2CSTA

Crystal structure of the closed form of chicken cytosolic aspartate aminotransferase at 1.9 angstroms resolution
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
411
structure length
411
Chain Sequence
AASIFAAVPRAPPVAVFKLTADFREDGDSRKVNLGVGAYRTDEGQPWVLPVVRKVEQLIAGDGSLNHEYLPILGLPEFRANASRIALGDDSPAIAQKRVGSVQGLGGTGALRIGAEFLRRWYNGNNNTATPVYVSSPTWENHNSVFMDAGFKDIRTYRYWDAAKRGLDLQGLLDDMEKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQGFASGSLDKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLNPKQVEYMIKEKHIYLMASGRINMCGLTTKNLDYVAKSIHEAVTKIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the closed form of chicken cytosolic aspartate aminotransferase at 1.9 A resolution.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase(aminotransferase)
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 155
structure length 411
sequence length 411
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1994-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2cstA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2cstA01
3B1CA 2YCTA 4ATQA 2Z9XA 1TOJA 3MAFA 5JAYA 3NNKA 1XI9A 3FFHA 4WYAA 3GZDC 5E5IA 1BQAA 3B8XA 1AJSB 4IXZA 3EZ1A 3GWPA 1N31A 5G4IA 1AJSA 1DJ9A 2ZY3A 3BWNA 4OYTA 2PB2A 3KGWA 1PMOA 2VLFA 1C7NA 2R5EA 4OT8A 4IXSA 1MDXA 1OXOA 2HUIA 3BWNC 5HHYA 5I92A 4WP0A 4ZDPA 2O7CA 2Z9WA 2OGAA 1AHXA 2BIAA 3DODA 2F8JA 3FZ7A 1IX6A 2Z20A 4R8DA 4XJPA 3VK2A 4Q75A 3NYSA 1X29A 2FYFA 4J5UA 1ARGA 4RJ0A 1KKJA 1ASGA 4ZSWA 4QGRA 2CINA 3AEMA 3AEJA 4ZDLA 1IX8A 4RLGA 1ZC9A 1ASBA 4A00A 3JTXA 3FSLA 1MAPA 2EPJA 3AEJC 2DGLA 3B46A 3WKRA 1UU1A 4R2NA 1VP4A 1IAXA 4KYOA 1J32A 1PMMA 1B5PA 1GEYA 4GEBA 3E9KA 4TV7A 3COGA 1CJ0A 3L8AA 5EUEA 1CZCA 1GC2A 2VMNA 3PDBA 2WKAA 2JJGA 3BCXA 1VJOA 1TOIA 2D64A 4WYDA 1TASA 4E77A 2VI8A 2D7YA 3FZ6A 1M6SA 1LC8A 1KMJA 1TOGA 4IW7A 1QISA 2VMSA 3DZZA 3CQ4A 4U2HA 1UKJA 2OQXA 1H0CA 2C7TA 3EI7A 1CZEA 2YKXA 3E6GA 2VLHA 1M32A 4RM1A 3ZZKA 3VK3A 2JJHA 2ZSMA 1DJEA 1S09A 3FVUA 5F9SA 1TOEA 2CH2A 1CL1A 1IJIA 4ZSYA 1AJRA 3RUYA 2VMUA 4PIWA 2E54A 1W23A 2W7EA 1BKGA 3M5UA 4W91A 2BWNA 1BJNA 1DGEA 2DKBA 4MQRA 1I43A 1C4KA 2X8UA 1FG3A 3F0HA 1BS0A 2YRRA 2HOXA 1ECXA 2W8JA 3EIBA 1ASEA 5G09A 4F5LA 3NYTA 1S06A 4DGTA 2AY4A 4A6TA 2QB2A 2HORA 1LK9A 2WK9A 2GB3A 3PD6B 4W1XA 1M7YA 2X3LA 5EUNA 5HXXA 5D5SA 2QA3A 3CQ6A 5FT4A 3IHJA 3BCAA 3ELEA 1SF2A 4WBTA 4ATPA 3USFA 4E3QA 1ORDA 3JWBA 1TOKA 2Z1ZA 4H51A 4A0GA 4WYCA 2VGTA 3A8UX 3P1TA 4OTLA 1UU0A 3MADA 5M46A 1IX7A 3ISLA 2VMVA 1ZOBA 3G0TA 2ZY4A 1YOOA 2VMZA 4WB0B 4EB7A 3LVLB 4ZAHA 1G7WA 3VOMA 4UHOA 3HL2A 2DGMA 1YIZA 4U1TA 1B9HA 1M0QA 1SPAA 1O62A 2VIAA 1FC4A 1QITA 1SZSA 2E7JA 1SVVA 1ASAA 2FNUA 2O1BA 3UE8A 1B4XA 2ZY2A 4RKCA 2DR1A 4DBCA 4LC3A 2NMPA 3HQTA 4OMAA 2HP1A 3MC6C 2GMSA 3QM2A 1YAAA 1TARA 1YNUA 1ELQA 3MC6A 3DRDA 2R5CA 1QGNA 5FT8A 4WD2A 2HOZA 4GDYA 1DKAA 2YCNA 3LVKA 4Q31A 4TMRA 2ZUKA 2X5FA 3G8MA 3A9XA 3GZCA 4OCAA 2AY2A 2ZC0A 2CJHA 1AY5A 1I41A 3TCMA 1AMSA 2D5YA 3GSBA 2ZY5A 3RBLA 2BKWA 3H14A 1MLYA 3ASAA 3RQ1A 4F5KA 3W1IA 4MY5A 1ARSA 2C81A 2FNIA 2VMYA 4AH3A 2YOBA 2CANA 1AHEA 2VGVA 2ORDA 2W7JA 3E2YA 5M4DA 5EAVA 4CXQA 1LW4A 4AO4A 2FM1A 5TF5A 3A9YA 4UOYA 3N0LA 1B9IA 3VAXA 3GR9A 1GBNA 2Z67A 3AOWA 3FQ8A 4B9BA 2BI9A 4M2JA 4W1VA 1WYVA 4F5FA 3FQ7A 4E1OA 3HVYA 1AIAA 9AATA 2PB0A 2EO5A 3GETA 4EMYA 1MAQA 3D6KA 3FDBA 2CTZA 2VMXA 1GC4A 1SZKA 1W3UA 2GSAA 4PFFA 4XEWA 4XK1A 2OGEA 5G0AA 4ITGA 3ZRRA 1YIYA 4UHNA 5E3KA 2YRIA 4XAUA 3E77A 3K40A 1S08A 5M49A 3QI6A 4BHDA 4F4EA 3PPLA 4IY7A 5LHAA 2BWPA 1SZUA 1BT4A 1ASFA 1D7RA 2AY8A 3B1DA 2QMAA 4CBSA 3FTBA 3I5TA 1AAWA 3E2FA 5EUDA 4A0FA 2BYJA 2DGKA 4GE7A 4CBRA 4EU1A 4F5IA 3DU4A 1CQ8A 1IBJA 4ZM4A 4AZKA 1EG5A 1W7MA 3FZ8A 3TATA 1DFOA 1KKPA 3R4TA 4KXKA 3E2ZB 3QN6A 2W7HA 3AOVA 1AHFA 2VIBA 2W7LA 1LC7A 1BQDA 3CBFA 1D7VA 1W7NA 4WXGA 2VMQA 2R0TA 1RVYA 1AY4A 1S07A 3NUBA 2X5DA 4N0WA 3GZDA 1DJUA 1JF9A 1V2EA 3DC1A 4Q6RA 3WKSA 1S0AA 2CFBA 1QJ3A 3VK4A 5M4BA 3JZLA 4MGRA 5AX8A 5HDMA 3VP6A 3BC8A 1BJWA 4OBUA 4MKJA 1GCKA 2FN6A 4ZLVA 1P3WA 2JISA 3IF2A 3G7QA 4MQPA 5G4JA 3NRAA 1OXPA 2W7GA 4L0OA 1OHWA 3ACZA 2HP2A 3A2BA 1TATA 1V2FA 1YJSA 3FFRA 3RCHB 3KGXA 3EI9A 4ZDOA 2AATA 1ASLA 4NOGA 3NYUA 4A6RA 4O6ZA 3EI8A 1KL1A 3FCRA 5DX5A 3QBOA 4WXFA 4Y0DA 3FVXA 1DGDA 3FD0A 1WYTA 1AMQA 4IXOA 3ECDA 2EH6A 1JG8A 3ZRPA 2VMOA 2EZ2A 4F5JA 3QPGA 2OATA 4MKKA 1B5OA 1M0OA 3FDDA 1AX4A 3BS8A 4JEZA 3EIAA 1BW0A 1OHVA 3WY7A 4FFCA 4PVFA 3DR7A 2G6WA 3AV7A 5F8VA 5K8BA 1UU2A 3WCNA 2AY1A 1GC0A 2Q7WA 4XJLA 1IUGA 4LNJA 2O0RA 3FQAA 1O4SA 1BJOA 1J04A 1G4VA 3PDBB 1AICA 2W8TA 2D66A 5FT6A 4R5FA 2VMTA 2W8VA 4F5MA 3NTJA 4HVKA 1GC3A 4GSAA 4LW2A 2GMUA 1E5EA 2YKVA 5EIGB 2ZP7A 1DTYA 3DXVA 1M4NA 2DOUA 3KE3A 4JF0A 4JEWA 4WXBA 2QLRA 2WK7A 4PFNA 3DXWA 3FRKA 4Y0IA 2OKKA 2W7FA 1AHGA 4WYFA 3JU7A 1JS3A 1V72A 3K7YA 1ARIA 5DJ1A 2W7DA 3ASBA 3LVJA 5EQCA 3RI6A 2JJFA 1CL2A 1AMAA 1CS1A 1Z7DA 1ARTA 3F9TA 5BJ4A 4A0RA 1AKCA 2EGYA 4BA5A 4W8IA 2AY7A 2QBTA 2D61A 2Z9VA 1AKAA 3L44A 3WGCA 1LW5A 4CXRA 2BIGA 1MDZA 1MDOA 3BWOA 3DYDA 4RKDA 3HT4A 4RITA 3A9ZA 3CAIA 1Z3ZA 3EI6A 2YCPA 3BB8A 1O69A 3MBBA 2Z1YA 4FL0A 2ZYJA 2W8WA 5EIGA 4WLJA 3ZZJA 1W7LA 1N2TA 2CSTA 5DJ9A 4HF8A 1AMRA 2CH1A 1ASNA 3UAKA 2VYCA 2W7KA 4W1WA 3GBXA 1EQBA 1KMKA 1BJOB 3LWSA 4Q76A 2BHXA 4W5KA 4UQVA 1WYUA 1X0MA 2EZ1A 2XBNA 3F6TA 4WYGA 2OKJA 2CB1A 1H1CA 4WB0A 3KKIA 3K28A 3PGYA 4R5ZA 2D63A 4JEXA 3II0A 1QZ9A 3OP7A 2HUFA 3WX9A 2TPLA 3FVSA 4ADBA 4WLHA 3WGBA 1X28A 1QJ5A 2XH1A 1AAMA 5J8QA 1EJIA 2HZPA 5IWQA 3PJ0A 3TQXA 2D65A 2CY8A 4ITXA 2YKYA 3I4JA 1OHYA 2V1PA 2ZJGA 7AATA 1LKCA 2JJEA 3AATA 4GE4A 2RFVA 1D7SA 3GJUA 2CJDA 4AOAA 2AY6A 4ADDA 3LVMA 1LS3A 3TFUA 5LH9A 2VGWA 3AEOA 4MSOA 4GRXA 3JWAA 3LG0A 3T32A 2VMWA 3NDNA 4IYOB 3AELA 5EAAA 2BYLA 4BQ0A 1D7UA 1ELUA 3PD6A 3CQ5A 4AZJA 3NUIA 3EI5A 4LW4A 2VGUA 3PDXA 1ASMA 1B8GA 3N75A 1M0NA 2YKUA 1WSTA 1QIRA 5FT5A 4LNLA 3BCBA 4JE5D 4KAMA 1C0NA 5G2QA 4RAEA 3RCHA 4AO9A 2W7MA 3WCOA 2C44A 4A6UA 1XEYA 1RVUA 4A72A 4ADCA 2AY9A 4XQ2A 