2Z1ZA

Crystal structure of ll-diaminopimelate aminotransferase from arabidopsis thaliana complexed with l-malate ion
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
408
structure length
408
Chain Sequence
EYKTKVSRNSNMSKLQAGYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHRENILEACRRFKQLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LL-diaminopimelate aminotransferase
publication title Crystal structure of LL-diaminopimelate aminotransferase from Arabidopsis thaliana: a recently discovered enzyme in the biosynthesis of L-lysine by plants and Chlamydia
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase
total genus 145
structure length 408
sequence length 408
chains with identical sequence B
ec nomenclature ec 2.6.1.83: LL-diaminopimelate aminotransferase.
pdb deposition date 2007-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2z1zA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2z1zA01
2FNIA 5M49A 1GC2A 2D5YA 4IYOB 1ECXA 4ZASA 3AEJA 4CBRA 3WZFA 3AOWA 3BN1A 4LNJA 1ZOBA 4WB0A 4AO4A 4PIWA 2CJHA 1J04A 1MDXA 4UOYA 5DB5A 1JG8A 1T3IA 4CXQA 3W1IA 2QB2A 1N2TA 3EI5A 3JZLA 4ITXA 5LH9A 1VP4A 4ADBA 4U2HA 1DJEA 1TOEA 5M46A 3EZ1A 3K28A 2AEVA 3E2FA 1X29A 4IYOA 4TMRA 4U1TA 3H14A 2WKAA 3L44A 1OHWA 2VMUA 4KYOA 1M0PA 2QA3A 3PAAA 4R5FA 1AY5A 2W7JA 3LWSA 4N0WA 2AY8A 1M0OA 4BQ0A 2OGAA 1N31A 1S08A 1LK9A 1SZUA 2W8JA 3FVSA 2ORDA 4IXOA 3RI6A 1H1CA 2EPJA 1U08A 5E5IA 2FN6A 2JG2A 2GMSA 1C7GA 3G7QA 4WYAA 3DYDA 3P6KA 2E7IA 2BIAA 3MC6C 1VJOA 3WLXA 1JF9A 2RFVA 3JWBA 1BT4A 1TPLA 2D63A 4WD2A 2WK8A 1S07A 5IWQA 1B5OA 2R5CB 3L8AA 4OCAA 1OXOA 1WYUB 2D61A 2W7DA 2Z9WA 3TCMA 5DJ1A 1SF2A 3DC1A 1YJYA 1ASNA 4TN4A 2Z1ZA 4EU1A 1WKHA 4F5HA 2D7ZA 1AIBA 1ARTA 4MQRA 4MKKA 4WLHA 4RLGA 4F5FA 3A2BA 1WYVB 3BCAA 1P3WA 1S06A 3GZCA 5D5SA 2R5CA 2VGZA 4XJLA 5D95A 5EUEA 1QITA 1UU1A 1CQ7A 2BI2A 2HOYA 3GZDC 4IXSA 5EUDA 2E7JA 3E9KA 2JJEA 1ASDA 1WYVA 2QB3A 2VMNA 2BKWA 2VGSA 3B8XA 3M5UA 3I5TA 3CQ4A 4JEZA 5G09A 