4QGRA 2ZJGA 2DOUA 4L0OA 4A0RA 3UWCA 2X3LA 1W7LA 3JZLA 3LY1A 1FC4A 3EI9A 3B1CA 1AJSB 1M0OA 3B8XA 3ACZA 3EUCA 3GR9A 5C6UA 2ZUKA 1ASMA 3FRKA 2VMQA 1I41A 1TARA 3OP7A 2V0YA 4JEWA 3WGBA 4BMKA 1PG8A 3DR7A 4Q31A 5G4JA 4F5GA 5M4DA 1MGVA 2YKYA 3DC1A 1CQ6A 1G4XA 3FFHA 4LC3A 4GDYA 3HDOA 1N2TA 4A0GA 1OXPA 4Y0DA 1AHGA 1QJ5A 2GSAA 4F4EA 1KMJA 2O1BA 3WZFA 1S07A 1DGEA 1Y4IA 2PO3A 1YJSA 2OKJA 4PIWA 2BWOA 4RITA 1B5PA 4UQVA 3ZRQA 4CXQA 2DGLA
chains in the Genus database with same CATH superfamily
4IYOA 2VIBA 3GZCA 1JG8A 4IYOB 1WYTA 1WYTB 2VMVA 3HLMA 4OT8A 4CVQA 2AEUA 2ORDA 3BB8A 2BIGA 1G7WA 3DU4A 3L44A 5BJ4A 3ASAA 2GB3A 4ZM3A 1AKBA 3LVLB 3BWOA 2VGUA 4GRXA 4B9BA 2VMRA 1LW5A 1QISA 3AOVA 3EZSA 3Q8NA 2FKIA 1MDXA 2W7JA 3BWNA 5FT8A 2Z9XA 3WKSA 1B8GA 3PDBA 1SZSA 1GDEA 4MQQA 4ZDLA 2EZ1A 4F5IA 1UKJA 3QBOA 1DFOA 1IX6A 2R5EA 4XK1A 4P3MA 4JF0A 4W8IA 4XJMA 1CQ8A 3AEJC 4ATQA 4EMYA 5LH9A 1MAPA 2EPJA 1ASGA 1C9CA 3JWBA 5IWQA 4M2JA 4EFFA 4TN4A 3BV0A 5AX8A 3TATA 4TV7A 4JEYA 2W7EA 1PFFA 1C7GA 4XJOA 3K40A 1V2FA 2QBTA 3WCNA 2BKWA 1BT4A 1WYUA 2AY6A 4J8LA 4E1OA 1BJOB 4LNJA 3KGXA 4PFNA 2AY4A 4OMAA 1GC4A 1AMRA 2AATA 3COGA 3JWAA 1ARHA 3OKSA 3PIUA 3BN1A 4I8AA 2W7LA 2ZY3A 1O69A 4TMRA 3N7NA 5FT6A 1WKHA 3A9XA 2E7JA 1ZODA 4AOAA 2HOXA 4ZDOA 1W3UA 2VMUA 3RI6A 4GEBA 1H0CA 3G8MA 2BYJA 2PB2A 5G4IA 1XI9A 1AJRA 5EFSA 3MC6A 1OHWA 2C7TA 1N31A 1VEFA 2C81A 2VMTA 3NYTA 3PPLA 4J5UA 4JEZA 2JJEA 3MADA 4OBVA 5M49A 4H63Q 1CS1A 4IXOA 4JE5D 3H7FA 1AY8A 5TF5A 3VK4A 3UAKA 2FYFA 2W7DA 4K05A 3BWNC 2QB3A 4IW7A 3WKRA 5EQCA 4BA5A 3AEMC 1GC3A 1E5EA 4A6TA 1TPLA 3DZZA 3E2YA 4NOGA 4RLGA 2W8JA 5EUDA 3DXWA 1AMQA 2OATA 3KKIA 3HL2A 3W1HA 2R2NA 1DJUA 2NMPA 2CJHA 3BCAA 4JF1A 4W1VA 4Y0HA 1CL1A 8AATA 3QN6A 1UU0A 2EH6A 2O0RA 3LVKA 5FT4A 1CQ7A 1P3WA 4MKKA 1KMKA 1ASEA 4XEWA 2VLFA 3GZDC 3ZZKA 4RJYA 5EAVA 2W8UA 4GE4A 2WB6A 2Z61A 5I92A 3MAFB 1IX7A 2VI9A 3LG0A 4RKDA 3FDDA 1AIAA 3DXVA 4P7YA 2KFPA 3AEPA 4ATPA 1OXOA 3HQTA 3KGWA 1TOEA 2CH2A 1AKAA 2BIAA 2AY9A 3FQ8A 4WLHA 1T3IA 3ZRPA 1DJ9A 3TFUA 3FTBA 1W7MA 3I5TA 2VMXA 2W8VA 3CQ5A 3N4XA 2RFVA 4AZKA 3CBFA 5D95A 1ASNA 4LNLA 4PVFA 1AJSA 2YKXA 1IAXA 3MC6C 2FNUA 2QB2A 4OC9A 2AY1A 4M2MA 1BQAA 1JS3A 2D7YA 2E54A 2X5FA 2Z67A 3A2BA 3ATHA 1C7OA 3BC8A 4XJLA 2X8UA 5K8BA 1O4SA 3GSBA 1MDZA 4ISYA 2BWPA 1D2FA 3GJUA 2EYQA 1AHYA 1LW4A 4W5KA 1ASFA 4BA4A 1ARTA 3NU7A 3P1TA 1MDOA 4WYEA 3F9TA 1C4KA 3ELPA 5JAYA 1PMMA 4AO9A 1X2AA 3NYUA 5DX5A 3A8UX 4R8DA 3USFA 1FG3A 2D65A 1S09A 1BJ4A 4RM1A 3AENB 4B98A 3E9KA 3NUBA 3HMUA 5G0AA 2HZPA 1LKCA 1VP4A 1YJZA 1JF9A 2VMWA 3NU8A 3PAAA 2VGWA 2HORA 2XBNA 4MQPA 4WB0B 2ZY2A 1AAWA 1RVYA 1WYVB 2CB1A 2FQ6A 2VMSA 3H14A 4MSOA 3VK2A 3RCHB 1SFFA 5LHAA 2TPLA 3FD0A 4ZDPA 1RVUA 2JG2A 2YKVA 1N8PA 1AY5A 2CJDA 2E7IA 2JISA 3F0HA 4ADDA 1C0NA 1YIYA 4WYGA 4ZAHA 2ZSLA 1OHVA 5EIGA 5EIGB 1GEYA 4RKCA 3KE3A 3VAXA 2AEVA 4IXSA 4OBUA 2W8WA 4Q76A 2VMNA 2FNIA 3B46A 4ITXA 3TFTA 1YIZA 5FT5A 2BI5A 2DKBA 4ADEA 1TOKA 3CAIA 4O6ZA 3UE8A 1J04A 1MLZA 2YOBA 4A0FA 3FKDA 1TOJA 1M0PA 2GMSA 1TASA 3HVYA 4KYOA 1IAYA 7AATA 1BW0A 2W8TA 4LW4A 4R5FA 1BKGA 3VOMA 1BJOA 1PMOA 4F5FA 1M6SA 4A6RA 1M0QA 1BJNA 1WKGA 3MEBA 1IJIA 4R5ZA 2EZ2A 2AY3A 1G4VA 3LVJA 1TATA 1QIRA 3E2ZB 1GC0A 2EGYA 2YCTA 4AH3A 1DJEA 1SZKA 1D7RA 2D5YA 1BJWA 4DQ6A 2CH1A 3DODA 1W7NA 3H9XA 2D63A 2Z9VA 2YHKA 3E6GA 2BIEA 1BQDA 3BCBA 3GWPA 2VMYA 1CZCA 2WK9A 2ZSMA 3K7YA 1AICA 2CTZA 2VGVA 1H1CA 1KL2A 2HP2A 3N5MA 2VGSA 2V1PA 4GE9A 3FZ6A 5KTBA 3EI7A 4EB5A 1QITA 2BI9A 4R2NA 4AZJA 3WY7A 4FFCA 5E3KA 1ORDA 2Z1ZA 2FM1A 2ZY5A 1U08A 2X5DA 1KKJA 5DJ9A 5E4ZA 4Q6RA 1ARGA 2BI3A 3DR4A 1IUGA 2JJFA 1X29A 3NNKA 5EUEA 4WP0A 5G2PA 1AX4A 1AHXA 3W1IA 5EUNA 1V72A 2Q7WA 4CBRA 2YRRA 3TQXA 2ZP7A 3BS8A 4HF8A 3WX9A 3IHJA 2AY2A 4ITGA 3BCXA 2E7UA 2YCPA 4IXZA 5HHYA 1AHFA 1AIBA 3MAFA 3RBFA 4IY7A 1X0MA 3ELEA 1TOIA 2GMUA 4ZWMA 3MKJA 5D5SA 2YKUA 4K2BA 5F9SA 1J32A 4N0BA 3P6KA 2CFBA 1UU2A 3HBXA 3QI6A 1MLYA 4BHDA 3FFRA 1LS3A 3EI6A 3FVSA 4LW2A 1ZC9A 1GBNA 2VMZA 3NX3A 5HDMA 4DGTA 1AAMA 3FCRA 3FQAA 4Q75A 1ELQA 2JJGA 2QMAA 1TOGA 4MQRA 3I16A 3MAUA 3QGUA 3EI5A 4K2IA 1O61A 3G7QA 1QZ9A 2A1VA 4ZWVA 2OGEA 1Z3ZA 3R9AA 1GC2A 4WD2A 1AKCA 4WYDA 2W7IA 3RUYA 3N75A 1SPAA 1RV3A 3D6KA 4GSAA 2Z20A 2CANA 3FDBA 3PGYA 1X28A 5EAAA 3JU7A 3LWSA 1S0AA 3AEJA 3R4TA 2PB0A 2VGZA 5DB5A 2DGKA 3ECDA 4CBSA 1QJ3A 4LNMA 2C0RA 2ZC0A 4A00A 1GD9A 4CXRA 3AENA 3B1DA 4ZASA 2HOYA 1WSTA 3EIBA 3A9ZA 1GCKA 3NRAA 2W7KA 4K2MA 3CQ4A 3M5UA 1FG7A 1MAQA 4WB0A 1WYVA 1C7NA 2FN6A 4ZSWA 3G0TA 1BS0A 4HVKA 3HT4A 2BHXA 3RCHA 3JTXA 4KAMA 3NUIA 4RIZA 2Z9WA 3N0LA 1YNUA 4M2KA 1LC8A 1W23A 2GQNA 3N4RA 3VP6A 2CINA 1LK9A 2F8JA 2QA3A 4PFFA 3F6TA 2OQXA 5HXXA 2W7GA 1ASBA 1ASAA 1OATA 1GEWA 1VJOA 3I4JA 1SVVA 3WCOA 3W1JA 2QLRA 2HP1A 3GBXA 4JEXA 4E3RA 2W7FA 2XH1A 2VMOA 1EQBA 3ZRRA 3N4SA 1ASCA 3FZ8A 1KAFA 1YAAA 2OKKA 1Z7DA 2OGAA 2WKAA 3K28A 4F5JA 2JJHA 2BWNA 4F5MA 2YRIA 3AV7A 4N0WA 4XQ2A 2BI1A 3PJ0A 3PDBB 5BJ3A 4A6UA 1I29A 1M4NA 3TCMA 3AEMA 1V2DA 3L8AA 1OHYA 2R5CA 2R5CB 3ISLA 1QGNA 1LC5A 1I43A 2D64A 2HUFA 1D7UA 1EJIA 2HOZA 2VYCA 2Z9UA 3E2ZA 3IF2A 4UOYA 2W7HA 4DBCA 1ASLA 2AY8A 4AO4A 5F8VA 1DGDA 1XEYA 1EG5A 1M7YA 