3BN1A 3HDOA 2BI5A 1ZODA 4ISYA 2VMPA 4J8LA 5G2PA 2BIEA 3QHXA 1AIBA 1FG7A 3WZFA 1WYUB 1GEWA 1I29A 5C6UA 2HOYA 3TFTA 2VGZA 3ATHA 5D95A 1SFFA 3LV2A 2R5CB 2BI1A 3QGUA 3R9AA 2HUUA 5BJ3A 2ZSLA 3AENA 2QB3A 2BI2A 3LY1A 1BJ4A 1JS6A 2VMRA 3BV0A 3I16A 1G4XA 3NU8A 2Z9UA 5EFSA 1AY8A 2VGSA 2WK8A 3HMUA 3MEBA 4BA4A 4E3RA 1AKBA 1CQ6A 1GDEA 2W8UA 3W1HA 1N8PA 4M2KA 4ADEA 4OBVA 1ASCA 1I48A 4XJOA 4JF1A 2BI3A 4WYEA 3DR4A 8AATA 1YJYA 3ZRQA 1PG8A 4K2BA 1MLZA 3MAUA 1PFFA 3N5MA 1AHYA 1E5FA 1MGVA 4EFFA 3ELPA 4I8AA 4B98A 3NU7A 4A0HA 2YHKA 3AENB 4F5GA 4ZWVA 4RIZA 3W1JA 3HBXA 1VEFA 5E4ZA 4Y0HA 1IAYA 2Z61A 2JG2A 2AY3A 3H7FA 3NX3A 2R2NA 3PA9A 3PAAA 4JEVA 1KL2A 3RBFA 1LC5A 4N0BA 3AEMC 1D2FA 3MAFB 4TN4A 1CQ7A 1WKGA 1Y4IA 3HLMA 1M0PA 4ZM3A 1T3IA 4RJYA 3UWCA 4IYOA 4JE5A 1YJZA 4JEYA 1C9CA 3B1EA 4LNMA 4P7YA 1TPLA 2PO3A 4K2IA 3MKJA 4UHMA 1RV3A 3PIUA 4OC9A 3P6KA 1C7GA 1WYVB 2JGTA 4GE9A 4K2MA 4ZASA 2AEVA 4MQQA 1IVRA 1WYTB 3FKDA 1ARHA 1X2AA 2D7ZA 1O61A 2VI9A 3Q8NA 4P3MA 4DQ6A 1GD9A 1V2DA 2CJGA 2E7IA 2DKJA 1GEXA 1OATA 1RV4A 2FQ6A 4F5HA 3E2ZA 4ZWMA 1WKHA 2V0YA 4EB5A 3OKSA 3JW9A 2GQNA 1C7OA 2C0RA 2E7UA 1ASDA 1G7XA 3AEPA 3WLXA 4CVQA 4BMKA 2W7IA 1U08A 4XJMA 2AEUA 3EUCA 2AY5A 4M2MA 4IX8A 5DB5A 3EZSA 2BWOA
chains in the Genus database with same CATH superfamily
3B1CA 2YCTA 4ATQA 2Z9XA 1TOJA 3MAFA 5JAYA 3NNKA 1XI9A 3FFHA 4WYAA 3GZDC 5E5IA 1BQAA 3B8XA 1AJSB 4IXZA 3EZ1A 3GWPA 1N31A 5G4IA 1AJSA 1DJ9A 2ZY3A 3BWNA 4OYTA 2PB2A 3KGWA 1PMOA 2VLFA 1C7NA 2R5EA 4OT8A 4IXSA 1MDXA 1OXOA 2HUIA 3BWNC 5HHYA 5I92A 4WP0A 4ZDPA 2O7CA 2Z9WA 2OGAA 1AHXA 2BIAA 3DODA 2F8JA 3FZ7A 1IX6A 2Z20A 4R8DA 4XJPA 3VK2A 4Q75A 3NYSA 1X29A 2FYFA 4J5UA 1ARGA 4RJ0A 1KKJA 1ASGA 4ZSWA 4QGRA 2CINA 3AEMA 3AEJA 4ZDLA 1IX8A 4RLGA 1ZC9A 1ASBA 4A00A 3JTXA 3FSLA 1MAPA 2EPJA 3AEJC 2DGLA 3B46A 3WKRA 1UU1A 4R2NA 1VP4A 1IAXA 4KYOA 1J32A 1PMMA 1B5PA 1GEYA 4GEBA 3E9KA 4TV7A 3COGA 1CJ0A 3L8AA 5EUEA 1CZCA 1GC2A 2VMNA 3PDBA 2WKAA 2JJGA 3BCXA 1VJOA 1TOIA 2D64A 4WYDA 1TASA 4E77A 2VI8A 2D7YA 3FZ6A 1M6SA 1LC8A 1KMJA 1TOGA 4IW7A 1QISA 2VMSA 3DZZA 3CQ4A 4U2HA 1UKJA 2OQXA 1H0CA 2C7TA 3EI7A 1CZEA 2YKXA 3E6GA 2VLHA 1M32A 4RM1A 3ZZKA 3VK3A 2JJHA 2ZSMA 1DJEA 1S09A 3FVUA 5F9SA 1TOEA 2CH2A 1CL1A 1IJIA 4ZSYA 1AJRA 3RUYA 2VMUA 4PIWA 2E54A 1W23A 2W7EA 1BKGA 2QSRA 3M5UA 3N7NA 4W91A 3N4SA 2BWNA 1BJNA 1DGEA 2DKBA 4MQRA 1I43A 1C4KA 2X8UA 1FG3A 3F0HA 3N4XA 1BS0A 2YRRA 2HOXA 1ECXA 2W8JA 3EIBA 1ASEA 5G09A 4F5LA 3NYTA 1S06A 4DGTA 2AY4A 4A6TA 2QB2A 2HORA 1LK9A 2WK9A 2GB3A 3PD6B 4W1XA 1M7YA 2X3LA 5EUNA 5HXXA 5D5SA 2QA3A 3CQ6A 5FT4A 3IHJA 3BCAA 3ELEA 1SF2A 4WBTA 4ATPA 3USFA 4E3QA 1ORDA 3JWBA 1TOKA 2Z1ZA 4H51A 4A0GA 4WYCA 2VGTA 3A8UX 3P1TA 4OTLA 1UU0A 3MADA 5M46A 1IX7A 3ISLA 2VMVA 1ZOBA 3G0TA 2ZY4A 1YOOA 2VMZA 4WB0B 4EB7A 3LVLB 4ZAHA 1G7WA 3VOMA 4UHOA 3HL2A 2DGMA 1YIZA 4U1TA 1B9HA 1M0QA 1SPAA 1O62A 2VIAA 1FC4A 1QITA 1SZSA 2E7JA 1SVVA 1ASAA 2FNUA 2O1BA 3UE8A 1B4XA 2ZY2A 4RKCA 2DR1A 4DBCA 4LC3A 2NMPA 3HQTA 4OMAA 2HP1A 3MC6C 2GMSA 3QM2A 1YAAA 1TARA 1YNUA 1ELQA 3MC6A 3DRDA 2R5CA 1QGNA 5FT8A 4WD2A 2HOZA 4GDYA 1DKAA 2YCNA 3LVKA 4Q31A 4TMRA 2ZUKA 2X5FA 3G8MA 3A9XA 3GZCA 4OCAA 2AY2A 2ZC0A 2CJHA 1AY5A 1I41A 3TCMA 1AMSA 2D5YA 3GSBA 2ZY5A 3RBLA 2BKWA 3H14A 1MLYA 3ASAA 3RQ1A 4F5KA 3W1IA 4MY5A 1ARSA 2C81A 2FNIA 2VMYA 4AH3A 2YOBA 2CANA 1AHEA 2VGVA 2ORDA 2W7JA 3E2YA 5M4DA 5EAVA 4CXQA 1LW4A 4AO4A 2FM1A 5TF5A 3A9YA 4UOYA 3N0LA 1B9IA 3VAXA 3GR9A 1GBNA 2Z67A 3AOWA 3FQ8A 4B9BA 2BI9A 4M2JA 4W1VA 1WYVA 4F5FA 3FQ7A 4E1OA 3HVYA 1AIAA 9AATA 2PB0A 2EO5A 3GETA 4EMYA 1MAQA 3D6KA 3FDBA 2CTZA 2VMXA 1GC4A 1SZKA 1W3UA 2GSAA 4PFFA 4XEWA 4XK1A 2OGEA 5G0AA 4ITGA 3ZRRA 1YIYA 4UHNA 5E3KA 2YRIA 4XAUA 3E77A 3K40A 1S08A 5M49A 3QI6A 4BHDA 4F4EA 3PPLA 4IY7A 5LHAA 2BWPA 1SZUA 1BT4A 1ASFA 1D7RA 2AY8A 3B1DA 2QMAA 4CBSA 3FTBA 3I5TA 1AAWA 3E2FA 5EUDA 4A0FA 2BYJA 2DGKA 4GE7A 4CBRA 4EU1A 4F5IA 3DU4A 1CQ8A 1IBJA 4ZM4A 4AZKA 1EG5A 1W7MA 3FZ8A 3TATA 1DFOA 1KKPA 3R4TA 4KXKA 3E2ZB 3QN6A 2W7HA 3AOVA 1AHFA 2VIBA 2W7LA 1LC7A 1BQDA 3CBFA 1D7VA 1W7NA 4WXGA 2VMQA 2R0TA 1RVYA 1AY4A 1S07A 3NUBA 3N4RA 2X5DA 4N0WA 3GZDA 1DJUA 1JF9A 1V2EA 3DC1A 4Q6RA 3WKSA 1S0AA 2CFBA 1QJ3A 3VK4A 5M4BA 3JZLA 4MGRA 5AX8A 5HDMA 3VP6A 3BC8A 1BJWA 4OBUA 4MKJA 1GCKA 2FN6A 4ZLVA 1P3WA 2JISA 3IF2A 3G7QA 4MQPA 5G4JA 3NRAA 1OXPA 2W7GA 4L0OA 1OHWA 3ACZA 2HP2A 3A2BA 1TATA 1V2FA 1YJSA 3FFRA 3RCHB 3KGXA 3EI9A 4ZDOA 2AATA 1ASLA 4NOGA 3NYUA 4A6RA 4O6ZA 3EI8A 2FKIA 1KL1A 3FCRA 5DX5A 3QBOA 4WXFA 2G7JA 4Y0DA 3FVXA 1DGDA 3FD0A 1WYTA 1AMQA 4IXOA 3ECDA 2EH6A 1JG8A 3ZRPA 2VMOA 2EZ2A 4F5JA 3QPGA 2OATA 4MKKA 1B5OA 1M0OA 3FDDA 1AX4A 3BS8A 4JEZA 3EIAA 1BW0A 1OHVA 3WY7A 4FFCA 4PVFA 3DR7A 2G6WA 3AV7A 5F8VA 5K8BA 1UU2A 3WCNA 2AY1A 1GC0A 2Q7WA 4XJLA 1IUGA 4LNJA 2O0RA 3FQAA 1O4SA 1BJOA 1J04A 1G4VA 3PDBB 1AICA 2W8TA 2D66A 5FT6A 4R5FA 2VMTA 2W8VA 4F5MA 3NTJA 4HVKA 1GC3A 4GSAA 4LW2A 2GMUA 1E5EA 2YKVA 5EIGB 2ZP7A 1DTYA 3DXVA 1M4NA 2DOUA 3KE3A 4JF0A 4JEWA 4WXBA 2QLRA 2WK7A 4PFNA 3DXWA 3FRKA 4Y0IA 2OKKA 2W7FA 1AHGA 4WYFA 3JU7A 1JS3A 1V72A 3K7YA 2A1VA 1ARIA 5DJ1A 2W7DA 3ASBA 3LVJA 5EQCA 3RI6A 2JJFA 1CL2A 1AMAA 1CS1A 1Z7DA 1ARTA 3F9TA 5BJ4A 4A0RA 1AKCA 2EGYA 4BA5A 4W8IA 2AY7A 2QBTA 2D61A 2Z9VA 1AKAA 3L44A 3WGCA 1LW5A 4CXRA 2BIGA 1MDZA 1MDOA 3BWOA 3DYDA 4RKDA 3HT4A 4RITA 3A9ZA 3CAIA 1Z3ZA 3EI6A 2YCPA 3BB8A 1O69A 3MBBA 2Z1YA 4FL0A 2ZYJA 2W8WA 5EIGA 4WLJA 3ZZJA 1W7LA 1N2TA 2CSTA 5DJ9A 4HF8A 1AMRA 2CH1A 1ASNA 3UAKA 2VYCA 2W7KA 4W1WA 3GBXA 1EQBA 1KMKA 1BJOB 3LWSA 4Q76A 2BHXA 4W5KA 4UQVA 1WYUA 1X0MA 2EZ1A 2XBNA 3F6TA 4WYGA 2OKJA 2CB1A 1H1CA 4WB0A 3KKIA 3K28A 3PGYA 4R5ZA 2D63A 4JEXA 3II0A 1QZ9A 3OP7A 2HUFA 3WX9A 2TPLA 3FVSA 4ADBA 4WLHA 3WGBA 1X28A 1QJ5A 2XH1A 1AAMA 5J8QA 1EJIA 2HZPA 5IWQA 3PJ0A 3TQXA 2D65A 2CY8A 4ITXA 2YKYA 3I4JA 1OHYA 2V1PA 2ZJGA 7AATA 1LKCA 2JJEA 3AATA 4GE4A 2RFVA 1D7SA 3GJUA 2CJDA 4AOAA 2AY6A 4ADDA 3LVMA 1LS3A 3TFUA 5LH9A 2VGWA 3AEOA 4MSOA 4GRXA 3JWAA 3LG0A 3T32A 2VMWA 3NDNA 4IYOB 3AELA 5EAAA 2BYLA 4BQ0A 1D7UA 1ELUA 3PD6A 3CQ5A 4AZJA 3NUIA 3EI5A 4LW4A 2VGUA 3PDXA 1ASMA 1B8GA 3N75A 1M0NA 2YKUA 1WSTA 1QIRA 5FT5A 4LNLA 3BCBA 4JE5D 4KAMA 1C0NA 5G2QA 4RAEA 3RCHA 4AO9A 2W7MA 3WCOA 2C44A 4A6UA 1XEYA 1RVUA 4A72A 4ADCA 2AY9A 4XQ2A 3BN1A 3HDOA 2BI5A 1ZODA 2KFPA 4ISYA 2VMPA 4J8LA 5G2PA 2BIEA 3QHXA 1AIBA 1FG7A 3WZFA 1WYUB 1GEWA 1I29A 5C6UA 2HOYA 3TFTA 3H9XA 2EYQA 2VGZA 3ATHA 5D95A 1SFFA 3LV2A 2R5CB 2BI1A 3QGUA 3R9AA 2HUUA 5BJ3A 2ZSLA 3AENA 2QB3A 2BI2A 3LY1A 1BJ4A 1JS6A 2VMRA 3BV0A 3I16A 1G4XA 3NU8A 2Z9UA 5EFSA 1AY8A 2VGSA 2WK8A 3HMUA 3MEBA 4BA4A 4E3RA 1AKBA 1CQ6A 1GDEA 4H63Q 2W8UA 3W1HA 1N8PA 4M2KA 2WB6A 4ADEA 4OBVA 1ASCA 1I48A 4XJOA 4JF1A 2BI3A 4WYEA 4K05A 3DR4A 8AATA 1YJYA 3ZRQA 1PG8A 4K2BA 1MLZA 3MAUA 1PFFA 3N5MA 1AHYA 1E5FA 1MGVA 4EFFA 3ELPA 4I8AA 4B98A 3NU7A 4A0HA 2YHKA 3AENB 4F5GA 4ZWVA 4RIZA 3W1JA 3HBXA 1VEFA 5E4ZA 5KTBA 4Y0HA 1IAYA 2Z61A 2JG2A 2AY3A 3H7FA 3NX3A 2R2NA 3PA9A 3PAAA 4JEVA 1KL2A 3RBFA 1LC5A 4N0BA 3AEMC 1D2FA 3MAFB 4TN4A 1CQ7A 1WKGA 1Y4IA 3HLMA 1M0PA 4ZM3A 1T3IA 4RJYA 3UWCA 4IYOA 4JE5A 1YJZA 4JEYA 1C9CA 3B1EA 4LNMA 4P7YA 1TPLA 2PO3A 4K2IA 3MKJA 4UHMA 1RV3A 3PIUA 4OC9A 3P6KA 1C7GA 1WYVB 2JGTA 4GE9A 4K2MA 4ZASA 2AEVA 4MQQA 1IVRA 1WYTB 3FKDA 1ARHA 1X2AA 2D7ZA 1O61A 2VI9A 3Q8NA 4P3MA 4DQ6A 1GD9A 1V2DA 2CJGA 2E7IA 2DKJA 1GEXA 1OATA 1RV4A 2FQ6A 4F5HA 3E2ZA 4ZWMA 1WKHA 2V0YA 4EB5A 3OKSA 3JW9A 2GQNA 1C7OA 2C0RA 1KAFA 2E7UA 1ASDA 1G7XA 3AEPA 3WLXA 4CVQA 4BMKA 2W7IA 1U08A 4XJMA 2AEUA 3EUCA 2AY5A 4M2MA 4IX8A 5DB5A 3EZSA 2BWOA
chains in the Genus database with same CATH topology
3B1CA 2YCTA 4ATQA 2Z9XA 1TOJA 3MAFA 5JAYA 3NNKA 1XI9A 3FFHA 4WYAA 3GZDC 5E5IA 1BQAA 3B8XA 1AJSB 4IXZA 3EZ1A 3GWPA 1N31A 5G4IA 1AJSA 1DJ9A 2ZY3A 3BWNA 4OYTA 2PB2A 3KGWA 1PMOA 2VLFA 1C7NA 2R5EA 4OT8A 4IXSA 1MDXA 1OXOA 2HUIA 3BWNC 5HHYA 5I92A 4WP0A 4ZDPA 2O7CA 2Z9WA 2OGAA 1AHXA 2BIAA 3DODA 2F8JA 3FZ7A 1IX6A 2Z20A 4R8DA 4XJPA 3VK2A 4Q75A 3NYSA 1X29A 2FYFA 4J5UA 1ARGA 4RJ0A 1KKJA 1ASGA 4ZSWA 4QGRA 2CINA 3AEMA 3AEJA 4ZDLA 1IX8A 4RLGA 1ZC9A 1ASBA 4A00A 3JTXA 3FSLA 1MAPA 2EPJA 3AEJC 2DGLA 3B46A 3WKRA 1UU1A 4R2NA 1VP4A 1IAXA 4KYOA 1J32A 1PMMA 1B5PA 1GEYA 4GEBA 3E9KA 4TV7A 3COGA 1CJ0A 3L8AA 5EUEA 1CZCA 1GC2A 2VMNA 3PDBA 2WKAA 2JJGA 3BCXA 1VJOA 1TOIA 2D64A 4WYDA 1TASA 4E77A 2VI8A 2D7YA 3FZ6A 1M6SA 1LC8A 1KMJA 1TOGA 4IW7A 1QISA 2VMSA 3DZZA 3CQ4A 4U2HA 1UKJA 2OQXA 1H0CA 2C7TA 3EI7A 1CZEA 2YKXA 3E6GA 2VLHA 1M32A 4RM1A 3ZZKA 3VK3A 2JJHA 2ZSMA 1DJEA 1S09A 3FVUA 5F9SA 1TOEA 2CH2A 1CL1A 1IJIA 4ZSYA 1AJRA 3RUYA 2VMUA 4PIWA 2E54A 1W23A 2W7EA 1BKGA 2QSRA 3M5UA 3N7NA 4W91A 3N4SA 2BWNA 1BJNA 1DGEA 2DKBA 4MQRA 1I43A 1C4KA 2X8UA 1FG3A 3F0HA 3N4XA 1BS0A 2YRRA 2HOXA 1ECXA 2W8JA 3EIBA 1ASEA 5G09A 4F5LA 3NYTA 1S06A 4DGTA 2AY4A 4A6TA 2QB2A 2HORA 1LK9A 2WK9A 2GB3A 3PD6B 4W1XA 1M7YA 2X3LA 5EUNA 5HXXA 5D5SA 2QA3A 3CQ6A 5FT4A 3IHJA 3BCAA 3ELEA 1SF2A 4WBTA 4ATPA 3USFA 4E3QA 1ORDA 3JWBA 1TOKA 2Z1ZA 4H51A 4A0GA 4WYCA 2VGTA 3A8UX 3P1TA 4OTLA 1UU0A 3MADA 5M46A 1IX7A 3ISLA 2VMVA 1ZOBA 3G0TA 2ZY4A 1YOOA 2VMZA 4WB0B 4EB7A 3LVLB 4ZAHA 1G7WA 3VOMA 4UHOA 3HL2A 2DGMA 1YIZA 4U1TA 1B9HA 1M0QA 1SPAA 1O62A 2VIAA 1FC4A 1QITA 1SZSA 2E7JA 1SVVA 1ASAA 2FNUA 2O1BA 3UE8A 1B4XA 2ZY2A 4RKCA 2DR1A 4DBCA 4LC3A 2NMPA 3HQTA 4OMAA 2HP1A 3MC6C 2GMSA 3QM2A 1YAAA 1TARA 1YNUA 1ELQA 3MC6A 3DRDA 2R5CA 1QGNA 5FT8A 4WD2A 2HOZA 4GDYA 1DKAA 2YCNA 3LVKA 4Q31A 4TMRA 2ZUKA 2X5FA 3G8MA 3A9XA 3GZCA 4OCAA 2AY2A 2ZC0A 2CJHA 1AY5A 1I41A 3TCMA 1AMSA 2D5YA 3GSBA 2ZY5A 3RBLA 2BKWA 3H14A 1MLYA 3ASAA 3RQ1A 4F5KA 3W1IA 4MY5A 1ARSA 2C81A 2FNIA 2VMYA 4AH3A 2YOBA 2CANA 1AHEA 2VGVA 2ORDA 2W7JA 3E2YA 5M4DA 5EAVA 4CXQA 1LW4A 4AO4A 2FM1A 5TF5A 3A9YA 4UOYA 3N0LA 1B9IA 3VAXA 3GR9A 1GBNA 2Z67A 3AOWA 3FQ8A 4B9BA 2BI9A 4M2JA 4W1VA 1WYVA 4F5FA 3FQ7A 4E1OA 3HVYA 1AIAA 9AATA 2PB0A 2EO5A 3GETA 4EMYA 1MAQA 3D6KA 3FDBA 2CTZA 2VMXA 1GC4A 1SZKA 1W3UA 2GSAA 4PFFA 4XEWA 4XK1A 2OGEA 5G0AA 4ITGA 3ZRRA 1YIYA 4UHNA 5E3KA 2YRIA 4XAUA 3E77A 3K40A 1S08A 5M49A 3QI6A 4BHDA 4F4EA 3PPLA 4IY7A 5LHAA 2BWPA 1SZUA 1BT4A 1ASFA 1D7RA 2AY8A 3B1DA 2QMAA 4CBSA 3FTBA 3I5TA 1AAWA 3E2FA 5EUDA 4A0FA 2BYJA 2DGKA 4GE7A 4CBRA 4EU1A 4F5IA 3DU4A 1CQ8A 1IBJA 4ZM4A 4AZKA 1EG5A 1W7MA 3FZ8A 3TATA 1DFOA 1KKPA 3R4TA 4KXKA 3E2ZB 3QN6A 2W7HA 3AOVA 1AHFA 2VIBA 2W7LA 1LC7A 1BQDA 3CBFA 1D7VA 1W7NA 4WXGA 2VMQA 2R0TA 1RVYA 1AY4A 1S07A 3NUBA 3N4RA 2X5DA 4N0WA 3GZDA 1DJUA 1JF9A 1V2EA 3DC1A 4Q6RA 3WKSA 1S0AA 2CFBA 1QJ3A 3VK4A 5M4BA 3JZLA 4MGRA 5AX8A 5HDMA 3VP6A 3BC8A 1BJWA 4OBUA 4MKJA 1GCKA 2FN6A 4ZLVA 1P3WA 2JISA 3IF2A 3G7QA 4MQPA 5G4JA 3NRAA 1OXPA 2W7GA 4L0OA 1OHWA 3ACZA 2HP2A 3A2BA 1TATA 1V2FA 1YJSA 3FFRA 3RCHB 3KGXA 3EI9A 4ZDOA 2AATA 1ASLA 4NOGA 3NYUA 4A6RA 4O6ZA 3EI8A 2FKIA 1KL1A 3FCRA 5DX5A 3QBOA 4WXFA 2G7JA 4Y0DA 3FVXA 1DGDA 3FD0A 1WYTA 1AMQA 4IXOA 3ECDA 2EH6A 1JG8A 3ZRPA 2VMOA 2EZ2A 4F5JA 3QPGA 2OATA 4MKKA 1B5OA 1M0OA 3FDDA 1AX4A 3BS8A 4JEZA 3EIAA 1BW0A 1OHVA 3WY7A 4FFCA 4PVFA 3DR7A 2G6WA 3AV7A 5F8VA 5K8BA 1UU2A 3WCNA 2AY1A 1GC0A 2Q7WA 4XJLA 1IUGA 4LNJA 2O0RA 3FQAA 1O4SA 1BJOA 1J04A 1G4VA 3PDBB 1AICA 2W8TA 2D66A 5FT6A 4R5FA 2VMTA 2W8VA 4F5MA 3NTJA 4HVKA 1GC3A 4GSAA 4LW2A 2GMUA 1E5EA 2YKVA 5EIGB 2ZP7A 1DTYA 3DXVA 1M4NA 2DOUA 3KE3A 4JF0A 4JEWA 4WXBA 2QLRA 2WK7A 4PFNA 3DXWA 3FRKA 4Y0IA 2OKKA 2W7FA 1AHGA 4WYFA 3JU7A 1JS3A 1V72A 3K7YA 2A1VA 1ARIA 5DJ1A 2W7DA 3ASBA 3LVJA 5EQCA 3RI6A 2JJFA 1CL2A 1AMAA 1CS1A 1Z7DA 1ARTA 3F9TA 5BJ4A 4A0RA 1AKCA 2EGYA 4BA5A 4W8IA 2AY7A 2QBTA 2D61A 2Z9VA 1AKAA 3L44A 3WGCA 1LW5A 4CXRA 2BIGA 1MDZA 1MDOA 3BWOA 3DYDA 4RKDA 3HT4A 4RITA 3A9ZA 3CAIA 1Z3ZA 3EI6A 2YCPA 3BB8A 1O69A 3MBBA 2Z1YA 4FL0A 2ZYJA 2W8WA 5EIGA 4WLJA 3ZZJA 1W7LA 1N2TA 2CSTA 5DJ9A 4HF8A 1AMRA 2CH1A 1ASNA 3UAKA 2VYCA 2W7KA 4W1WA 3GBXA 1EQBA 1KMKA 1BJOB 3LWSA 4Q76A 2BHXA 4W5KA 4UQVA 1WYUA 1X0MA 2EZ1A 2XBNA 3F6TA 4WYGA 2OKJA 2CB1A 1H1CA 4WB0A 3KKIA 3K28A 3PGYA 4R5ZA 2D63A 4JEXA 3II0A 1QZ9A 3OP7A 2HUFA 3WX9A 2TPLA 3FVSA 4ADBA 