1B4XA 1D7SA 2DGMA 3CQ6A 1ARIA 2BYLA 1RV4A 1S06A 2C44A 2WK8A 3AELA 4XAUA 3E77A 3NDNA 4E77A 1ASDA 2VMPA 4FL0A 3GZDA 5DJ1A 4EU1A 5M46A 4XJPA 1WYUB 3A9YA 3EI8A 4JEVA 2CSTA 2HUUA 3MBBA 4WYAA 4OCAA 4IX8A 2G6WA 3II0A 4RJ0A 1CJ0A 5G09A 1JS6A 3ASBA 4UHOA 3WGCA 3LV2A 2YCNA 3AATA 2VI8A 2CY8A 4WYCA 1CZEA 1ZOBA 2EO5A 4E3QA 4WBTA 2QSRA 1M0NA 1UU1A 2JGTA 4W1XA 4UHNA 4WYFA 1I48A 4ZLVA 3FVUA 2O7CA 3FZ7A 1ARSA 1V2EA 2DKJA 4OYTA 2BI2A 1ECXA 4W91A 4WLJA 4MY5A 3EZ1A 4WXFA 4ADCA 3EIAA 4ZSYA 1B9HA 1S08A 1AY4A 3FQ7A 1IVRA 3VK3A 2HUIA 1D7VA 1YJYA 3AOWA 3JW9A 1M32A 1YOOA 1AMSA 1IBJA 2VGTA 3FSLA 1IX8A 4WXBA 1E5FA 4U2HA 2VIAA 4A0HA 2D66A 4UHMA 1B9IA 2D61A 2CJGA 4A72A 2AY5A 3FVXA 2D7ZA 2R0TA 2WK7A 3QPGA 4JE5A 3ZZJA 4KXKA 3WLXA 3B1EA 2DR1A 1GEXA 3T32A 1AHEA 2Z1YA 3RQ1A 2AY7A 4OTLA 1AMAA 1O62A 4U1TA 3RBLA 1SZUA 3QM2A 4EB7A 4ZM4A 1SF2A 2ZY4A 5M4BA 1B5OA 4H51A 3DRDA 3PA9A 1LC7A 1ELUA 1DKAA 3NTJA 4MGRA 3GETA 4BQ0A 1KL1A 2W7MA 5J8QA 4RAEA 3DYDA 4F5LA 3E2FA 3NYSA 3AEOA 4ADBA 1DTYA 4Y0IA 2ZYJA 1G7XA 4WXGA 4F5KA 3PDXA 1KKPA 3PD6A 3PD6B 9AATA 5E5IA 5G2QA 2VLHA 4MKJA 1CL2A 3LVMA 3QHXA 4F5HA 4W1WA 4GE7A 4QGRA 2ZJGA 2DOUA 4L0OA 4A0RA 3UWCA 2X3LA 1W7LA 3JZLA 3LY1A 1FC4A 3EI9A 3B1CA 1AJSB 1M0OA 3B8XA 3ACZA 3EUCA 3GR9A 5C6UA 2G7JA 2ZUKA 1ASMA 3FRKA 2VMQA 1I41A 1TARA 3OP7A 2V0YA 4JEWA 3WGBA 4BMKA 1PG8A 3DR7A 4Q31A 5G4JA 4F5GA 5M4DA 1MGVA 2YKYA 3DC1A 1CQ6A 1G4XA 3FFHA 4LC3A 4GDYA 3HDOA 1N2TA 4A0GA 1OXPA 4Y0DA 1AHGA 1QJ5A 2GSAA 4F4EA 1KMJA 2O1BA 3WZFA 1S07A 1DGEA 1Y4IA 2PO3A 1YJSA 2OKJA 4PIWA 2BWOA 4RITA 1B5PA 4UQVA 3ZRQA 4CXQA 2DGLA
chains in the Genus database with same CATH topology
4IYOA 2VIBA 3GZCA 1JG8A 4IYOB 1WYTA 1WYTB 2VMVA 3HLMA 4OT8A 4CVQA 2AEUA 2ORDA 3BB8A 2BIGA 1G7WA 3DU4A 3L44A 5BJ4A 3ASAA 2GB3A 4ZM3A 1AKBA 3LVLB 3BWOA 2VGUA 4GRXA 4B9BA 2VMRA 1LW5A 1QISA 3AOVA 3EZSA 3Q8NA 2FKIA 1MDXA 2W7JA 3BWNA 5FT8A 2Z9XA 3WKSA 1B8GA 3PDBA 1SZSA 1GDEA 4MQQA 4ZDLA 2EZ1A 4F5IA 1UKJA 3QBOA 1DFOA 1IX6A 2R5EA 4XK1A 4P3MA 4JF0A 4W8IA 4XJMA 1CQ8A 3AEJC 4ATQA 4EMYA 5LH9A 1MAPA 2EPJA 1ASGA 1C9CA 3JWBA 5IWQA 4M2JA 4EFFA 4TN4A 3BV0A 5AX8A 3TATA 4TV7A 4JEYA 2W7EA 1PFFA 1C7GA 4XJOA 3K40A 1V2FA 2QBTA 3WCNA 2BKWA 1BT4A 1WYUA 2AY6A 4J8LA 4E1OA 1BJOB 4LNJA 3KGXA 4PFNA 2AY4A 4OMAA 1GC4A 1AMRA 2AATA 3COGA 3JWAA 1ARHA 3OKSA 3PIUA 3BN1A 4I8AA 2W7LA 2ZY3A 1O69A 4TMRA 3N7NA 5FT6A 1WKHA 3A9XA 2E7JA 1ZODA 4AOAA 2HOXA 4ZDOA 1W3UA 2VMUA 3RI6A 4GEBA 1H0CA 3G8MA 2BYJA 2PB2A 5G4IA 1XI9A 1AJRA 5EFSA 3MC6A 1OHWA 2C7TA 1N31A 1VEFA 2C81A 2VMTA 3NYTA 3PPLA 4J5UA 4JEZA 2JJEA 3MADA 4OBVA 5M49A 4H63Q 1CS1A 4IXOA 4JE5D 3H7FA 1AY8A 5TF5A 3VK4A 3UAKA 2FYFA 2W7DA 4K05A 3BWNC 2QB3A 4IW7A 3WKRA 5EQCA 4BA5A 3AEMC 1GC3A 1E5EA 4A6TA 1TPLA 3DZZA 3E2YA 4NOGA 4RLGA 2W8JA 5EUDA 3DXWA 1AMQA 2OATA 3KKIA 3HL2A 3W1HA 2R2NA 1DJUA 2NMPA 2CJHA 3BCAA 4JF1A 4W1VA 4Y0HA 1CL1A 8AATA 3QN6A 1UU0A 2EH6A 2O0RA 3LVKA 5FT4A 1CQ7A 1P3WA 4MKKA 1KMKA 1ASEA 4XEWA 2VLFA 3GZDC 3ZZKA 4RJYA 5EAVA 2W8UA 4GE4A 2WB6A 2Z61A 5I92A 3MAFB 1IX7A 2VI9A 3LG0A 4RKDA 3FDDA 1AIAA 3DXVA 4P7YA 2KFPA 3AEPA 4ATPA 1OXOA 3HQTA 3KGWA 1TOEA 2CH2A 1AKAA 2BIAA 2AY9A 3FQ8A 4WLHA 1T3IA 3ZRPA 1DJ9A 3TFUA 3FTBA 1W7MA 3I5TA 2VMXA 2W8VA 3CQ5A 3N4XA 2RFVA 4AZKA 3CBFA 5D95A 1ASNA 4LNLA 4PVFA 1AJSA 2YKXA 1IAXA 3MC6C 2FNUA 2QB2A 4OC9A 2AY1A 4M2MA 1BQAA 1JS3A 2D7YA 2E54A 2X5FA 2Z67A 3A2BA 3ATHA 1C7OA 3BC8A 4XJLA 2X8UA 5K8BA 1O4SA 3GSBA 1MDZA 4ISYA 2BWPA 1D2FA 3GJUA 2EYQA 1AHYA 1LW4A 4W5KA 1ASFA 4BA4A 1ARTA 3NU7A 3P1TA 1MDOA 4WYEA 3F9TA 1C4KA 3ELPA 5JAYA 1PMMA 4AO9A 1X2AA 3NYUA 5DX5A 3A8UX 4R8DA 3USFA 1FG3A 2D65A 1S09A 1BJ4A 4RM1A 3AENB 4B98A 3E9KA 3NUBA 3HMUA 5G0AA 2HZPA 1LKCA 1VP4A 1YJZA 1JF9A 2VMWA 3NU8A 3PAAA 2VGWA 2HORA 2XBNA 4MQPA 4WB0B 2ZY2A 1AAWA 1RVYA 1WYVB 2CB1A 2FQ6A 2VMSA 3H14A 4MSOA 3VK2A 3RCHB 1SFFA 5LHAA 2TPLA 3FD0A 4ZDPA 1RVUA 2JG2A 2YKVA 1N8PA 1AY5A 2CJDA 2E7IA 2JISA 3F0HA 4ADDA 1C0NA 1YIYA 4WYGA 4ZAHA 2ZSLA 1OHVA 5EIGA 5EIGB 1GEYA 4RKCA 3KE3A 3VAXA 2AEVA 4IXSA 4OBUA 2W8WA 4Q76A 2VMNA 2FNIA 3B46A 4ITXA 3TFTA 1YIZA 5FT5A 2BI5A 2DKBA 4ADEA 1TOKA 3CAIA 4O6ZA 3UE8A 1J04A 1MLZA 2YOBA 4A0FA 3FKDA 1TOJA 1M0PA 2GMSA 1TASA 3HVYA 4KYOA 1IAYA 7AATA 1BW0A 2W8TA 4LW4A 4R5FA 1BKGA 3VOMA 1BJOA 1PMOA 4F5FA 1M6SA 4A6RA 1M0QA 1BJNA 1WKGA 3MEBA 1IJIA 4R5ZA 2EZ2A 2AY3A 1G4VA 3LVJA 1TATA 1QIRA 3E2ZB 1GC0A 2EGYA 2YCTA 4AH3A 1DJEA 1SZKA 1D7RA 2D5YA 1BJWA 4DQ6A 2CH1A 3DODA 1W7NA 3H9XA 2D63A 2Z9VA 2YHKA 3E6GA 2BIEA 1BQDA 3BCBA 3GWPA 2VMYA 1CZCA 2WK9A 2ZSMA 3K7YA 1AICA 2CTZA 2VGVA 1H1CA 1KL2A 2HP2A 3N5MA 2VGSA 2V1PA 4GE9A 3FZ6A 5KTBA 3EI7A 4EB5A 1QITA 2BI9A 4R2NA 4AZJA 3WY7A 4FFCA 5E3KA 1ORDA 2Z1ZA 2FM1A 2ZY5A 1U08A 2X5DA 1KKJA 5DJ9A 5E4ZA 4Q6RA 1ARGA 2BI3A 3DR4A 1IUGA 2JJFA 1X29A 3NNKA 5EUEA 4WP0A 5G2PA 1AX4A 1AHXA 3W1IA 5EUNA 1V72A 2Q7WA 4CBRA 2YRRA 3TQXA 2ZP7A 3BS8A 4HF8A 3WX9A 3IHJA 2AY2A 4ITGA 3BCXA 2E7UA 2YCPA 4IXZA 5HHYA 1AHFA 1AIBA 3MAFA 3RBFA 4IY7A 1X0MA 3ELEA 1TOIA 2GMUA 4ZWMA 3MKJA 5D5SA 2YKUA 4K2BA 5F9SA 1J32A 4N0BA 3P6KA 2CFBA 1UU2A 3HBXA 3QI6A 1MLYA 4BHDA 3FFRA 1LS3A 3EI6A 3FVSA 4LW2A 1ZC9A 1GBNA 2VMZA 3NX3A 5HDMA 