4WLHA 3WGBA 1X28A 1QJ5A 2XH1A 1AAMA 5J8QA 1EJIA 2HZPA 5IWQA 3PJ0A 3TQXA 2D65A 2CY8A 4ITXA 2YKYA 3I4JA 1OHYA 2V1PA 2ZJGA 7AATA 1LKCA 2JJEA 3AATA 4GE4A 2RFVA 1D7SA 3GJUA 2CJDA 4AOAA 2AY6A 4ADDA 3LVMA 1LS3A 3TFUA 5LH9A 2VGWA 3AEOA 4MSOA 4GRXA 3JWAA 3LG0A 3T32A 2VMWA 3NDNA 4IYOB 3AELA 5EAAA 2BYLA 4BQ0A 1D7UA 1ELUA 3PD6A 3CQ5A 4AZJA 3NUIA 3EI5A 4LW4A 2VGUA 3PDXA 1ASMA 1B8GA 3N75A 1M0NA 2YKUA 1WSTA 1QIRA 5FT5A 4LNLA 3BCBA 4JE5D 4KAMA 1C0NA 5G2QA 4RAEA 3RCHA 4AO9A 2W7MA 3WCOA 2C44A 4A6UA 1XEYA 1RVUA 4A72A 4ADCA 2AY9A 4XQ2A 3BN1A 3HDOA 2BI5A 1ZODA 2KFPA 4ISYA 2VMPA 4J8LA 5G2PA 2BIEA 3QHXA 1AIBA 1FG7A 3WZFA 1WYUB 1GEWA 1I29A 5C6UA 2HOYA 3TFTA 3H9XA 2EYQA 2VGZA 3ATHA 5D95A 1SFFA 3LV2A 2R5CB 2BI1A 3QGUA 3R9AA 2HUUA 5BJ3A 2ZSLA 3AENA 2QB3A 2BI2A 3LY1A 1BJ4A 1JS6A 2VMRA 3BV0A 3I16A 1G4XA 3NU8A 2Z9UA 5EFSA 1AY8A 2VGSA 2WK8A 3HMUA 3MEBA 4BA4A 4E3RA 1AKBA 1CQ6A 1GDEA 4H63Q 2W8UA 3W1HA 1N8PA 4M2KA 2WB6A 4ADEA 4OBVA 1ASCA 1I48A 4XJOA 4JF1A 2BI3A 4WYEA 4K05A 3DR4A 8AATA 1YJYA 3ZRQA 1PG8A 4K2BA 1MLZA 3MAUA 1PFFA 3N5MA 1AHYA 1E5FA 1MGVA 4EFFA 3ELPA 4I8AA 4B98A 3NU7A 4A0HA 2YHKA 3AENB 4F5GA 4ZWVA 4RIZA 3W1JA 3HBXA 1VEFA 5E4ZA 5KTBA 4Y0HA 1IAYA 2Z61A 2JG2A 2AY3A 3H7FA 3NX3A 2R2NA 3PA9A 3PAAA 4JEVA 1KL2A 3RBFA 1LC5A 4N0BA 3AEMC 1D2FA 3MAFB 4TN4A 1CQ7A 1WKGA 1Y4IA 3HLMA 1M0PA 4ZM3A 1T3IA 4RJYA 3UWCA 4IYOA 4JE5A 1YJZA 4JEYA 1C9CA 3B1EA 4LNMA 4P7YA 1TPLA 2PO3A 4K2IA 3MKJA 4UHMA 1RV3A 3PIUA 4OC9A 3P6KA 1C7GA 1WYVB 2JGTA 4GE9A 4K2MA 4ZASA 2AEVA 4MQQA 1IVRA 1WYTB 3FKDA 1ARHA 1X2AA 2D7ZA 1O61A 2VI9A 3Q8NA 4P3MA 4DQ6A 1GD9A 1V2DA 2CJGA 2E7IA 2DKJA 1GEXA 1OATA 1RV4A 2FQ6A 4F5HA 3E2ZA 4ZWMA 1WKHA 2V0YA 4EB5A 3OKSA 3JW9A 2GQNA 1C7OA 2C0RA 2E7UA 1ASDA 1G7XA 3AEPA 3WLXA 4CVQA 4BMKA 2W7IA 1U08A 4XJMA 2AEUA 3EUCA 2AY5A 4M2MA 4IX8A 5DB5A 3EZSA 2BWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B1C A;  2YCT A;  4ATQ A;  2Z9X A;  1TOJ A;  3MAF A;  5JAY A;  3NNK A;  1XI9 A;  3FFH A;  4WYA A;  3GZD C;  5E5I A;  1BQA A;  3B8X A;  1AJS B;  4IXZ A;  3EZ1 A;  3GWP A;  1N31 A;  5G4I A;  1AJS A;  1DJ9 A;  2ZY3 A;  3BWN A;  4OYT A;  2PB2 A;  3KGW A;  1PMO A;  2VLF A;  1C7N A;  2R5E A;  4OT8 A;  4IXS A;  1MDX A;  1OXO A;  2HUI A;  3BWN C;  5HHY A;  5I92 A;  4WP0 A;  4ZDP A;  2O7C A;  2Z9W A;  2OGA A;  1AHX A;  2BIA A;  3DOD A;  2F8J A;  3FZ7 A;  1IX6 A;  2Z20 A;  4R8D A;  4XJP A;  3VK2 A;  4Q75 A;  3NYS A;  1X29 A;  2FYF A;  4J5U A;  1ARG A;  4RJ0 A;  1KKJ A;  1ASG A;  4ZSW A;  4QGR A;  2CIN A;  3AEM A;  3AEJ A;  4ZDL A;  1IX8 A;  4RLG A;  1ZC9 A;  1ASB A;  4A00 A;  3JTX A;  3FSL A;  1MAP A;  2EPJ A;  3AEJ C;  2DGL A;  3B46 A;  3WKR A;  1UU1 A;  4R2N A;  1VP4 A;  1IAX A;  4KYO A;  1J32 A;  1PMM A;  1B5P A;  1GEY A;  4GEB A;  3E9K A;  4TV7 A;  3COG A;  1CJ0 A;  3L8A A;  5EUE A;  1CZC A;  1GC2 A;  2VMN A;  3PDB A;  2WKA A;  2JJG A;  3BCX A;  1VJO A;  1TOI A;  2D64 A;  4WYD A;  1TAS A;  4E77 A;  2VI8 A;  2D7Y A;  3FZ6 A;  1M6S A;  1LC8 A;  1KMJ A;  1TOG A;  4IW7 A;  1QIS A;  2VMS A;  3DZZ A;  3CQ4 A;  4U2H A;  1UKJ A;  2OQX A;  1H0C A;  2C7T A;  3EI7 A;  1CZE A;  2YKX A;  3E6G A;  2VLH A;  1M32 A;  4RM1 A;  3ZZK A;  3VK3 A;  2JJH A;  2ZSM A;  1DJE A;  1S09 A;  3FVU A;  5F9S A;  1TOE A;  2CH2 A;  1CL1 A;  1IJI A;  4ZSY A;  1AJR A;  3RUY A;  2VMU A;  4PIW A;  2E54 A;  1W23 A;  2W7E A;  1BKG A;  3M5U A;  4W91 A;  2BWN A;  1BJN A;  1DGE A;  2DKB A;  4MQR A;  1I43 A;  1C4K A;  2X8U A;  1FG3 A;  3F0H A;  1BS0 A;  2YRR A;  2HOX A;  1ECX A;  2W8J A;  3EIB A;  1ASE A;  5G09 A;  4F5L A;  3NYT A;  1S06 A;  4DGT A;  2AY4 A;  4A6T A;  2QB2 A;  2HOR A;  1LK9 A;  2WK9 A;  2GB3 A;  3PD6 B;  4W1X A;  1M7Y A;  2X3L A;  5EUN A;  5HXX A;  5D5S A;  2QA3 A;  3CQ6 A;  5FT4 A;  3IHJ A;  3BCA A;  3ELE A;  1SF2 A;  4WBT A;  4ATP A;  3USF A;  4E3Q A;  1ORD A;  3JWB A;  1TOK A;  2Z1Z A;  4H51 A;  4A0G A;  4WYC A;  2VGT A;  3A8U X;  3P1T A;  4OTL A;  1UU0 A;  3MAD A;  5M46 A;  1IX7 A;  3ISL A;  2VMV A;  1ZOB A;  3G0T A;  2ZY4 A;  1YOO A;  2VMZ A;  4WB0 B;  4EB7 A;  3LVL B;  4ZAH A;  1G7W A;  3VOM A;  4UHO A;  3HL2 A;  2DGM A;  1YIZ A;  4U1T A;  1B9H A;  1M0Q A;  1SPA A;  1O62 A;  2VIA A;  1FC4 A;  1QIT A;  1SZS A;  2E7J A;  1SVV A;  1ASA A;  2FNU A;  2O1B A;  3UE8 A;  1B4X A;  2ZY2 A;  4RKC A;  2DR1 A;  4DBC A;  4LC3 A;  2NMP A;  3HQT A;  4OMA A;  2HP1 A;  3MC6 C;  2GMS A;  3QM2 A;  1YAA A;  1TAR A;  1YNU A;  1ELQ A;  3MC6 A;  3DRD A;  2R5C A;  1QGN A;  5FT8 A;  4WD2 A;  2HOZ A;  4GDY A;  1DKA A;  2YCN A;  3LVK A;  4Q31 A;  4TMR A;  2ZUK A;  2X5F A;  3G8M A;  3A9X A;  3GZC A;  4OCA A;  2AY2 A;  2ZC0 A;  2CJH A;  1AY5 A;  1I41 A;  3TCM A;  1AMS A;  2D5Y A;  3GSB A;  2ZY5 A;  3RBL A;  2BKW A;  3H14 A;  1MLY A;  3ASA A;  3RQ1 A;  4F5K A;  3W1I A;  4MY5 A;  1ARS A;  2C81 A;  2FNI A;  2VMY A;  4AH3 A;  2YOB A;  2CAN A;  1AHE A;  2VGV A;  2ORD A;  2W7J A;  3E2Y A;  5M4D A;  5EAV A;  4CXQ A;  1LW4 A;  4AO4 A;  2FM1 A;  5TF5 A;  3A9Y A;  4UOY A;  3N0L A;  1B9I A;  3VAX A;  3GR9 A;  1GBN A;  2Z67 A;  3AOW A;  3FQ8 A;  4B9B A;  2BI9 A;  4M2J A;  4W1V A;  1WYV A;  4F5F A;  3FQ7 A;  4E1O A;  3HVY A;  1AIA A;  9AAT A;  2PB0 A;  2EO5 A;  3GET A;  4EMY A;  1MAQ A;  3D6K A;  3FDB A;  2CTZ A;  2VMX A;  1GC4 A;  1SZK A;  1W3U A;  2GSA A;  4PFF A;  4XEW A;  4XK1 A;  2OGE A;  5G0A A;  4ITG A;  3ZRR A;  1YIY A;  4UHN A;  5E3K A;  2YRI A;  4XAU A;  3E77 A;  3K40 A;  1S08 A;  5M49 A;  3QI6 A;  4BHD A;  4F4E A;  3PPL A;  4IY7 A;  5LHA A;  2BWP A;  1SZU A;  1BT4 A;  1ASF A;  1D7R A;  2AY8 A;  3B1D A;  2QMA A;  4CBS A;  3FTB A;  3I5T A;  1AAW A;  3E2F A;  5EUD A;  4A0F A;  2BYJ A;  2DGK A;  4GE7 A;  4CBR A;  4EU1 A;  4F5I A;  3DU4 A;  1CQ8 A;  1IBJ A;  4ZM4 A;  4AZK A;  1EG5 A;  1W7M A;  3FZ8 A;  3TAT A;  1DFO A;  1KKP A;  3R4T A;  4KXK A;  3E2Z B;  3QN6 A;  2W7H A;  3AOV A;  1AHF A;  2VIB A;  2W7L A;  1LC7 A;  1BQD A;  3CBF A;  1D7V A;  1W7N A;  4WXG A;  2VMQ A;  2R0T A;  1RVY A;  1AY4 A;  1S07 A;  3NUB A;  2X5D A;  4N0W A;  3GZD A;  1DJU A;  1JF9 A;  1V2E A;  3DC1 A;  4Q6R A;  3WKS A;  1S0A A;  2CFB A;  1QJ3 A;  3VK4 A;  5M4B A;  3JZL A;  4MGR A;  5AX8 A;  5HDM A;  3VP6 A;  3BC8 A;  1BJW A;  4OBU A;  4MKJ A;  1GCK A;  2FN6 A;  4ZLV A;  1P3W A;  2JIS A;  3IF2 A;  3G7Q A;  4MQP A;  5G4J A;  3NRA A;  1OXP A;  2W7G A;  4L0O A;  1OHW A;  3ACZ A;  2HP2 A;  3A2B A;  1TAT A;  1V2F A;  1YJS A;  3FFR A;  3RCH B;  3KGX A;  3EI9 A;  4ZDO A;  2AAT A;  1ASL A;  4NOG A;  3NYU A;  4A6R A;  4O6Z A;  3EI8 A;  1KL1 A;  3FCR A;  5DX5 A;  3QBO A;  4WXF A;  4Y0D A;  3FVX A;  1DGD A;  3FD0 A;  1WYT A;  1AMQ A;  4IXO A;  3ECD A;  2EH6 A;  1JG8 A;  3ZRP A;  2VMO A;  2EZ2 A;  4F5J A;  3QPG A;  2OAT A;  4MKK A;  1B5O A;  1M0O A;  3FDD A;  1AX4 A;  3BS8 A;  4JEZ A;  3EIA A;  1BW0 A;  1OHV A;  3WY7 A;  4FFC A;  4PVF A;  3DR7 A;  2G6W A;  3AV7 A;  5F8V A;  5K8B A;  1UU2 A;  3WCN A;  2AY1 A;  1GC0 A;  2Q7W A;  4XJL A;  1IUG A;  4LNJ A;  2O0R A;  3FQA A;  1O4S A;  1BJO A;  1J04 A;  1G4V A;  3PDB B;  1AIC A;  2W8T A;  2D66 A;  5FT6 A;  4R5F A;  2VMT A;  2W8V A;  4F5M A;  3NTJ A;  4HVK A;  1GC3 A;  4GSA A;  4LW2 A;  2GMU A;  1E5E A;  2YKV A;  5EIG B;  2ZP7 A;  1DTY A;  3DXV A;  1M4N A;  2DOU A;  3KE3 A;  4JF0 A;  4JEW A;  4WXB A;  2QLR A;  2WK7 A;  4PFN A;  3DXW A;  3FRK A;  4Y0I A;  2OKK A;  2W7F A;  1AHG A;  4WYF A;  3JU7 A;  1JS3 A;  1V72 A;  3K7Y A;  1ARI A;  5DJ1 A;  2W7D A;  3ASB A;  3LVJ A;  5EQC A;  3RI6 A;  2JJF A;  1CL2 A;  1AMA A;  1CS1 A;  1Z7D A;  1ART A;  3F9T A;  5BJ4 A;  4A0R A;  1AKC A;  2EGY A;  4BA5 A;  4W8I A;  2AY7 A;  2QBT A;  2D61 A;  2Z9V A;  1AKA A;  3L44 A;  3WGC A;  1LW5 A;  4CXR A;  2BIG A;  1MDZ A;  1MDO A;  3BWO A;  3DYD A;  4RKD A;  3HT4 A;  4RIT A;  3A9Z A;  3CAI A;  1Z3Z A;  3EI6 A;  2YCP A;  3BB8 A;  1O69 A;  3MBB A;  2Z1Y A;  4FL0 A;  2ZYJ A;  2W8W A;  5EIG A;  4WLJ A;  3ZZJ A;  1W7L A;  1N2T A;  2CST A;  5DJ9 A;  4HF8 A;  1AMR A;  2CH1 A;  1ASN A;  3UAK A;  2VYC A;  2W7K A;  4W1W A;  3GBX A;  1EQB A;  1KMK A;  1BJO B;  3LWS A;  4Q76 A;  2BHX A;  4W5K A;  4UQV A;  1WYU A;  1X0M A;  2EZ1 A;  2XBN A;  3F6T A;  4WYG A;  2OKJ A;  2CB1 A;  1H1C A;  4WB0 A;  3KKI A;  3K28 A;  3PGY A;  4R5Z A;  2D63 A;  4JEX A;  3II0 A;  1QZ9 A;  3OP7 A;  2HUF A;  3WX9 A;  2TPL A;  3FVS A;  4ADB A;  4WLH A;  3WGB A;  1X28 A;  1QJ5 A;  2XH1 A;  1AAM A;  5J8Q A;  1EJI A;  2HZP A;  5IWQ A;  3PJ0 A;  3TQX A;  2D65 A;  2CY8 A;  4ITX A;  2YKY A;  3I4J A;  1OHY A;  2V1P A;  2ZJG A;  7AAT A;  1LKC A;  2JJE A;  3AAT A;  4GE4 A;  2RFV A;  1D7S A;  3GJU A;  2CJD A;  4AOA A;  2AY6 A;  4ADD A;  3LVM A;  1LS3 A;  3TFU A;  5LH9 A;  2VGW A;  3AEO A;  4MSO A;  4GRX A;  3JWA A;  3LG0 A;  3T32 A;  2VMW A;  3NDN A;  4IYO B;  3AEL A;  5EAA A;  2BYL A;  4BQ0 A;  1D7U A;  1ELU A;  3PD6 A;  3CQ5 A;  4AZJ A;  3NUI A;  3EI5 A;  4LW4 A;  2VGU A;  3PDX A;  1ASM A;  1B8G A;  3N75 A;  1M0N A;  2YKU A;  1WST A;  1QIR A;  5FT5 A;  4LNL A;  3BCB A;  4JE5 D;  4KAM A;  1C0N A;  5G2Q A;  4RAE A;  3RCH A;  4AO9 A;  2W7M A;  3WCO A;  2C44 A;  4A6U A;  1XEY A;  1RVU A;  4A72 A;  4ADC A;  2AY9 A;  4XQ2 A;  3BN1 A;  3HDO A;  2BI5 A;  1ZOD A;  4ISY A;  2VMP A;  4J8L A;  5G2P A;  2BIE A;  3QHX A;  1AIB A;  1FG7 A;  3WZF A;  1WYU B;  1GEW A;  1I29 A;  5C6U A;  2HOY A;  3TFT A;  2VGZ A;  3ATH A;  5D95 A;  1SFF A;  3LV2 A;  2R5C B;  2BI1 A;  3QGU A;  3R9A A;  2HUU A;  5BJ3 A;  2ZSL A;  3AEN A;  2QB3 A;  2BI2 A;  3LY1 A;  1BJ4 A;  1JS6 A;  2VMR A;  3BV0 A;  3I16 A;  1G4X A;  3NU8 A;  2Z9U A;  5EFS A;  1AY8 A;  2VGS A;  2WK8 A;  3HMU A;  3MEB A;  4BA4 A;  4E3R A;  1AKB A;  1CQ6 A;  1GDE A;  2W8U A;  3W1H A;  1N8P A;  4M2K A;  4ADE A;  4OBV A;  1ASC A;  1I48 A;  4XJO A;  4JF1 A;  2BI3 A;  4WYE A;  3DR4 A;  8AAT A;  1YJY A;  3ZRQ A;  1PG8 A;  4K2B A;  1MLZ A;  3MAU A;  1PFF A;  3N5M A;  1AHY A;  1E5F A;  1MGV A;  4EFF A;  3ELP A;  4I8A A;  4B98 A;  3NU7 A;  4A0H A;  2YHK A;  3AEN B;  4F5G A;  4ZWV A;  4RIZ A;  3W1J A;  3HBX A;  1VEF A;  5E4Z A;  4Y0H A;  1IAY A;  2Z61 A;  2JG2 A;  2AY3 A;  3H7F A;  3NX3 A;  2R2N A;  3PA9 A;  3PAA A;  4JEV A;  1KL2 A;  3RBF A;  1LC5 A;  4N0B A;  3AEM C;  1D2F A;  3MAF B;  4TN4 A;  1CQ7 A;  1WKG A;  1Y4I A;  3HLM A;  1M0P A;  4ZM3 A;  1T3I A;  4RJY A;  3UWC A;  4IYO A;  4JE5 A;  1YJZ A;  4JEY A;  1C9C A;  3B1E A;  4LNM A;  4P7Y A;  1TPL A;  2PO3 A;  4K2I A;  3MKJ A;  4UHM A;  1RV3 A;  3PIU A;  4OC9 A;  3P6K A;  1C7G A;  1WYV B;  2JGT A;  4GE9 A;  4K2M A;  4ZAS A;  2AEV A;  4MQQ A;  1IVR A;  1WYT B;  3FKD A;  1ARH A;  1X2A A;  2D7Z A;  1O61 A;  2VI9 A;  3Q8N A;  4P3M A;  4DQ6 A;  1GD9 A;  1V2D A;  2CJG A;  2E7I A;  2DKJ A;  1GEX A;  1OAT A;  1RV4 A;  2FQ6 A;  4F5H A;  3E2Z A;  4ZWM A;  1WKH A;  2V0Y A;  4EB5 A;  3OKS A;  3JW9 A;  2GQN A;  1C7O A;  2C0R A;  2E7U A;  1ASD A;  1G7X A;  3AEP A;  3WLX A;  4CVQ A;  4BMK A;  2W7I A;  1U08 A;  4XJM A;  2AEU A;  3EUC A;  2AY5 A;  4M2M A;  4IX8 A;  5DB5 A;  3EZS A;  2BWO A; 
#chains in the Genus database with same CATH topology