4DGTA 1AAMA 3FCRA 3FQAA 4Q75A 1ELQA 2JJGA 2QMAA 1TOGA 4MQRA 3I16A 3MAUA 3QGUA 3EI5A 4K2IA 1O61A 3G7QA 1QZ9A 2A1VA 4ZWVA 2OGEA 1Z3ZA 3R9AA 1GC2A 4WD2A 1AKCA 4WYDA 2W7IA 3RUYA 3N75A 1SPAA 1RV3A 3D6KA 4GSAA 2Z20A 2CANA 3FDBA 3PGYA 1X28A 5EAAA 3JU7A 3LWSA 1S0AA 3AEJA 3R4TA 2PB0A 2VGZA 5DB5A 2DGKA 3ECDA 4CBSA 1QJ3A 4LNMA 2C0RA 2ZC0A 4A00A 1GD9A 4CXRA 3AENA 3B1DA 4ZASA 2HOYA 1WSTA 3EIBA 3A9ZA 1GCKA 3NRAA 2W7KA 4K2MA 3CQ4A 3M5UA 1FG7A 1MAQA 4WB0A 1WYVA 1C7NA 2FN6A 4ZSWA 3G0TA 1BS0A 4HVKA 3HT4A 2BHXA 3RCHA 3JTXA 4KAMA 3NUIA 4RIZA 2Z9WA 3N0LA 1YNUA 4M2KA 1LC8A 1W23A 2GQNA 3N4RA 3VP6A 2CINA 1LK9A 2F8JA 2QA3A 4PFFA 3F6TA 2OQXA 5HXXA 2W7GA 1ASBA 1ASAA 1OATA 1GEWA 1VJOA 3I4JA 1SVVA 3WCOA 3W1JA 2QLRA 2HP1A 3GBXA 4JEXA 4E3RA 2W7FA 2XH1A 2VMOA 1EQBA 3ZRRA 3N4SA 1ASCA 3FZ8A 1YAAA 2OKKA 1Z7DA 2OGAA 2WKAA 3K28A 4F5JA 2JJHA 2BWNA 4F5MA 2YRIA 3AV7A 4N0WA 4XQ2A 2BI1A 3PJ0A 3PDBB 5BJ3A 4A6UA 1I29A 1M4NA 3TCMA 3AEMA 1V2DA 3L8AA 1OHYA 2R5CA 2R5CB 3ISLA 1QGNA 1LC5A 1I43A 2D64A 2HUFA 1D7UA 1EJIA 2HOZA 2VYCA 2Z9UA 3E2ZA 3IF2A 4UOYA 2W7HA 4DBCA 1ASLA 2AY8A 4AO4A 5F8VA 1DGDA 1XEYA 1EG5A 1M7YA 1B4XA 1D7SA 2DGMA 3CQ6A 1ARIA 2BYLA 1RV4A 1S06A 2C44A 2WK8A 3AELA 4XAUA 3E77A 3NDNA 4E77A 1ASDA 2VMPA 4FL0A 3GZDA 5DJ1A 4EU1A 5M46A 4XJPA 1WYUB 3A9YA 3EI8A 4JEVA 2CSTA 2HUUA 3MBBA 4WYAA 4OCAA 4IX8A 2G6WA 3II0A 4RJ0A 1CJ0A 5G09A 1JS6A 3ASBA 4UHOA 3WGCA 3LV2A 2YCNA 3AATA 2VI8A 2CY8A 4WYCA 1CZEA 1ZOBA 2EO5A 4E3QA 4WBTA 2QSRA 1M0NA 1UU1A 2JGTA 4W1XA 4UHNA 4WYFA 1I48A 4ZLVA 3FVUA 2O7CA 3FZ7A 1ARSA 1V2EA 2DKJA 4OYTA 2BI2A 1ECXA 4W91A 4WLJA 4MY5A 3EZ1A 4WXFA 4ADCA 3EIAA 4ZSYA 1B9HA 1S08A 1AY4A 3FQ7A 1IVRA 3VK3A 2HUIA 1D7VA 1YJYA 3AOWA 3JW9A 1M32A 1YOOA 1AMSA 1IBJA 2VGTA 3FSLA 1IX8A 4WXBA 1E5FA 4U2HA 2VIAA 4A0HA 2D66A 4UHMA 1B9IA 2D61A 2CJGA 4A72A 2AY5A 3FVXA 2D7ZA 2R0TA 2WK7A 3QPGA 4JE5A 3ZZJA 4KXKA 3WLXA 3B1EA 2DR1A 1GEXA 3T32A 1AHEA 2Z1YA 3RQ1A 2AY7A 4OTLA 1AMAA 1O62A 4U1TA 3RBLA 1SZUA 3QM2A 4EB7A 4ZM4A 1SF2A 2ZY4A 5M4BA 1B5OA 4H51A 3DRDA 3PA9A 1LC7A 1ELUA 1DKAA 3NTJA 4MGRA 3GETA 4BQ0A 1KL1A 2W7MA 5J8QA 4RAEA 3DYDA 4F5LA 3E2FA 3NYSA 3AEOA 4ADBA 1DTYA 4Y0IA 2ZYJA 1G7XA 4WXGA 4F5KA 3PDXA 1KKPA 3PD6A 3PD6B 9AATA 5E5IA 5G2QA 2VLHA 4MKJA 1CL2A 3LVMA 3QHXA 4F5HA 4W1WA 4GE7A 4QGRA 2ZJGA 2DOUA 4L0OA 4A0RA 3UWCA 2X3LA 1W7LA 3JZLA 3LY1A 1FC4A 3EI9A 3B1CA 1AJSB 1M0OA 3B8XA 3ACZA 3EUCA 3GR9A 5C6UA 2G7JA 2ZUKA 1ASMA 3FRKA 2VMQA 1I41A 1TARA 3OP7A 2V0YA 4JEWA 3WGBA 4BMKA 1PG8A 3DR7A 4Q31A 5G4JA 4F5GA 5M4DA 1MGVA 2YKYA 3DC1A 1CQ6A 1G4XA 3FFHA 4LC3A 4GDYA 3HDOA 1N2TA 4A0GA 1OXPA 4Y0DA 1AHGA 1QJ5A 2GSAA 4F4EA 1KMJA 2O1BA 3WZFA 1S07A 1DGEA 1Y4IA 2PO3A 1YJSA 2OKJA 4PIWA 2BWOA 4RITA 1B5PA 4UQVA 3ZRQA 4CXQA 2DGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYO A;  2VIB A;  3GZC A;  1JG8 A;  4IYO B;  1WYT A;  1WYT B;  2VMV A;  3HLM A;  4OT8 A;  4CVQ A;  2AEU A;  2ORD A;  3BB8 A;  2BIG A;  1G7W A;  3DU4 A;  3L44 A;  5BJ4 A;  3ASA A;  2GB3 A;  4ZM3 A;  1AKB A;  3LVL B;  3BWO A;  2VGU A;  4GRX A;  4B9B A;  2VMR A;  1LW5 A;  1QIS A;  3AOV A;  3EZS A;  3Q8N A;  1MDX A;  2W7J A;  3BWN A;  5FT8 A;  2Z9X A;  3WKS A;  1B8G A;  3PDB A;  1SZS A;  1GDE A;  4MQQ A;  4ZDL A;  2EZ1 A;  4F5I A;  1UKJ A;  3QBO A;  1DFO A;  1IX6 A;  2R5E A;  4XK1 A;  4P3M A;  4JF0 A;  4W8I A;  4XJM A;  1CQ8 A;  3AEJ C;  4ATQ A;  4EMY A;  5LH9 A;  1MAP A;  2EPJ A;  1ASG A;  1C9C A;  3JWB A;  5IWQ A;  4M2J A;  4EFF A;  4TN4 A;  3BV0 A;  5AX8 A;  3TAT A;  4TV7 A;  4JEY A;  2W7E A;  1PFF A;  1C7G A;  4XJO A;  3K40 A;  1V2F A;  2QBT A;  3WCN A;  2BKW A;  1BT4 A;  1WYU A;  2AY6 A;  4J8L A;  4E1O A;  1BJO B;  4LNJ A;  3KGX A;  4PFN A;  2AY4 A;  4OMA A;  1GC4 A;  1AMR A;  2AAT A;  3COG A;  3JWA A;  1ARH A;  3OKS A;  3PIU A;  3BN1 A;  4I8A A;  2W7L A;  2ZY3 A;  1O69 A;  4TMR A;  5FT6 A;  1WKH A;  3A9X A;  2E7J A;  1ZOD A;  4AOA A;  2HOX A;  4ZDO A;  1W3U A;  2VMU A;  3RI6 A;  4GEB A;  1H0C A;  3G8M A;  2BYJ A;  2PB2 A;  5G4I A;  1XI9 A;  1AJR A;  5EFS A;  3MC6 A;  1OHW A;  2C7T A;  1N31 A;  1VEF A;  2C81 A;  2VMT A;  3NYT A;  3PPL A;  4J5U A;  4JEZ A;  2JJE A;  3MAD A;  4OBV A;  5M49 A;  1CS1 A;  4IXO A;  4JE5 D;  3H7F A;  1AY8 A;  5TF5 A;  3VK4 A;  3UAK A;  2FYF A;  2W7D A;  3BWN C;  2QB3 A;  4IW7 A;  3WKR A;  5EQC A;  4BA5 A;  3AEM C;  1GC3 A;  1E5E A;  4A6T A;  1TPL A;  3DZZ A;  3E2Y A;  4NOG A;  4RLG A;  2W8J A;  5EUD A;  3DXW A;  1AMQ A;  2OAT A;  3KKI A;  3HL2 A;  3W1H A;  2R2N A;  1DJU A;  2NMP A;  2CJH A;  3BCA A;  4JF1 A;  4W1V A;  4Y0H A;  1CL1 A;  8AAT A;  3QN6 A;  1UU0 A;  2EH6 A;  2O0R A;  3LVK A;  5FT4 A;  1CQ7 A;  1P3W A;  4MKK A;  1KMK A;  1ASE A;  4XEW A;  2VLF A;  3GZD C;  3ZZK A;  4RJY A;  5EAV A;  2W8U A;  4GE4 A;  2Z61 A;  5I92 A;  3MAF B;  1IX7 A;  2VI9 A;  3LG0 A;  4RKD A;  3FDD A;  1AIA A;  3DXV A;  4P7Y A;  3AEP A;  4ATP A;  1OXO A;  3HQT A;  3KGW A;  1TOE A;  2CH2 A;  1AKA A;  2BIA A;  2AY9 A;  3FQ8 A;  4WLH A;  1T3I A;  3ZRP A;  1DJ9 A;  3TFU A;  3FTB A;  1W7M A;  3I5T A;  2VMX A;  2W8V A;  3CQ5 A;  2RFV A;  4AZK A;  3CBF A;  5D95 A;  1ASN A;  4LNL