 3B1C A;  2YCT A;  4ATQ A;  2Z9X A;  1TOJ A;  3MAF A;  5JAY A;  3NNK A;  1XI9 A;  3FFH A;  4WYA A;  3GZD C;  5E5I A;  1BQA A;  3B8X A;  1AJS B;  4IXZ A;  3EZ1 A;  3GWP A;  1N31 A;  5G4I A;  1AJS A;  1DJ9 A;  2ZY3 A;  3BWN A;  4OYT A;  2PB2 A;  3KGW A;  1PMO A;  2VLF A;  1C7N A;  2R5E A;  4OT8 A;  4IXS A;  1MDX A;  1OXO A;  2HUI A;  3BWN C;  5HHY A;  5I92 A;  4WP0 A;  4ZDP A;  2O7C A;  2Z9W A;  2OGA A;  1AHX A;  2BIA A;  3DOD A;  2F8J A;  3FZ7 A;  1IX6 A;  2Z20 A;  4R8D A;  4XJP A;  3VK2 A;  4Q75 A;  3NYS A;  1X29 A;  2FYF A;  4J5U A;  1ARG A;  4RJ0 A;  1KKJ A;  1ASG A;  4ZSW A;  4QGR A;  2CIN A;  3AEM A;  3AEJ A;  4ZDL A;  1IX8 A;  4RLG A;  1ZC9 A;  1ASB A;  4A00 A;  3JTX A;  3FSL A;  1MAP A;  2EPJ A;  3AEJ C;  2DGL A;  3B46 A;  3WKR A;  1UU1 A;  4R2N A;  1VP4 A;  1IAX A;  4KYO A;  1J32 A;  1PMM A;  1B5P A;  1GEY A;  4GEB A;  3E9K A;  4TV7 A;  3COG A;  1CJ0 A;  3L8A A;  5EUE A;  1CZC A;  1GC2 A;  2VMN A;  3PDB A;  2WKA A;  2JJG A;  3BCX A;  1VJO A;  1TOI A;  2D64 A;  4WYD A;  1TAS A;  4E77 A;  2VI8 A;  2D7Y A;  3FZ6 A;  1M6S A;  1LC8 A;  1KMJ A;  1TOG A;  4IW7 A;  1QIS A;  2VMS A;  3DZZ A;  3CQ4 A;  4U2H A;  1UKJ A;  2OQX A;  1H0C A;  2C7T A;  3EI7 A;  1CZE A;  2YKX A;  3E6G A;  2VLH A;  1M32 A;  4RM1 A;  3ZZK A;  3VK3 A;  2JJH A;  2ZSM A;  1DJE A;  1S09 A;  3FVU A;  5F9S A;  1TOE A;  2CH2 A;  1CL1 A;  1IJI A;  4ZSY A;  1AJR A;  3RUY A;  2VMU A;  4PIW A;  2E54 A;  1W23 A;  2W7E A;  1BKG A;  2QSR A;  3M5U A;  3N7N A;  4W91 A;  3N4S A;  2BWN A;  1BJN A;  1DGE A;  2DKB A;  4MQR A;  1I43 A;  1C4K A;  2X8U A;  1FG3 A;  3F0H A;  3N4X A;  1BS0 A;  2YRR A;  2HOX A;  1ECX A;  2W8J A;  3EIB A;  1ASE A;  5G09 A;  4F5L A;  3NYT A;  1S06 A;  4DGT A;  2AY4 A;  4A6T A;  2QB2 A;  2HOR A;  1LK9 A;  2WK9 A;  2GB3 A;  3PD6 B;  4W1X A;  1M7Y A;  2X3L A;  5EUN A;  5HXX A;  5D5S A;  2QA3 A;  3CQ6 A;  5FT4 A;  3IHJ A;  3BCA A;  3ELE A;  1SF2 A;  4WBT A;  4ATP A;  3USF A;  4E3Q A;  1ORD A;  3JWB A;  1TOK A;  2Z1Z A;  4H51 A;  4A0G A;  4WYC A;  2VGT A;  3A8U X;  3P1T A;  4OTL A;  1UU0 A;  3MAD A;  5M46 A;  1IX7 A;  3ISL A;  2VMV A;  1ZOB A;  3G0T A;  2ZY4 A;  1YOO A;  2VMZ A;  4WB0 B;  4EB7 A;  3LVL B;  4ZAH A;  1G7W A;  3VOM A;  4UHO A;  3HL2 A;  2DGM A;  1YIZ A;  4U1T A;  1B9H A;  1M0Q A;  1SPA A;  1O62 A;  2VIA A;  1FC4 A;  1QIT A;  1SZS A;  2E7J A;  1SVV A;  1ASA A;  2FNU A;  2O1B A;  3UE8 A;  1B4X A;  2ZY2 A;  4RKC A;  2DR1 A;  4DBC A;  4LC3 A;  2NMP A;  3HQT A;  4OMA A;  2HP1 A;  3MC6 C;  2GMS A;  3QM2 A;  1YAA A;  1TAR A;  1YNU A;  1ELQ A;  3MC6 A;  3DRD A;  2R5C A;  1QGN A;  5FT8 A;  4WD2 A;  2HOZ A;  4GDY A;  1DKA A;  2YCN A;  3LVK A;  4Q31 A;  4TMR A;  2ZUK A;  2X5F A;  3G8M A;  3A9X A;  3GZC A;  4OCA A;  2AY2 A;  2ZC0 A;  2CJH A;  1AY5 A;  1I41 A;  3TCM A;  1AMS A;  2D5Y A;  3GSB A;  2ZY5 A;  3RBL A;  2BKW A;  3H14 A;  1MLY A;  3ASA A;  3RQ1 A;  4F5K A;  3W1I A;  4MY5 A;  1ARS A;  2C81 A;  2FNI A;  2VMY A;  4AH3 A;  2YOB A;  2CAN A;  1AHE A;  2VGV A;  2ORD A;  2W7J A;  3E2Y A;  5M4D A;  5EAV A;  4CXQ A;  1LW4 A;  4AO4 A;  2FM1 A;  5TF5 A;  3A9Y A;  4UOY A;  3N0L A;  1B9I A;  3VAX A;  3GR9 A;  1GBN A;  2Z67 A;  3AOW A;  3FQ8 A;  4B9B A;  2BI9 A;  4M2J A;  4W1V A;  1WYV A;  4F5F A;  3FQ7 A;  4E1O A;  3HVY A;  1AIA A;  9AAT A;  2PB0 A;  2EO5 A;  3GET A;  4EMY A;  1MAQ A;  3D6K A;  3FDB A;  2CTZ A;  2VMX A;  1GC4 A;  1SZK A;  1W3U A;  2GSA A;  4PFF A;  4XEW A;  4XK1 A;  2OGE A;  5G0A A;  4ITG A;  3ZRR A;  1YIY A;  4UHN A;  5E3K A;  2YRI A;  4XAU A;  3E77 A;  3K40 A;  1S08 A;  5M49 A;  3QI6 A;  4BHD A;  4F4E A;  3PPL A;  4IY7 A;  5LHA A;  2BWP A;  1SZU A;  1BT4 A;  1ASF A;  1D7R A;  2AY8 A;  3B1D A;  2QMA A;  4CBS A;  3FTB A;  3I5T A;  1AAW A;  3E2F A;  5EUD A;  4A0F A;  2BYJ A;  2DGK A;  4GE7 A;  4CBR A;  4EU1 A;  4F5I A;  3DU4 A;  1CQ8 A;  1IBJ A;  4ZM4 A;  4AZK A;  1EG5 A;  1W7M A;  3FZ8 A;  3TAT A;  1DFO A;  1KKP A;  3R4T A;  4KXK A;  3E2Z B;  3QN6 A;  2W7H A;  3AOV A;  1AHF A;  2VIB A;  2W7L A;  1LC7 A;  1BQD A;  3CBF A;  1D7V A;  1W7N A;  4WXG A;  2VMQ A;  2R0T A;  1RVY A;  1AY4 A;  1S07 A;  3NUB A;  3N4R A;  2X5D A;  4N0W A;  3GZD A;  1DJU A;  1JF9 A;  1V2E A;  3DC1 A;  4Q6R A;  3WKS A;  1S0A A;  2CFB A;  1QJ3 A;  3VK4 A;  5M4B A;  3JZL A;  4MGR A;  5AX8 A;  5HDM A;  3VP6 A;  3BC8 A;  1BJW A;  4OBU A;  4MKJ A;  1GCK A;  2FN6 A;  4ZLV A;  1P3W A;  2JIS A;  3IF2 A;  3G7Q A;  4MQP A;  5G4J A;  3NRA A;  1OXP A;  2W7G A;  4L0O A;  1OHW A;  3ACZ A;  2HP2 A;  3A2B A;  1TAT A;  1V2F A;  1YJS A;  3FFR A;  3RCH B;  3KGX A;  3EI9 A;  4ZDO A;  2AAT A;  1ASL A;  4NOG A;  3NYU A;  4A6R A;  4O6Z A;  3EI8 A;  2FKI A;  1KL1 A;  3FCR A;  5DX5 A;  3QBO A;  4WXF A;  2G7J A;  4Y0D A;  3FVX A;  1DGD A;  3FD0 A;  1WYT A;  1AMQ A;  4IXO A;  3ECD A;  2EH6 A;  1JG8 A;  3ZRP A;  2VMO A;  2EZ2 A;  4F5J A;  3QPG A;  2OAT A;  4MKK A;  1B5O A;  1M0O A;  3FDD A;  1AX4 A;  3BS8 A;  4JEZ A;  3EIA A;  1BW0 A;  1OHV A;  3WY7 A;  4FFC A;  4PVF A;  3DR7 A;  2G6W A;  3AV7 A;  5F8V A;  5K8B A;  1UU2 A;  3WCN A;  2AY1 A;  1GC0 A;  2Q7W A;  4XJL A;  1IUG A;  4LNJ A;  2O0R A;  3FQA A;  1O4S A;  1BJO A;  1J04 A;  1G4V A;  3PDB B;  1AIC A;  2W8T A;  2D66 A;  5FT6 A;  4R5F A;  2VMT A;  2W8V A;  4F5M A;  3NTJ A;  4HVK A;  1GC3 A;  4GSA A;  4LW2 A;  2GMU A;  1E5E A;  2YKV A;  5EIG B;  2ZP7 A;  1DTY A;  3DXV A;  1M4N A;  2DOU A;  3KE3 A;  4JF0 A;  4JEW A;  4WXB A;  2QLR A;  2WK7 A;  4PFN A;  3DXW A;  3FRK A;  4Y0I A;  2OKK A;  2W7F A;  1AHG A;  4WYF A;  3JU7 A;  1JS3 A;  1V72 A;  3K7Y A;  2A1V A;  1ARI A;  5DJ1 A;  2W7D A;  3ASB A;  3LVJ A;  5EQC A;  3RI6 A;  2JJF A;  1CL2 A;  1AMA A;  1CS1 A;  1Z7D A;  1ART A;  3F9T A;  5BJ4 A;  4A0R A;  1AKC A;  2EGY A;  4BA5 A;  4W8I A;  2AY7 A;  2QBT A;  2D61 A;  2Z9V A;  1AKA A;  3L44 A;  3WGC A;  1LW5 A;  4CXR A;  2BIG A;  1MDZ A;  1MDO A;  3BWO A;  3DYD A;  4RKD A;  3HT4 A;  4RIT A;  3A9Z A;  3CAI A;  1Z3Z A;  3EI6 A;  2YCP A;  3BB8 A;  1O69 A;  3MBB A;  2Z1Y A;  4FL0 A;  2ZYJ A;  2W8W A;  5EIG A;  4WLJ A;  3ZZJ A;  1W7L A;  1N2T A;  2CST A;  5DJ9 A;  4HF8 A;  1AMR A;  2CH1 A;  1ASN A;  3UAK A;  2VYC A;  2W7K A;  4W1W A;  3GBX A;  1EQB A;  1KMK A;  1BJO B;  3LWS A;  4Q76 A;  2BHX A;  4W5K A;  4UQV A;  1WYU A;  1X0M A;  2EZ1 A;  2XBN A;  3F6T A;  4WYG A;  2OKJ A;  2CB1 A;  1H1C A;  4WB0 A;  3KKI A;  3K28 A;  3PGY A;  4R5Z A;  2D63 A;  4JEX A;  3II0 A;  1QZ9 A;  3OP7 A;  2HUF A;  3WX9 A;  2TPL A;  3FVS A;  4ADB A;  4WLH A;  3WGB A;  1X28 A;  1QJ5 A;  2XH1 A;  1AAM A;  5J8Q A;  1EJI A;  2HZP A;  5IWQ A;  3PJ0 A;  3TQX A;  2D65 A;  2CY8 A;  4ITX A;  2YKY A;  3I4J A;  1OHY A;  2V1P A;  2ZJG A;  7AAT A;  1LKC A;  2JJE A;  3AAT A;  4GE4 A;  2RFV A;  1D7S A;  3GJU A;  2CJD A;  4AOA A;  2AY6 A;  4ADD A;  3LVM A;  1LS3 A;  3TFU A;  5LH9 A;  2VGW A;  3AEO A;  4MSO A;  4GRX A;  3JWA A;  3LG0 A;  3T32 A;  2VMW A;  3NDN A;  4IYO B;  3AEL A;  5EAA A;  2BYL A;  4BQ0 A;  1D7U A;  1ELU A;  3PD6 A;  3CQ5 A;  4AZJ A;  3NUI A;  3EI5 A;  4LW4 A;  2VGU A;  3PDX A;  1ASM A;  1B8G A;  3N75 A;  1M0N A;  2YKU A;  1WST A;  1QIR A;  5FT5 A;  4LNL A;  3BCB A;  4JE5 D;  4KAM A;  1C0N A;  5G2Q A;  4RAE A;  3RCH A;  4AO9 A;  2W7M A;  3WCO A;  2C44 A;  4A6U A;  1XEY A;  1RVU A;  4A72 A;  4ADC A;  2AY9 A;  4XQ2 A;  3BN1 A;  3HDO A;  2BI5 A;  1ZOD A;  2KFP A;  4ISY A;  2VMP A;  4J8L A;  5G2P A;  2BIE A;  3QHX A;  1AIB A;  1FG7 A;  3WZF A;  1WYU B;  1GEW A;  1I29 A;  5C6U A;  2HOY A;  3TFT A;  3H9X A;  2EYQ A;  2VGZ A;  3ATH A;  5D95 A;  1SFF A;  3LV2 A;  2R5C B;  2BI1 A;  3QGU A;  3R9A A;  2HUU A;  5BJ3 A;  2ZSL A;  3AEN A;  2QB3 A;  2BI2 A;  3LY1 A;  1BJ4 A;  1JS6 A;  2VMR A;  3BV0 A;  3I16 A;  1G4X A;  3NU8 A;  2Z9U A;  5EFS A;  1AY8 A;  2VGS A;  2WK8 A;  3HMU A;  3MEB A;  4BA4 A;  4E3R A;  1AKB A;  1CQ6 A;  1GDE A;  4H63 Q;  2W8U A;  3W1H A;  1N8P A;  4M2K A;  2WB6 A;  4ADE A;  4OBV A;  1ASC A;  1I48 A;  4XJO A;  4JF1 A;  2BI3 A;  4WYE A;  4K05 A;  3DR4 A;  8AAT A;  1YJY A;  3ZRQ A;  1PG8 A;  4K2B A;  1MLZ A;  3MAU A;  1PFF A;  3N5M A;  1AHY A;  1E5F A;  1MGV A;  4EFF A;  3ELP A;  4I8A A;  4B98 A;  3NU7 A;  4A0H A;  2YHK A;  3AEN B;  4F5G A;  4ZWV A;  4RIZ A;  3W1J A;  3HBX A;  1VEF A;  5E4Z A;  5KTB A;  4Y0H A;  1IAY A;  2Z61 A;  2JG2 A;  2AY3 A;  3H7F A;  3NX3 A;  2R2N A;  3PA9 A;  3PAA A;  4JEV A;  1KL2 A;  3RBF A;  1LC5 A;  4N0B A;  3AEM C;  1D2F A;  3MAF B;  4TN4 A;  1CQ7 A;  1WKG A;  1Y4I A;  3HLM A;  1M0P A;  4ZM3 A;  1T3I A;  4RJY A;  3UWC A;  4IYO A;  4JE5 A;  1YJZ A;  4JEY A;  1C9C A;  3B1E A;  4LNM A;  4P7Y A;  1TPL A;  2PO3 A;  4K2I A;  3MKJ A;  4UHM A;  1RV3 A;  3PIU A;  4OC9 A;  3P6K A;  1C7G A;  1WYV B;  2JGT A;  4GE9 A;  4K2M A;  4ZAS A;  2AEV A;  4MQQ A;  1IVR A;  1WYT B;  3FKD A;  1ARH A;  1X2A A;  2D7Z A;  1O61 A;  2VI9 A;  3Q8N A;  4P3M A;  4DQ6 A;  1GD9 A;  1V2D A;  2CJG A;  2E7I A;  2DKJ A;  1GEX A;  1OAT A;  1RV4 A;  2FQ6 A;  4F5H A;  3E2Z A;  4ZWM A;  1WKH A;  2V0Y A;  4EB5 A;  3OKS A;  3JW9 A;  2GQN A;  1C7O A;  2C0R A;  1KAF A;  2E7U A;  1ASD A;  1G7X A;  3AEP A;  3WLX A;  4CVQ A;  4BMK A;  2W7I A;  1U08 A;  4XJM A;  2AEU A;  3EUC A;  2AY5 A;  4M2M A;  4IX8 A;  5DB5 A;  3EZS A;  2BWO A; 
#chains in the Genus database with same CATH homology
 3B1C A;  2YCT A;  4ATQ A;  2Z9X A;  1TOJ A;  3MAF A;  5JAY A;  3NNK A;  1XI9 A;  3FFH A;  4WYA A;  3GZD C;  5E5I A;  1BQA A;  3B8X A;  1AJS B;  4IXZ A;  3EZ1 A;  3GWP A;  1N31 A;  5G4I A;  1AJS A;  1DJ9 A;  2ZY3 A;  3BWN A;  4OYT A;  2PB2 A;  3KGW A;  1PMO A;  2VLF A;  1C7N A;  2R5E A;  4OT8 A;  4IXS A;  1MDX A;  1OXO A;  2HUI A;  3BWN C;  5HHY A;  5I92 A;  4WP0 A;  4ZDP A;  2O7C A;  2Z9W A;  2OGA A;  1AHX A;  2BIA A;  3DOD A;  2F8J A;  3FZ7 A;  1IX6 A;  2Z20 A;  4R8D A;  4XJP A;  3VK2 A;  4Q75 A;  3NYS A;  1X29 A;  2FYF A;  4J5U A;  1ARG A;  4RJ0 A;  1KKJ A;  1ASG A;  4ZSW A;  4QGR A;  2CIN A;  3AEM A;  3AEJ A;  4ZDL A;  1IX8 A;  4RLG A;  1ZC9 A;  1ASB A;  4A00 A;  3JTX A;  3FSL A;  1MAP A;  2EPJ A;  3AEJ C;  2DGL A;  3B46 A;  3WKR A;  1UU1 A;  4R2N A;  1VP4 A;  1IAX A;  4KYO A;  1J32 A;  1PMM A;  1B5P A;  1GEY A;  4GEB A;  3E9K A;  4TV7 A;  3COG A;  1CJ0 A;  3L8A A;  5EUE A;  1CZC A;  1GC2 A;  2VMN A;  3PDB A;  2WKA A;  2JJG A;  3BCX A;  1VJO A;  1TOI A;  2D64 A;  4WYD A;  1TAS A;  4E77 A;  2VI8 A;  2D7Y A;  3FZ6 A;  1M6S A;  1LC8 A;  1KMJ A;  1TOG A;  4IW7 A;  1QIS A;  2VMS A;  3DZZ A;  3CQ4 A;  4U2H A;  1UKJ A;  2OQX A;  1H0C A;  2C7T A;  3EI7 A;  1CZE A;  2YKX A;  3E6G A;  2VLH A;  1M32 A;  4RM1 A;  3ZZK A;  3VK3 A;  2JJH A;  2ZSM A;  1DJE A;  1S09 A;  3FVU A;  5F9S A;  1TOE A;  2CH2 A;  1CL1 A;  1IJI A;  4ZSY A;  1AJR A;  3RUY A;  2VMU A;  4PIW A;  2E54 A;  1W23 A;  2W7E A;  1BKG A;  2QSR A;  3M5U A;  3N7N A;  4W91 A;  3N4S A;  2BWN A;  1BJN A;  1DGE A;  2DKB A;  4MQR A;  1I43 A;  1C4K A;  2X8U A;  1FG3 A;  3F0H A;  3N4X A;  1BS0 A;  2YRR A;  2HOX A;  1ECX A;  2W8J A;  3EIB A;  1ASE A;  5G09 A;  4F5L A;  3NYT A;  1S06 A;  4DGT A;  2AY4 A;  4A6T A;  2QB2 A;  2HOR A;  1LK9 A;  2WK9 A;  2GB3 A;  3PD6 B;  4W1X A;  1M7Y A;  2X3L A;  5EUN A;  5HXX A;  5D5S A;  2QA3 A;  3CQ6 A;  5FT4 A;  3IHJ A;  3BCA A;  3ELE A;  1SF2 A;  4WBT A;  4ATP A;  3USF A;  4E3Q A;  1ORD A;  3JWB A;  1TOK A;  2Z1Z A;  4H51 A;  4A0G A;  4WYC A;  2VGT A;  3A8U X;  3P1T A;  4OTL A;  1UU0 A;  3MAD A;  5M46 A;  1IX7 A;  3ISL A;  2VMV A;  1ZOB A;  3G0T A;  2ZY4 A;  1YOO A;  2VMZ A;  4WB0 B;  4EB7 A;  3LVL B;  4ZAH A;  1G7W A;  3VOM A;  4UHO A;  3HL2 A;  2DGM A;  1YIZ A;  4U1T A;  1B9H A;  1M0Q A;  1SPA A;  1O62 A;  2VIA A;  1FC4 A;  1QIT A;  1SZS A;  2E7J A;  1SVV A;  1ASA A;  2FNU A;  2O1B A;  3UE8 A;  1B4X A;  2ZY2 A;  4RKC A;  2DR1 A;  4DBC A;  4LC3 A;  2NMP A;  3HQT A;  4OMA A;  2HP1 A;  3MC6 C;  2GMS A;  3QM2 A;  1YAA A;  1TAR A;  1YNU A;  1ELQ A;  3MC6 A;  3DRD A;  2R5C A;  1QGN A;  5FT8 A;  4WD2 A;  2HOZ A;  4GDY A;  1DKA A;  2YCN A;  3LVK A;  4Q31 A;  4TMR A;  2ZUK A;  2X5F A;  3G8M A;  3A9X A;  3GZC A;  4OCA A;  2AY2 A;  2ZC0 A;  2CJH A;  1AY5 A;  1I41 A;  3TCM A;  1AMS A;  2D5Y A;  3GSB A;  2ZY5 A;  3RBL A;  2BKW A;  3H14 A;  1MLY A;  3ASA A;  3RQ1 A;  4F5K A;  3W1I A;  4MY5 A;  1ARS A;  2C81 A;  2FNI A;  2VMY A;  4AH3 A;  2YOB A;  2CAN A;  1AHE A;  2VGV A;  2ORD A;  2W7J A;  3E2Y A;  5M4D A;  5EAV A;  4CXQ A;  1LW4 A;  4AO4 A;  2FM1 A;  5TF5 A;  3A9Y A;  4UOY A;  3N0L A;  1B9I A;  3VAX A;  3GR9 A;  1GBN A;  2Z67 A;  3AOW A;  3FQ8 A;  4B9B A;  2BI9 A;  4M2J A;  4W1V A;  1WYV A;  4F5F A;  3FQ7 A;  4E1O A;  3HVY A;  1AIA A;  9AAT A;  2PB0 A;  2EO5 A;  3GET A;  4EMY A;  1MAQ A;  