A;  4PVF A;  1AJS A;  2YKX A;  1IAX A;  3MC6 C;  2FNU A;  2QB2 A;  4OC9 A;  2AY1 A;  4M2M A;  1BQA A;  1JS3 A;  2D7Y A;  2E54 A;  2X5F A;  2Z67 A;  3A2B A;  3ATH A;  1C7O A;  3BC8 A;  4XJL A;  2X8U A;  5K8B A;  1O4S A;  3GSB A;  1MDZ A;  4ISY A;  2BWP A;  1D2F A;  3GJU A;  1AHY A;  1LW4 A;  4W5K A;  1ASF A;  4BA4 A;  1ART A;  3NU7 A;  3P1T A;  1MDO A;  4WYE A;  3F9T A;  1C4K A;  3ELP A;  5JAY A;  1PMM A;  4AO9 A;  1X2A A;  3NYU A;  5DX5 A;  3A8U X;  4R8D A;  3USF A;  1FG3 A;  2D65 A;  1S09 A;  1BJ4 A;  4RM1 A;  3AEN B;  4B98 A;  3E9K A;  3NUB A;  3HMU A;  5G0A A;  2HZP A;  1LKC A;  1VP4 A;  1YJZ A;  1JF9 A;  2VMW A;  3NU8 A;  3PAA A;  2VGW A;  2HOR A;  2XBN A;  4MQP A;  4WB0 B;  2ZY2 A;  1AAW A;  1RVY A;  1WYV B;  2CB1 A;  2FQ6 A;  2VMS A;  3H14 A;  4MSO A;  3VK2 A;  3RCH B;  1SFF A;  5LHA A;  2TPL A;  3FD0 A;  4ZDP A;  1RVU A;  2JG2 A;  2YKV A;  1N8P A;  1AY5 A;  2CJD A;  2E7I A;  2JIS A;  3F0H A;  4ADD A;  1C0N A;  1YIY A;  4WYG A;  4ZAH A;  2ZSL A;  1OHV A;  5EIG A;  5EIG B;  1GEY A;  4RKC A;  3KE3 A;  3VAX A;  2AEV A;  4IXS A;  4OBU A;  2W8W A;  4Q76 A;  2VMN A;  2FNI A;  3B46 A;  4ITX A;  3TFT A;  1YIZ A;  5FT5 A;  2BI5 A;  2DKB A;  4ADE A;  1TOK A;  3CAI A;  4O6Z A;  3UE8 A;  1J04 A;  1MLZ A;  2YOB A;  4A0F A;  3FKD A;  1TOJ A;  1M0P A;  2GMS A;  1TAS A;  3HVY A;  4KYO A;  1IAY A;  7AAT A;  1BW0 A;  2W8T A;  4LW4 A;  4R5F A;  1BKG A;  3VOM A;  1BJO A;  1PMO A;  4F5F A;  1M6S A;  4A6R A;  1M0Q A;  1BJN A;  1WKG A;  3MEB A;  1IJI A;  4R5Z A;  2EZ2 A;  2AY3 A;  1G4V A;  3LVJ A;  1TAT A;  1QIR A;  3E2Z B;  1GC0 A;  2EGY A;  2YCT A;  4AH3 A;  1DJE A;  1SZK A;  1D7R A;  2D5Y A;  1BJW A;  4DQ6 A;  2CH1 A;  3DOD A;  1W7N A;  2D63 A;  2Z9V A;  2YHK A;  3E6G A;  2BIE A;  1BQD A;  3BCB A;  3GWP A;  2VMY A;  1CZC A;  2WK9 A;  2ZSM A;  3K7Y A;  1AIC A;  2CTZ A;  2VGV A;  1H1C A;  1KL2 A;  2HP2 A;  3N5M A;  2VGS A;  2V1P A;  4GE9 A;  3FZ6 A;  3EI7 A;  4EB5 A;  1QIT A;  2BI9 A;  4R2N A;  4AZJ A;  3WY7 A;  4FFC A;  5E3K A;  1ORD A;  2Z1Z A;  2FM1 A;  2ZY5 A;  1U08 A;  2X5D A;  1KKJ A;  5DJ9 A;  5E4Z A;  4Q6R A;  1ARG A;  2BI3 A;  3DR4 A;  1IUG A;  2JJF A;  1X29 A;  3NNK A;  5EUE A;  4WP0 A;  5G2P A;  1AX4 A;  1AHX A;  3W1I A;  5EUN A;  1V72 A;  2Q7W A;  4CBR A;  2YRR A;  3TQX A;  2ZP7 A;  3BS8 A;  4HF8 A;  3WX9 A;  3IHJ A;  2AY2 A;  4ITG A;  3BCX A;  2E7U A;  2YCP A;  4IXZ A;  5HHY A;  1AHF A;  1AIB A;  3MAF A;  3RBF A;  4IY7 A;  1X0M A;  3ELE A;  1TOI A;  2GMU A;  4ZWM A;  3MKJ A;  5D5S A;  2YKU A;  4K2B A;  5F9S A;  1J32 A;  4N0B A;  3P6K A;  2CFB A;  1UU2 A;  3HBX A;  3QI6 A;  1MLY A;  4BHD A;  3FFR A;  1LS3 A;  3EI6 A;  3FVS A;  4LW2 A;  1ZC9 A;  1GBN A;  2VMZ A;  3NX3 A;  5HDM A;  4DGT A;  1AAM A;  3FCR A;  3FQA A;  4Q75 A;  1ELQ A;  2JJG A;  2QMA A;  1TOG A;  4MQR A;  3I16 A;  3MAU A;  3QGU A;  3EI5 A;  4K2I A;  1O61 A;  3G7Q A;  1QZ9 A;  4ZWV A;  2OGE A;  1Z3Z A;  3R9A A;  1GC2 A;  4WD2 A;  1AKC A;  4WYD A;  2W7I A;  3RUY A;  3N75 A;  1SPA A;  1RV3 A;  3D6K A;  4GSA A;  2Z20 A;  2CAN A;  3FDB A;  3PGY A;  1X28 A;  5EAA A;  3JU7 A;  3LWS A;  1S0A A;  3AEJ A;  3R4T A;  2PB0 A;  2VGZ A;  5DB5 A;  2DGK A;  3ECD A;  4CBS A;  1QJ3 A;  4LNM A;  2C0R A;  2ZC0 A;  4A00 A;  1GD9 A;  4CXR A;  3AEN A;  3B1D A;  4ZAS A;  2HOY A;  1WST A;  3EIB A;  3A9Z A;  1GCK A;  3NRA A;  2W7K A;  4K2M A;  3CQ4 A;  3M5U A;  1FG7 A;  1MAQ A;  4WB0 A;  1WYV A;  1C7N A;  2FN6 A;  4ZSW A;  3G0T A;  1BS0 A;  4HVK A;  3HT4 A;  2BHX A;  3RCH A;  3JTX A;  4KAM A;  3NUI A;  4RIZ A;  2Z9W A;  3N0L A;  1YNU A;  4M2K A;  1LC8 A;  1W23 A;  2GQN A;  3VP6 A;  2CIN A;  1LK9 A;  2F8J A;  2QA3 A;  4PFF A;  3F6T A;  2OQX A;  5HXX A;  2W7G A;  1ASB A;  1ASA A;  1OAT A;  1GEW A;  1VJO A;  3I4J A;  1SVV A;  3WCO A;  3W1J A;  2QLR A;  2HP1 A;  3GBX A;  4JEX A;  4E3R A;  2W7F A;  2XH1 A;  2VMO A;  1EQB A;  3ZRR A;  1ASC A;  3FZ8 A;  1YAA A;  2OKK A;  1Z7D A;  2OGA A;  2WKA A;  3K28 A;  4F5J A;  2JJH A;  2BWN A;  4F5M A;  2YRI A;  3AV7 A;  4N0W A;  4XQ2 A;  2BI1 A;  3PJ0 A;  3PDB B;  5BJ3 A;  4A6U A;  1I29 A;  1M4N A;  3TCM A;  3AEM A;  1V2D A;  3L8A A;  1OHY A;  2R5C A;  2R5C B;  3ISL A;  1QGN A;  1LC5 A;  1I43 A;  2D64 A;  2HUF A;  1D7U A;  1EJI A;  2HOZ A;  2VYC A;  2Z9U A;  3E2Z A;  3IF2 A;  4UOY A;  2W7H A;  4DBC A;  1ASL A;  2AY8 A;  4AO4 A;  5F8V A;  1DGD A;  1XEY A;  1EG5 A;  1M7Y A;  1B4X A;  1D7S A;  2DGM A;  3CQ6 A;  1ARI A;  2BYL A;  1RV4 A;  1S06 A;  2C44 A;  2WK8 A;  3AEL A;  4XAU A;  3E77 A;  3NDN A;  4E77 A;  1ASD A;  2VMP A;  4FL0 A;  3GZD A;  5DJ1 A;  4EU1 A;  5M46 A;  4XJP A;  1WYU B;  3A9Y A;  3EI8 A;  4JEV A;  2CST A;  2HUU A;  3MBB A;  4WYA A;  4OCA A;  4IX8 A;  2G6W A;  3II0 A;  4RJ0 A;  1CJ0 A;  5G09 A;  1JS6 A;  3ASB A;  4UHO A;  3WGC A;  3LV2 A;  2YCN A;  3AAT A;  2VI8 A;  2CY8 A;  4WYC A;  1CZE A;  1ZOB A;  2EO5 A;  4E3Q A;  4WBT A;  1M0N A;  1UU1 A;  2JGT A;  4W1X A;  4UHN A;  4WYF A;  1I48 A;  4ZLV A;  3FVU A;  2O7C A;  3FZ7 A;  1ARS A;  1V2E A;  2DKJ A;  4OYT A;  2BI2 A;  1ECX A;  4W91 A;  4WLJ A;  4MY5 A;  3EZ1 A;  4WXF A;  4ADC A;  3EIA A;  4ZSY A;  1B9H A;  1S08 A;  1AY4 A;  3FQ7 A;  1IVR A;  3VK3 A;  2HUI A;  1D7V A;  1YJY A;  3AOW A;  3JW9 A;  1M32 A;  1YOO A;  1AMS A;  1IBJ A;  2VGT A;  3FSL A;  1IX8 A;  4WXB A;  1E5F A;  4U2H A;  2VIA A;  4A0H A;  2D66 A;  4UHM A;  1B9I A;  2D61 A;  2CJG A;  4A72 A;  2AY5 A;  3FVX A;  2D7Z A;  2R0T A;  2WK7 A;  3QPG A;  4JE5 A;  3ZZJ A;  4KXK A;  3WLX A;  3B1E A;  2DR1 A;  1GEX A;  3T32 A;  1AHE A;  2Z1Y A;  3RQ1 A;  2AY7 A;  4OTL A;  1AMA A;  1O62 A;  4U1T A;  3RBL A;  1SZU A;  3QM2 A;  4EB7 A;  4ZM4 A;  1SF2 A;  2ZY4 A;  5M4B A;  1B5O A;  4H51 A;  3DRD A;  3PA9 A;  1LC7 A;  1ELU A;  1DKA A;  3NTJ A;  4MGR A;  3GET A;  4BQ0 A;  1KL1 A;  2W7M A;  5J8Q A;  4RAE A;  3DYD A;  4F5L A;  3E2F A;  3NYS A;  3AEO A;  4ADB A;  1DTY A;  4Y0I A;  2ZYJ A;  1G7X A;  4WXG A;  4F5K A;  3PDX A;  1KKP A;  3PD6 A;  3PD6 B;  9AAT A;  5E5I A;  5G2Q A;  2VLH A;  4MKJ A;  1CL2 A;  3LVM A;  3QHX A;  4F5H A;  4W1W A;  4GE7 A;  4QGR A;  2ZJG A;  2DOU A;  4L0O A;  4A0R A;  3UWC A;  2X3L A;  1W7L A;  3JZL A;  3LY1 A;  1FC4 A;  3EI9 A;  3B1C A;  1AJS B;  1M0O A;  3B8X A;  3ACZ A;  3EUC A;  3GR9 A;  5C6U A;  2ZUK A;  1ASM A;  3FRK A;  2VMQ A;  1I41 A;  1TAR A;  3OP7 A;  2V0Y A;  4JEW A;  3WGB A;  4BMK A;  1PG8 A;  3DR7 A;  4Q31 A;  5G4J A;  4F5G A;  5M4D A;  1MGV A;  2YKY A;  3DC1 A;  1CQ6 A;  1G4X A;  3FFH A;  4LC3 A;  4GDY A;  3HDO A;  1N2T A;  4A0G A;  1OXP A;  4Y0D A;  1AHG A;  1QJ5 A;  2GSA A;  4F4E A;  1KMJ A;  2O1B A;  3WZF A;  1S07 A;  1DGE A;  1Y4I A;  2PO3 A;  1YJS A;  2OKJ A;  4PIW A;  2BWO A;  4RIT A;  1B5P A;  4UQV A;  3ZRQ A;  4CXQ A;  2DGL A; 
#chains in the Genus database with same CATH topology
 4IYO A;  2VIB A;  3GZC A;  1JG8 A;  4IYO B;  1WYT A;  1WYT B;  2VMV A;  3HLM A;  4OT8 A;  4CVQ A;  2AEU A;  2ORD A;  3BB8 A;  2BIG A;  1G7W A;  3DU4 A;  3L44 A;  5BJ4 A;  3ASA A;  2GB3 A;  4ZM3 A;  1AKB A;  3LVL B;  3BWO A;  2VGU A;  4GRX A;  4B9B A;  2VMR A;  1LW5 A;  1QIS A;  3AOV A;  3EZS A;  3Q8N A;  2FKI A;  1MDX A;  2W7J A;  3BWN A;  5FT8 A;  2Z9X A;  3WKS A;  1B8G A;  3PDB A;  1SZS A;  1GDE A;  4MQQ A;  4ZDL A;  2EZ1 A;  4F5I A;  1UKJ A;  3QBO A;  1DFO A;  1IX6 A;  2R5E A;  4XK1 A;  4P3M A;  4JF0 A;  4W8I A;  4XJM A;  1CQ8 A;  3AEJ C;  4ATQ A;  4EMY A;  5LH9 A;  1MAP A;  2EPJ A;  1ASG A;  1C9C A;  3JWB A;  5IWQ A;  4M2J A;  4EFF A;  4TN4 A;  3BV0 A;  5AX8 A;  3TAT A;  4TV7 A;  4JEY A;  2W7E A;  1PFF A;  1C7G A;  4XJO A;  3K40 A;  1V2F A;  2QBT A;  3WCN A;  2BKW A;  1BT4 A;  1WYU A;  2AY6 A;  4J8L A;  4E1O A;  1BJO B;  4LNJ A;  3KGX A;  4PFN A;  2AY4 A;  4OMA A;  1GC4 A;  1AMR A;  2AAT A;  3COG A;  3JWA A;  1ARH A;  3OKS A;  3PIU A;  3BN1 A;  4I8A A;  2W7L A;  2ZY3 A;  1O69 A;  4TMR A;  3N7N A;  5FT6 A;  1WKH A;  3A9X A;  2E7J A;  1ZOD A;  4AOA A;  2HOX A;  4ZDO A;  1W3U A;  2VMU A;  3RI6 A;  4GEB A;  1H0C A;  3G8M A;  2BYJ A;  2PB2 A;  5G4I A;  1XI9 A;  1AJR A;  5EFS A;  3MC6 A;  1OHW A;  2C7T A;  1N31 A;  1VEF A;  2C81 A;  2VMT A;  3NYT A;  3PPL A;  4J5U A;  4JEZ A;  2JJE A;  3MAD A;  4OBV A;  5M49 A;  4H63 Q;  1CS1 A;  4IXO A;  4JE5 D;  3H7F A;  1AY8 A;  5TF5 A;  3VK4 A;  3UAK A;  2FYF A;  2W7D A;  4K05 A;  3BWN C;  2QB3 A;  4IW7 A;  3WKR A;  5EQC A;  4BA5 A;  3AEM C;  1GC3 A;  1E5E A;  4A6T A;  1TPL A;  3DZZ A;  3E2Y A;  4NOG A;  4RLG A;  2W8J A;  5EUD A;  3DXW A;  1AMQ A;  2OAT A;  3KKI A;  3HL2 A;  3W1H A;  2R2N A;  1DJU A;  2NMP A;  2CJH A;  3BCA A;  4JF1 A;  4W1V A;  4Y0H A;  1CL1 A;  8AAT A;  3QN6 A;  1UU0 A;  2EH6 A;  2O0R A;  3LVK A;  5FT4 A;  1CQ7 A;  1P3W A;  4MKK A;  1KMK A;  1ASE A;  4XEW A;  2VLF A;  3GZD C;  3ZZK A;  4RJY A;  5EAV A;  2W8U A;  4GE4 A;  2WB6 A;  2Z61 A;  5I92 A;  3MAF B;  1IX7 A;  2VI9 A;  3LG0 A;  4RKD A;  3FDD A;  1AIA A;  3DXV A;  4P7Y A;  2KFP A;  3AEP A;  4ATP A;  1OXO A;  3HQT A;  3KGW A;  1TOE A;  2CH2 A;  1AKA A;  2BIA A;  2AY9 A;  3FQ8 A;  4WLH A;  1T3I A;  3ZRP A;  1DJ9 A;  3TFU A;  3FTB A;  1W7M A;  3I5T A;  2VMX A;  2W8V A;  3CQ5 A;  3N4X A;  2RFV A;  4AZK A;  3CBF A;  5D95 A;  1ASN A;  4LNL A;  4PVF A;  1AJS A;  2YKX A;  1IAX A;  3MC6 C;  2FNU A;  2QB2 A;  4OC9 A;  2AY1 A;  4M2M A;  1BQA A;  1JS3 A;  2D7Y A;  2E54 A;  2X5F A;  2Z67 A;  3A2B A;  3ATH A;  1C7O A;  3BC8 A;  4XJL A;  2X8U A;  5K8B A;  1O4S A;  3GSB A;  1MDZ A;  4ISY A;  2BWP A;  1D2F A;  3GJU A;  2EYQ A;  1AHY A;  1LW4 A;  4W5K A;  1ASF A;  4BA4 A;  1ART A;  3NU7 A;  3P1T A;  1MDO A;  4WYE A;  3F9T A;  1C4K A;  3ELP A;  5JAY A;  1PMM A;  4AO9 A;  1X2A A;  3NYU A;  5DX5 A;  3A8U X;  4R8D A;  3USF A;  1FG3 A;  2D65 A;  1S09 A;  1BJ4 A;  4RM1 A;  3AEN B;  4B98 A;  3E9K A;  3NUB A;  3HMU A;  5G0A A;  2HZP A;  1LKC A;  1VP4 A;  1YJZ A;  1JF9 A;  2VMW A;  3NU8 A;  3PAA A;  2VGW A;  2HOR A;  2XBN A;  4MQP A;  4WB0 B;  2ZY2 A;  1AAW A;  1RVY A;  1WYV B;  2CB1 A;  2FQ6 A;  2VMS A;  3H14 A;  4MSO A;  3VK2 A;  3RCH B;  1SFF A;  5LHA A;  2TPL A;  3FD0 A;  4ZDP A;  1RVU A;  2JG2 A;  2YKV A;  1N8P A;  1AY5 A;  2CJD A;  2E7I A;  