3D6K A;  3FDB A;  2CTZ A;  2VMX A;  1GC4 A;  1SZK A;  1W3U A;  2GSA A;  4PFF A;  4XEW A;  4XK1 A;  2OGE A;  5G0A A;  4ITG A;  3ZRR A;  1YIY A;  4UHN A;  5E3K A;  2YRI A;  4XAU A;  3E77 A;  3K40 A;  1S08 A;  5M49 A;  3QI6 A;  4BHD A;  4F4E A;  3PPL A;  4IY7 A;  5LHA A;  2BWP A;  1SZU A;  1BT4 A;  1ASF A;  1D7R A;  2AY8 A;  3B1D A;  2QMA A;  4CBS A;  3FTB A;  3I5T A;  1AAW A;  3E2F A;  5EUD A;  4A0F A;  2BYJ A;  2DGK A;  4GE7 A;  4CBR A;  4EU1 A;  4F5I A;  3DU4 A;  1CQ8 A;  1IBJ A;  4ZM4 A;  4AZK A;  1EG5 A;  1W7M A;  3FZ8 A;  3TAT A;  1DFO A;  1KKP A;  3R4T A;  4KXK A;  3E2Z B;  3QN6 A;  2W7H A;  3AOV A;  1AHF A;  2VIB A;  2W7L A;  1LC7 A;  1BQD A;  3CBF A;  1D7V A;  1W7N A;  4WXG A;  2VMQ A;  2R0T A;  1RVY A;  1AY4 A;  1S07 A;  3NUB A;  3N4R A;  2X5D A;  4N0W A;  3GZD A;  1DJU A;  1JF9 A;  1V2E A;  3DC1 A;  4Q6R A;  3WKS A;  1S0A A;  2CFB A;  1QJ3 A;  3VK4 A;  5M4B A;  3JZL A;  4MGR A;  5AX8 A;  5HDM A;  3VP6 A;  3BC8 A;  1BJW A;  4OBU A;  4MKJ A;  1GCK A;  2FN6 A;  4ZLV A;  1P3W A;  2JIS A;  3IF2 A;  3G7Q A;  4MQP A;  5G4J A;  3NRA A;  1OXP A;  2W7G A;  4L0O A;  1OHW A;  3ACZ A;  2HP2 A;  3A2B A;  1TAT A;  1V2F A;  1YJS A;  3FFR A;  3RCH B;  3KGX A;  3EI9 A;  4ZDO A;  2AAT A;  1ASL A;  4NOG A;  3NYU A;  4A6R A;  4O6Z A;  3EI8 A;  2FKI A;  1KL1 A;  3FCR A;  5DX5 A;  3QBO A;  4WXF A;  2G7J A;  4Y0D A;  3FVX A;  1DGD A;  3FD0 A;  1WYT A;  1AMQ A;  4IXO A;  3ECD A;  2EH6 A;  1JG8 A;  3ZRP A;  2VMO A;  2EZ2 A;  4F5J A;  3QPG A;  2OAT A;  4MKK A;  1B5O A;  1M0O A;  3FDD A;  1AX4 A;  3BS8 A;  4JEZ A;  3EIA A;  1BW0 A;  1OHV A;  3WY7 A;  4FFC A;  4PVF A;  3DR7 A;  2G6W A;  3AV7 A;  5F8V A;  5K8B A;  1UU2 A;  3WCN A;  2AY1 A;  1GC0 A;  2Q7W A;  4XJL A;  1IUG A;  4LNJ A;  2O0R A;  3FQA A;  1O4S A;  1BJO A;  1J04 A;  1G4V A;  3PDB B;  1AIC A;  2W8T A;  2D66 A;  5FT6 A;  4R5F A;  2VMT A;  2W8V A;  4F5M A;  3NTJ A;  4HVK A;  1GC3 A;  4GSA A;  4LW2 A;  2GMU A;  1E5E A;  2YKV A;  5EIG B;  2ZP7 A;  1DTY A;  3DXV A;  1M4N A;  2DOU A;  3KE3 A;  4JF0 A;  4JEW A;  4WXB A;  2QLR A;  2WK7 A;  4PFN A;  3DXW A;  3FRK A;  4Y0I A;  2OKK A;  2W7F A;  1AHG A;  4WYF A;  3JU7 A;  1JS3 A;  1V72 A;  3K7Y A;  2A1V A;  1ARI A;  5DJ1 A;  2W7D A;  3ASB A;  3LVJ A;  5EQC A;  3RI6 A;  2JJF A;  1CL2 A;  1AMA A;  1CS1 A;  1Z7D A;  1ART A;  3F9T A;  5BJ4 A;  4A0R A;  1AKC A;  2EGY A;  4BA5 A;  4W8I A;  2AY7 A;  2QBT A;  2D61 A;  2Z9V A;  1AKA A;  3L44 A;  3WGC A;  1LW5 A;  4CXR A;  2BIG A;  1MDZ A;  1MDO A;  3BWO A;  3DYD A;  4RKD A;  3HT4 A;  4RIT A;  3A9Z A;  3CAI A;  1Z3Z A;  3EI6 A;  2YCP A;  3BB8 A;  1O69 A;  3MBB A;  2Z1Y A;  4FL0 A;  2ZYJ A;  2W8W A;  5EIG A;  4WLJ A;  3ZZJ A;  1W7L A;  1N2T A;  2CST A;  5DJ9 A;  4HF8 A;  1AMR A;  2CH1 A;  1ASN A;  3UAK A;  2VYC A;  2W7K A;  4W1W A;  3GBX A;  1EQB A;  1KMK A;  1BJO B;  3LWS A;  4Q76 A;  2BHX A;  4W5K A;  4UQV A;  1WYU A;  1X0M A;  2EZ1 A;  2XBN A;  3F6T A;  4WYG A;  2OKJ A;  2CB1 A;  1H1C A;  4WB0 A;  3KKI A;  3K28 A;  3PGY A;  4R5Z A;  2D63 A;  4JEX A;  3II0 A;  1QZ9 A;  3OP7 A;  2HUF A;  3WX9 A;  2TPL A;  3FVS A;  4ADB A;  4WLH A;  3WGB A;  1X28 A;  1QJ5 A;  2XH1 A;  1AAM A;  5J8Q A;  1EJI A;  2HZP A;  5IWQ A;  3PJ0 A;  3TQX A;  2D65 A;  2CY8 A;  4ITX A;  2YKY A;  3I4J A;  1OHY A;  2V1P A;  2ZJG A;  7AAT A;  1LKC A;  2JJE A;  3AAT A;  4GE4 A;  2RFV A;  1D7S A;  3GJU A;  2CJD A;  4AOA A;  2AY6 A;  4ADD A;  3LVM A;  1LS3 A;  3TFU A;  5LH9 A;  2VGW A;  3AEO A;  4MSO A;  4GRX A;  3JWA A;  3LG0 A;  3T32 A;  2VMW A;  3NDN A;  4IYO B;  3AEL A;  5EAA A;  2BYL A;  4BQ0 A;  1D7U A;  1ELU A;  3PD6 A;  3CQ5 A;  4AZJ A;  3NUI A;  3EI5 A;  4LW4 A;  2VGU A;  3PDX A;  1ASM A;  1B8G A;  3N75 A;  1M0N A;  2YKU A;  1WST A;  1QIR A;  5FT5 A;  4LNL A;  3BCB A;  4JE5 D;  4KAM A;  1C0N A;  5G2Q A;  4RAE A;  3RCH A;  4AO9 A;  2W7M A;  3WCO A;  2C44 A;  4A6U A;  1XEY A;  1RVU A;  4A72 A;  4ADC A;  2AY9 A;  4XQ2 A;  3BN1 A;  3HDO A;  2BI5 A;  1ZOD A;  2KFP A;  4ISY A;  2VMP A;  4J8L A;  5G2P A;  2BIE A;  3QHX A;  1AIB A;  1FG7 A;  3WZF A;  1WYU B;  1GEW A;  1I29 A;  5C6U A;  2HOY A;  3TFT A;  3H9X A;  2EYQ A;  2VGZ A;  3ATH A;  5D95 A;  1SFF A;  3LV2 A;  2R5C B;  2BI1 A;  3QGU A;  3R9A A;  2HUU A;  5BJ3 A;  2ZSL A;  3AEN A;  2QB3 A;  2BI2 A;  3LY1 A;  1BJ4 A;  1JS6 A;  2VMR A;  3BV0 A;  3I16 A;  1G4X A;  3NU8 A;  2Z9U A;  5EFS A;  1AY8 A;  2VGS A;  2WK8 A;  3HMU A;  3MEB A;  4BA4 A;  4E3R A;  1AKB A;  1CQ6 A;  1GDE A;  4H63 Q;  2W8U A;  3W1H A;  1N8P A;  4M2K A;  2WB6 A;  4ADE A;  4OBV A;  1ASC A;  1I48 A;  4XJO A;  4JF1 A;  2BI3 A;  4WYE A;  4K05 A;  3DR4 A;  8AAT A;  1YJY A;  3ZRQ A;  1PG8 A;  4K2B A;  1MLZ A;  3MAU A;  1PFF A;  3N5M A;  1AHY A;  1E5F A;  1MGV A;  4EFF A;  3ELP A;  4I8A A;  4B98 A;  3NU7 A;  4A0H A;  2YHK A;  3AEN B;  4F5G A;  4ZWV A;  4RIZ A;  3W1J A;  3HBX A;  1VEF A;  5E4Z A;  5KTB A;  4Y0H A;  1IAY A;  2Z61 A;  2JG2 A;  2AY3 A;  3H7F A;  3NX3 A;  2R2N A;  3PA9 A;  3PAA A;  4JEV A;  1KL2 A;  3RBF A;  1LC5 A;  4N0B A;  3AEM C;  1D2F A;  3MAF B;  4TN4 A;  1CQ7 A;  1WKG A;  1Y4I A;  3HLM A;  1M0P A;  4ZM3 A;  1T3I A;  4RJY A;  3UWC A;  4IYO A;  4JE5 A;  1YJZ A;  4JEY A;  1C9C A;  3B1E A;  4LNM A;  4P7Y A;  1TPL A;  2PO3 A;  4K2I A;  3MKJ A;  4UHM A;  1RV3 A;  3PIU A;  4OC9 A;  3P6K A;  1C7G A;  1WYV B;  2JGT A;  4GE9 A;  4K2M A;  4ZAS A;  2AEV A;  4MQQ A;  1IVR A;  1WYT B;  3FKD A;  1ARH A;  1X2A A;  2D7Z A;  1O61 A;  2VI9 A;  3Q8N A;  4P3M A;  4DQ6 A;  1GD9 A;  1V2D A;  2CJG A;  2E7I A;  2DKJ A;  1GEX A;  1OAT A;  1RV4 A;  2FQ6 A;  4F5H A;  3E2Z A;  4ZWM A;  1WKH A;  2V0Y A;  4EB5 A;  3OKS A;  3JW9 A;  2GQN A;  1C7O A;  2C0R A;  2E7U A;  1ASD A;  1G7X A;  3AEP A;  3WLX A;  4CVQ A;  4BMK A;  2W7I A;  1U08 A;  4XJM A;  2AEU A;  3EUC A;  2AY5 A;  4M2M A;  4IX8 A;  5DB5 A;  3EZS A;  2BWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...