2JIS A;  3F0H A;  4ADD A;  1C0N A;  1YIY A;  4WYG A;  4ZAH A;  2ZSL A;  1OHV A;  5EIG A;  5EIG B;  1GEY A;  4RKC A;  3KE3 A;  3VAX A;  2AEV A;  4IXS A;  4OBU A;  2W8W A;  4Q76 A;  2VMN A;  2FNI A;  3B46 A;  4ITX A;  3TFT A;  1YIZ A;  5FT5 A;  2BI5 A;  2DKB A;  4ADE A;  1TOK A;  3CAI A;  4O6Z A;  3UE8 A;  1J04 A;  1MLZ A;  2YOB A;  4A0F A;  3FKD A;  1TOJ A;  1M0P A;  2GMS A;  1TAS A;  3HVY A;  4KYO A;  1IAY A;  7AAT A;  1BW0 A;  2W8T A;  4LW4 A;  4R5F A;  1BKG A;  3VOM A;  1BJO A;  1PMO A;  4F5F A;  1M6S A;  4A6R A;  1M0Q A;  1BJN A;  1WKG A;  3MEB A;  1IJI A;  4R5Z A;  2EZ2 A;  2AY3 A;  1G4V A;  3LVJ A;  1TAT A;  1QIR A;  3E2Z B;  1GC0 A;  2EGY A;  2YCT A;  4AH3 A;  1DJE A;  1SZK A;  1D7R A;  2D5Y A;  1BJW A;  4DQ6 A;  2CH1 A;  3DOD A;  1W7N A;  3H9X A;  2D63 A;  2Z9V A;  2YHK A;  3E6G A;  2BIE A;  1BQD A;  3BCB A;  3GWP A;  2VMY A;  1CZC A;  2WK9 A;  2ZSM A;  3K7Y A;  1AIC A;  2CTZ A;  2VGV A;  1H1C A;  1KL2 A;  2HP2 A;  3N5M A;  2VGS A;  2V1P A;  4GE9 A;  3FZ6 A;  5KTB A;  3EI7 A;  4EB5 A;  1QIT A;  2BI9 A;  4R2N A;  4AZJ A;  3WY7 A;  4FFC A;  5E3K A;  1ORD A;  2Z1Z A;  2FM1 A;  2ZY5 A;  1U08 A;  2X5D A;  1KKJ A;  5DJ9 A;  5E4Z A;  4Q6R A;  1ARG A;  2BI3 A;  3DR4 A;  1IUG A;  2JJF A;  1X29 A;  3NNK A;  5EUE A;  4WP0 A;  5G2P A;  1AX4 A;  1AHX A;  3W1I A;  5EUN A;  1V72 A;  2Q7W A;  4CBR A;  2YRR A;  3TQX A;  2ZP7 A;  3BS8 A;  4HF8 A;  3WX9 A;  3IHJ A;  2AY2 A;  4ITG A;  3BCX A;  2E7U A;  2YCP A;  4IXZ A;  5HHY A;  1AHF A;  1AIB A;  3MAF A;  3RBF A;  4IY7 A;  1X0M A;  3ELE A;  1TOI A;  2GMU A;  4ZWM A;  3MKJ A;  5D5S A;  2YKU A;  4K2B A;  5F9S A;  1J32 A;  4N0B A;  3P6K A;  2CFB A;  1UU2 A;  3HBX A;  3QI6 A;  1MLY A;  4BHD A;  3FFR A;  1LS3 A;  3EI6 A;  3FVS A;  4LW2 A;  1ZC9 A;  1GBN A;  2VMZ A;  3NX3 A;  5HDM A;  4DGT A;  1AAM A;  3FCR A;  3FQA A;  4Q75 A;  1ELQ A;  2JJG A;  2QMA A;  1TOG A;  4MQR A;  3I16 A;  3MAU A;  3QGU A;  3EI5 A;  4K2I A;  1O61 A;  3G7Q A;  1QZ9 A;  2A1V A;  4ZWV A;  2OGE A;  1Z3Z A;  3R9A A;  1GC2 A;  4WD2 A;  1AKC A;  4WYD A;  2W7I A;  3RUY A;  3N75 A;  1SPA A;  1RV3 A;  3D6K A;  4GSA A;  2Z20 A;  2CAN A;  3FDB A;  3PGY A;  1X28 A;  5EAA A;  3JU7 A;  3LWS A;  1S0A A;  3AEJ A;  3R4T A;  2PB0 A;  2VGZ A;  5DB5 A;  2DGK A;  3ECD A;  4CBS A;  1QJ3 A;  4LNM A;  2C0R A;  2ZC0 A;  4A00 A;  1GD9 A;  4CXR A;  3AEN A;  3B1D A;  4ZAS A;  2HOY A;  1WST A;  3EIB A;  3A9Z A;  1GCK A;  3NRA A;  2W7K A;  4K2M A;  3CQ4 A;  3M5U A;  1FG7 A;  1MAQ A;  4WB0 A;  1WYV A;  1C7N A;  2FN6 A;  4ZSW A;  3G0T A;  1BS0 A;  4HVK A;  3HT4 A;  2BHX A;  3RCH A;  3JTX A;  4KAM A;  3NUI A;  4RIZ A;  2Z9W A;  3N0L A;  1YNU A;  4M2K A;  1LC8 A;  1W23 A;  2GQN A;  3N4R A;  3VP6 A;  2CIN A;  1LK9 A;  2F8J A;  2QA3 A;  4PFF A;  3F6T A;  2OQX A;  5HXX A;  2W7G A;  1ASB A;  1ASA A;  1OAT A;  1GEW A;  1VJO A;  3I4J A;  1SVV A;  3WCO A;  3W1J A;  2QLR A;  2HP1 A;  3GBX A;  4JEX A;  4E3R A;  2W7F A;  2XH1 A;  2VMO A;  1EQB A;  3ZRR A;  3N4S A;  1ASC A;  3FZ8 A;  1KAF A;  1YAA A;  2OKK A;  1Z7D A;  2OGA A;  2WKA A;  3K28 A;  4F5J A;  2JJH A;  2BWN A;  4F5M A;  2YRI A;  3AV7 A;  4N0W A;  4XQ2 A;  2BI1 A;  3PJ0 A;  3PDB B;  5BJ3 A;  4A6U A;  1I29 A;  1M4N A;  3TCM A;  3AEM A;  1V2D A;  3L8A A;  1OHY A;  2R5C A;  2R5C B;  3ISL A;  1QGN A;  1LC5 A;  1I43 A;  2D64 A;  2HUF A;  1D7U A;  1EJI A;  2HOZ A;  2VYC A;  2Z9U A;  3E2Z A;  3IF2 A;  4UOY A;  2W7H A;  4DBC A;  1ASL A;  2AY8 A;  4AO4 A;  5F8V A;  1DGD A;  1XEY A;  1EG5 A;  1M7Y A;  1B4X A;  1D7S A;  2DGM A;  3CQ6 A;  1ARI A;  2BYL A;  1RV4 A;  1S06 A;  2C44 A;  2WK8 A;  3AEL A;  4XAU A;  3E77 A;  3NDN A;  4E77 A;  1ASD A;  2VMP A;  4FL0 A;  3GZD A;  5DJ1 A;  4EU1 A;  5M46 A;  4XJP A;  1WYU B;  3A9Y A;  3EI8 A;  4JEV A;  2CST A;  2HUU A;  3MBB A;  4WYA A;  4OCA A;  4IX8 A;  2G6W A;  3II0 A;  4RJ0 A;  1CJ0 A;  5G09 A;  1JS6 A;  3ASB A;  4UHO A;  3WGC A;  3LV2 A;  2YCN A;  3AAT A;  2VI8 A;  2CY8 A;  4WYC A;  1CZE A;  1ZOB A;  2EO5 A;  4E3Q A;  4WBT A;  2QSR A;  1M0N A;  1UU1 A;  2JGT A;  4W1X A;  4UHN A;  4WYF A;  1I48 A;  4ZLV A;  3FVU A;  2O7C A;  3FZ7 A;  1ARS A;  1V2E A;  2DKJ A;  4OYT A;  2BI2 A;  1ECX A;  4W91 A;  4WLJ A;  4MY5 A;  3EZ1 A;  4WXF A;  4ADC A;  3EIA A;  4ZSY A;  1B9H A;  1S08 A;  1AY4 A;  3FQ7 A;  1IVR A;  3VK3 A;  2HUI A;  1D7V A;  1YJY A;  3AOW A;  3JW9 A;  1M32 A;  1YOO A;  1AMS A;  1IBJ A;  2VGT A;  3FSL A;  1IX8 A;  4WXB A;  1E5F A;  4U2H A;  2VIA A;  4A0H A;  2D66 A;  4UHM A;  1B9I A;  2D61 A;  2CJG A;  4A72 A;  2AY5 A;  3FVX A;  2D7Z A;  2R0T A;  2WK7 A;  3QPG A;  4JE5 A;  3ZZJ A;  4KXK A;  3WLX A;  3B1E A;  2DR1 A;  1GEX A;  3T32 A;  1AHE A;  2Z1Y A;  3RQ1 A;  2AY7 A;  4OTL A;  1AMA A;  1O62 A;  4U1T A;  3RBL A;  1SZU A;  3QM2 A;  4EB7 A;  4ZM4 A;  1SF2 A;  2ZY4 A;  5M4B A;  1B5O A;  4H51 A;  3DRD A;  3PA9 A;  1LC7 A;  1ELU A;  1DKA A;  3NTJ A;  4MGR A;  3GET A;  4BQ0 A;  1KL1 A;  2W7M A;  5J8Q A;  4RAE A;  3DYD A;  4F5L A;  3E2F A;  3NYS A;  3AEO A;  4ADB A;  1DTY A;  4Y0I A;  2ZYJ A;  1G7X A;  4WXG A;  4F5K A;  3PDX A;  1KKP A;  3PD6 A;  3PD6 B;  9AAT A;  5E5I A;  5G2Q A;  2VLH A;  4MKJ A;  1CL2 A;  3LVM A;  3QHX A;  4F5H A;  4W1W A;  4GE7 A;  4QGR A;  2ZJG A;  2DOU A;  4L0O A;  4A0R A;  3UWC A;  2X3L A;  1W7L A;  3JZL A;  3LY1 A;  1FC4 A;  3EI9 A;  3B1C A;  1AJS B;  1M0O A;  3B8X A;  3ACZ A;  3EUC A;  3GR9 A;  5C6U A;  2G7J A;  2ZUK A;  1ASM A;  3FRK A;  2VMQ A;  1I41 A;  1TAR A;  3OP7 A;  2V0Y A;  4JEW A;  3WGB A;  4BMK A;  1PG8 A;  3DR7 A;  4Q31 A;  5G4J A;  4F5G A;  5M4D A;  1MGV A;  2YKY A;  3DC1 A;  1CQ6 A;  1G4X A;  3FFH A;  4LC3 A;  4GDY A;  3HDO A;  1N2T A;  4A0G A;  1OXP A;  4Y0D A;  1AHG A;  1QJ5 A;  2GSA A;  4F4E A;  1KMJ A;  2O1B A;  3WZF A;  1S07 A;  1DGE A;  1Y4I A;  2PO3 A;  1YJS A;  2OKJ A;  4PIW A;  2BWO A;  4RIT A;  1B5P A;  4UQV A;  3ZRQ A;  4CXQ A;  2DGL A; 
#chains in the Genus database with same CATH homology
 4IYO A;  2VIB A;  3GZC A;  1JG8 A;  4IYO B;  1WYT A;  1WYT B;  2VMV A;  3HLM A;  4OT8 A;  4CVQ A;  2AEU A;  2ORD A;  3BB8 A;  2BIG A;  1G7W A;  3DU4 A;  3L44 A;  5BJ4 A;  3ASA A;  2GB3 A;  4ZM3 A;  1AKB A;  3LVL B;  3BWO A;  2VGU A;  4GRX A;  4B9B A;  2VMR A;  1LW5 A;  1QIS A;  3AOV A;  3EZS A;  3Q8N A;  2FKI A;  1MDX A;  2W7J A;  3BWN A;  5FT8 A;  2Z9X A;  3WKS A;  1B8G A;  3PDB A;  1SZS A;  1GDE A;  4MQQ A;  4ZDL A;  2EZ1 A;  4F5I A;  1UKJ A;  3QBO A;  1DFO A;  1IX6 A;  2R5E A;  4XK1 A;  4P3M A;  4JF0 A;  4W8I A;  4XJM A;  1CQ8 A;  3AEJ C;  4ATQ A;  4EMY A;  5LH9 A;  1MAP A;  2EPJ A;  1ASG A;  1C9C A;  3JWB A;  5IWQ A;  4M2J A;  4EFF A;  4TN4 A;  3BV0 A;  5AX8 A;  3TAT A;  4TV7 A;  4JEY A;  2W7E A;  1PFF A;  1C7G A;  4XJO A;  3K40 A;  1V2F A;  2QBT A;  3WCN A;  2BKW A;  1BT4 A;  1WYU A;  2AY6 A;  4J8L A;  4E1O A;  1BJO B;  4LNJ A;  3KGX A;  4PFN A;  2AY4 A;  4OMA A;  1GC4 A;  1AMR A;  2AAT A;  3COG A;  3JWA A;  1ARH A;  3OKS A;  3PIU A;  3BN1 A;  4I8A A;  2W7L A;  2ZY3 A;  1O69 A;  4TMR A;  3N7N A;  5FT6 A;  1WKH A;  3A9X A;  2E7J A;  1ZOD A;  4AOA A;  2HOX A;  4ZDO A;  1W3U A;  2VMU A;  3RI6 A;  4GEB A;  1H0C A;  3G8M A;  2BYJ A;  2PB2 A;  5G4I A;  1XI9 A;  1AJR A;  5EFS A;  3MC6 A;  1OHW A;  2C7T A;  1N31 A;  1VEF A;  2C81 A;  2VMT A;  3NYT A;  3PPL A;  4J5U A;  4JEZ A;  2JJE A;  3MAD A;  4OBV A;  5M49 A;  4H63 Q;  1CS1 A;  4IXO A;  4JE5 D;  3H7F A;  1AY8 A;  5TF5 A;  3VK4 A;  3UAK A;  2FYF A;  2W7D A;  4K05 A;  3BWN C;  2QB3 A;  4IW7 A;  3WKR A;  5EQC A;  4BA5 A;  3AEM C;  1GC3 A;  1E5E A;  4A6T A;  1TPL A;  3DZZ A;  3E2Y A;  4NOG A;  4RLG A;  2W8J A;  5EUD A;  3DXW A;  1AMQ A;  2OAT A;  3KKI A;  3HL2 A;  3W1H A;  2R2N A;  1DJU A;  2NMP A;  2CJH A;  3BCA A;  4JF1 A;  4W1V A;  4Y0H A;  1CL1 A;  8AAT A;  3QN6 A;  1UU0 A;  2EH6 A;  2O0R A;  3LVK A;  5FT4 A;  1CQ7 A;  1P3W A;  4MKK A;  1KMK A;  1ASE A;  4XEW A;  2VLF A;  3GZD C;  3ZZK A;  4RJY A;  5EAV A;  2W8U A;  4GE4 A;  2WB6 A;  2Z61 A;  5I92 A;  3MAF B;  1IX7 A;  2VI9 A;  3LG0 A;  4RKD A;  3FDD A;  1AIA A;  3DXV A;  4P7Y A;  2KFP A;  3AEP A;  4ATP A;  1OXO A;  3HQT A;  3KGW A;  1TOE A;  2CH2 A;  1AKA A;  2BIA A;  2AY9 A;  3FQ8 A;  4WLH A;  1T3I A;  3ZRP A;  1DJ9 A;  3TFU A;  3FTB A;  1W7M A;  3I5T A;  2VMX A;  2W8V A;  3CQ5 A;  3N4X A;  2RFV A;  4AZK A;  3CBF A;  5D95 A;  1ASN A;  4LNL A;  4PVF A;  1AJS A;  2YKX A;  1IAX A;  3MC6 C;  2FNU A;  2QB2 A;  4OC9 A;  2AY1 A;  4M2M A;  1BQA A;  1JS3 A;  2D7Y A;  2E54 A;  2X5F A;  2Z67 A;  3A2B A;  3ATH A;  1C7O A;  3BC8 A;  4XJL A;  2X8U A;  5K8B A;  1O4S A;  3GSB A;  1MDZ A;  4ISY A;  2BWP A;  1D2F A;  3GJU A;  2EYQ A;  1AHY A;  1LW4 A;  4W5K A;  1ASF A;  4BA4 A;  1ART A;  3NU7 A;  3P1T A;  1MDO A;  4WYE A;  3F9T A;  1C4K A;  3ELP A;  5JAY A;  1PMM A;  4AO9 A;  1X2A A;  3NYU A;  5DX5 A;  3A8U X;  4R8D A;  3USF A;  1FG3 A;  2D65 A;  1S09 A;  1BJ4 A;  4RM1 A;  3AEN B;  4B98 A;  3E9K A;  3NUB A;  3HMU A;  5G0A A;  2HZP A;  1LKC A;  1VP4 A;  1YJZ A;  1JF9 A;  2VMW A;  3NU8 A;  3PAA A;  2VGW A;  2HOR A;  2XBN A;  4MQP A;  4WB0 B;  2ZY2 A;  1AAW A;  1RVY A;  1WYV B;  2CB1 A;  2FQ6 A;  2VMS A;  3H14 A;  4MSO A;  3VK2 A;  3RCH B;  1SFF A;  5LHA A;  2TPL A;  3FD0 A;  4ZDP A;  1RVU A;  2JG2 A;  2YKV A;  1N8P A;  1AY5 A;  2CJD A;  2E7I A;  2JIS A;  3F0H A;  4ADD A;  1C0N A;  1YIY A;  4WYG A;  4ZAH A;  2ZSL A;  1OHV A;  5EIG A;  5EIG B;  1GEY A;  4RKC A;  3KE3 A;  3VAX A;  2AEV A;  4IXS A;  4OBU A;  2W8W A;  4Q76 A;  2VMN A;  2FNI A;  3B46 A;  4ITX A;  3TFT A;  1YIZ A;  5FT5 A;  2BI5 A;  2DKB A;  4ADE A;  1TOK A;  3CAI A;  4O6Z A;  3UE8 A;  1J04 A;  1MLZ A;  2YOB A;  4A0F A;  3FKD A;  1TOJ A;  1M0P A;  2GMS A;  1TAS A;  3HVY A;  4KYO A;  1IAY A;  7AAT A;  1BW0 A;  2W8T A;  4LW4 A;  4R5F A;  1BKG A;  3VOM A;  1BJO A;  1PMO A;  4F5F A;  1M6S A;  4A6R A;  1M0Q A;  1BJN A;  1WKG A;  3MEB A;  1IJI A;  4R5Z A;  2EZ2 A;  2AY3 A;  1G4V A;  3LVJ A;  1TAT A;  1QIR A;  3E2Z B;  1GC0 A;  2EGY A;  2YCT A;  4AH3 A;  1DJE A;  1SZK A;  1D7R A;  2D5Y A;  1BJW A;  4DQ6 A;  2CH1 A;  3DOD A;  1W7N A;  3H9X A;  2D63 A;  2Z9V A;  2YHK A;  3E6G A;  2BIE A;  1BQD A;  3BCB A;  3GWP A;  2VMY A;  1CZC A;  2WK9 A;  2ZSM A;  3K7Y A;  1AIC A;  2CTZ A;  2VGV A;  1H1C A;  1KL2 A;  2HP2 A;  3N5M A;  2VGS A;  2V1P A;  4GE9 A;  3FZ6 A;  5KTB A;  3EI7 A;  4EB5 A;  1QIT A;  2BI9 A;  4R2N A;  4AZJ A;  3WY7 A;  4FFC A;  5E3K A;  1ORD A;  2Z1Z A;  2FM1 A;  2ZY5 A;  1U08 A;  2X5D A;  1KKJ A;  5DJ9 A;  5E4Z A;  4Q6R A;  1ARG A;  2BI3 A;  3DR4 A;  1IUG A;  2JJF A;  1X29 A;  3NNK A;  5EUE A;  4WP0 A;  5G2P A;  1AX4 A;  1AHX A;  3W1I A;  5EUN A;  1V72 A;  2Q7W A;  4CBR A;  2YRR A;  3TQX A;  2ZP7 A;  3BS8 A;  4HF8 A;  3WX9 A;  3IHJ A;  2AY2 A;  4ITG A;  3BCX A;  2E7U A;  2YCP A;  4IXZ A;  5HHY A;  1AHF A;  1AIB A;  3MAF A;  3RBF A;  4IY7 A;  1X0M A;  3ELE A;  1TOI A;  2GMU A;  4ZWM A;  3MKJ A;  5D5S A;  2YKU A;  4K2B A;  5F9S A;  1J32 A;  4N0B A;  3P6K A;  2CFB A;  1UU2 A;  3HBX A;  3QI6 A;  1MLY A;  4BHD A;  3FFR A;  1LS3 A;  3EI6 A;  3FVS A;  4LW2 A;  1ZC9 A;  1GBN A;  2VMZ A;  3NX3 A;  5HDM A;  4DGT A;  1AAM A;  3FCR A;  3FQA A;  4Q75 A;  1ELQ A;  2JJG A;  2QMA A;  1TOG A;  4MQR A;  3I16 A;  3MAU A;  3QGU A;  3EI5 A;  4K2I A;  1O61 A;  3G7Q A;  1QZ9 A;  2A1V A;  4ZWV A;  2OGE A;  1Z3Z A;  3R9A A;  1GC2 A;  4WD2 A;  1AKC A;  4WYD A;  2W7I A;  3RUY A;  3N75 A;  1SPA A;  1RV3 A;  3D6K A;  4GSA A;  2Z20 A;  2CAN A;  3FDB A;  3PGY A;  1X28 A;  5EAA A;  3JU7 A;  3LWS A;  1S0A A;  3AEJ A;  3R4T A;  2PB0 A;  2VGZ A;  5DB5 A;  2DGK A;  3ECD A;  4CBS A;  1QJ3 A;  4LNM A;  2C0R A;  2ZC0 A;  4A00 A;  1GD9 A;  4CXR A;  3AEN A;  3B1D A;  4ZAS A;  2HOY A;  1WST A;  3EIB A;  3A9Z A;  1GCK A;  3NRA A;  2W7K A;  4K2M A;  3CQ4 A;  3M5U A;  1FG7 A;  1MAQ A;  4WB0 A;  1WYV A;  1C7N A;  2FN6 A;  4ZSW A;  3G0T A;  1BS0 A;  4HVK A;  3HT4 A;  2BHX A;  3RCH A;  3JTX A;  4KAM A;  3NUI A;  4RIZ A;  2Z9W A;  3N0L A;  1YNU A;  4M2K A;  1LC8 A;  1W23 A;  2GQN A;  3N4R A;  3VP6 A;  2CIN A;  1LK9 A;  2F8J A;  2QA3 A;  4PFF A;  3F6T A;  2OQX A;  5HXX A;  2W7G A;  1ASB A;  1ASA A;  1OAT A;  1GEW A;  1VJO A;  3I4J A;  1SVV A;  3WCO A;  3W1J A;  2QLR A;  2HP1 A;  3GBX A;  4JEX A;  4E3R A;  2W7F A;  2XH1 A;  2VMO A;  1EQB A;  3ZRR A;  3N4S A;  1ASC A;  3FZ8 A;  1YAA A;  2OKK A;  1Z7D A;  2OGA A;  2WKA A;  3K28 A;  4F5J A;  2JJH A;  2BWN A;  4F5M A;  2YRI A;  3AV7 A;  4N0W A;  4XQ2 A;  2BI1 A;  3PJ0 A;  3PDB B;  5BJ3 A;  4A6U A;  1I29 A;  1M4N A;  3TCM A;  3AEM A;  1V2D A;  3L8A A;  1OHY A;  2R5C A;  2R5C B;  3ISL A;  1QGN A;  1LC5 A;  1I43 A;  2D64 A;  2HUF A;  1D7U A;  1EJI A;  2HOZ A;  2VYC A;  2Z9U A;  3E2Z A;  3IF2 A;  4UOY A;  2W7H A;  4DBC A;  1ASL A;  2AY8 A;  4AO4 A;  5F8V A;  1DGD A;  1XEY A;  1EG5 A;  1M7Y A;  1B4X A;  1D7S A;  2DGM A;  3CQ6 A;  1ARI A;  2BYL A;  1RV4 A;  1S06 A;  2C44 A;  2WK8 A;  3AEL A;  4XAU A;  3E77 A;  3NDN A;  4E77 A;  1ASD A;  2VMP A;  4FL0 A;  3GZD A;  5DJ1 A;  4EU1 A;  5M46 A;  4XJP A;  1WYU B;  3A9Y A;  3EI8 A;  4JEV A;  2CST A;  2HUU A;  3MBB A;  4WYA A;  4OCA A;  4IX8 A;  2G6W A;  3II0 A;  4RJ0 A;  1CJ0 A;  5G09 A;  1JS6 A;  3ASB A;  4UHO A;  3WGC A;  3LV2 A;  2YCN A;  3AAT A;  2VI8 A;  2CY8 A;  4WYC A;  1CZE A;  1ZOB A;  2EO5 A;  4E3Q A;  4WBT A;  2QSR A;  1M0N A;  1UU1 A;  2JGT A;  4W1X A;  4UHN A;  4WYF A;  1I48 A;  4ZLV A;  3FVU A;  2O7C A;  3FZ7 A;  1ARS A;  1V2E A;  2DKJ A;  4OYT A;  2BI2 A;  1ECX A;  4W91 A;  4WLJ A;  4MY5 A;  3EZ1 A;  4WXF A;  4ADC A;  3EIA A;  4ZSY A;  1B9H A;  1S08 A;  1AY4 A;  3FQ7 A;  1IVR A;  3VK3 A;  2HUI A;  1D7V A;  1YJY A;  3AOW A;  3JW9 A;  1M32 A;  1YOO A;  1AMS A;  1IBJ A;  2VGT A;  3FSL A;  1IX8 A;  4WXB A;  1E5F A;  4U2H A;  2VIA A;  4A0H A;  2D66 A;  4UHM A;  1B9I A;  2D61 A;  2CJG A;  4A72 A;  2AY5 A;  3FVX A;  2D7Z A;  2R0T A;  2WK7 A;  3QPG A;  4JE5 A;  3ZZJ A;  4KXK A;  3WLX A;  3B1E A;  2DR1 A;  1GEX A;  3T32 A;  1AHE A;  2Z1Y A;  3RQ1 A;  2AY7 A;  4OTL A;  1AMA A;  1O62 A;  4U1T A;  3RBL A;  1SZU A;  3QM2 A;  4EB7 A;  4ZM4 A;  1SF2 A;  2ZY4 A;  5M4B A;  1B5O A;  4H51 A;  3DRD A;  3PA9 A;  1LC7 A;  1ELU A;  1DKA A;  3NTJ A;  4MGR A;  3GET A;  4BQ0 A;  1KL1 A;  2W7M A;  5J8Q A;  4RAE A;  3DYD A;  4F5L A;  3E2F A;  3NYS A;  3AEO A;  4ADB A;  1DTY A;  4Y0I A;  2ZYJ A;  1G7X A;  4WXG A;  4F5K A;  3PDX A;  1KKP A;  3PD6 A;  3PD6 B;  9AAT A;  5E5I A;  5G2Q A;  2VLH A;  4MKJ A;  1CL2 A;  3LVM A;  3QHX A;  4F5H A;  4W1W A;  4GE7 A;  4QGR A;  2ZJG A;  2DOU A;  4L0O A;  4A0R A;  3UWC A;  2X3L A;  1W7L A;  3JZL A;  3LY1 A;  1FC4 A;  3EI9 A;  3B1C A;  1AJS B;  1M0O A;  3B8X A;  3ACZ A;  3EUC A;  3GR9 A;  5C6U A;  2G7J A;  2ZUK A;  1ASM A;  3FRK A;  2VMQ A;  1I41 A;  1TAR A;  3OP7 A;  2V0Y A;  4JEW A;  3WGB A;  4BMK A;  1PG8 A;  3DR7 A;  4Q31 A;  5G4J A;  4F5G A;  5M4D A;  1MGV A;  2YKY A;  3DC1 A;  1CQ6 A;  1G4X A;  3FFH A;  4LC3 A;  4GDY A;  3HDO A;  1N2T A;  4A0G A;  1OXP A;  4Y0D A;  1AHG A;  1QJ5 A;  2GSA A;  4F4E A;  1KMJ A;  2O1B A;  3WZF A;  1S07 A;  1DGE A;  1Y4I A;  2PO3 A;  1YJS A;  2OKJ A;  4PIW A;  2BWO A;  4RIT A;  1B5P A;  4UQV A;  3ZRQ A;  4CXQ A;  2DGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...