4F5GA 3MAUA 4BMKA 2W7HA 2E54A 1TOJA 3TQXA 5EAAA 1ASAA 3NYSA 1C7NA 1AAWA 1D7VA 1MAPA 3EZSA 4O6ZA 3BWNA 4Q75A 5FT6A 1KMKA 4P7YA 1ARIA 4ZM4A 3FD0A 3K7YA 3AEPA 4MQPA 3FDDA 3HLMA 1W23A 3AEOA 2CSTA 1EQBA 4RKDA 2ZSLA 2CJDA 1ASCA 3RQ1A 4LW2A 4MSOA 4OMAA 1OHVA 4RJYA 1J32A 3PDBB 4UHOA 2CANA 2Z1YA 3AEMC 3FVXA 3E2YA 3NYTA 3BCXA 1ZC9A 4I8AA 1ARHA 2VIBA 2R2NA 2VMOA 3NTJA 3QI6A 4AZKA 1AHXA 2ZUKA 1PG8A 4JF0A 1E5FA 1M6SA 2C81A 4MQQA 4WP0A 3EI9A 3FZ7A 7AATA 3FZ6A 3PPLA 4JF1A 3FQ8A 3I16A 4OBVA 1BKGA 3I4JA 1AMAA 1QJ5A 1AKAA 4ATQA 3PDBA 4B98A 1BJOA 3ELPA 1M7YA 2W7FA 4MGRA 2CH2A 5HDMA 2QLRA 3KKIA 2ZY4A 2AATA 2AY4A 3QN6A 1TARA 2HZPA 1FG3A 3VP6A 2Z9XA 3ECDA 1D7SA 1CS1A 1YAAA 5DJ9A 3GZDA 4A0FA 3DRDA 2D7YA 3GBXA 3MAFA 2HP2A 3KGXA 1CJ0A 1QISA 3LVLB 3COGA 4M2KA 1D2FA 3LY1A 4GSAA 4WYEA 4E77A 3RCHB 5E4ZA 4K2BA 4OC9A 2ZY2A 1SPAA 3NUBA 2JJGA 3GJUA 1B9IA 2GMUA 4Y0IA 3T32A 2VMQA 3FCRA 2CH1A 1B8GA 3HVYA 3W1JA 5BJ4A 1YJZA 2JISA 3UE8A 2HP1A 3RCHA 3FTBA 2FM1A 4IX8A 3WKSA 4JE5D 1YOOA 2XH1A 3TFUA 3D6KA 2CFBA 2VI8A 1ARGA 1IX7A 1AHFA 2BI5A 3CQ5A 4ITGA 4AZJA 3PIUA 1Z3ZA 3OP7A 4ZSWA 1AJRA 3RBFA 1UU2A 4ADCA 1KKPA 3ZZKA 1OXPA 2VMSA 3A9XA 3QBOA 1D7UA 2VI9A 1LW5A 3NUIA 2VMVA 3BC8A 4CBSA 3AATA 2VGUA 2PO3A 4JE5A 1LS3A 4W1XA 3TFTA 4MY5A 3QM2A 1ORDA 4Y0HA 5G4JA 3DR7A 4A6RA 1IX8A 4OTLA 1BS0A 2D66A 3E2ZB 4RAEA 5F8VA 1ARSA 2CTZA 3ATHA 4JEYA 4F5IA 1WSTA 4R5ZA 2GSAA 5LHAA 1YNUA 3ZZJA 3HT4A 3WCNA 5J8QA 3FDBA 1GCKA 2O0RA 1M4NA 1IJIA 1D7RA 1G4VA 4EB5A 1PMOA 2AY2A 2VGTA 4OT8A 1O61A 4XAUA 1DKAA 1I29A 3HMUA 3JTXA 1DGDA 2DKJA 3E2ZA 4FL0A 4ISYA 2VGVA 3NDNA 4RITA 2VMWA 1LW4A 4AO9A 2O7CA 2C7TA 1IUGA 4IW7A 4DQ6A 1B9HA 1LKCA 1G4XA 2QMAA 2R0TA 1C0NA 1BQAA 1XEYA 2W7LA 4WBTA 1IVRA 4Q31A 1Y4IA 4WYCA 2VMTA 3VK3A 2YCNA 3A9ZA 2D64A 1GEWA 2VYCA 2YRIA 2Z67A 2ZSMA 1GEYA 3JW9A 4EB7A 2AY3A 1BJ4A 3FKDA 4RKCA 2BI3A 1AKBA 1DFOA 3MADA 2DGKA 1BJWA 5AX8A 3G0TA 2OKJA 4ZWVA 1QGNA 3FFHA 4PFNA 1MLYA 2YKUA 3DXWA 3EUCA 3AOVA 4BA4A 2W8VA 2BIGA 1I43A 1ASMA 1IAYA 3FZ8A 4Q6RA 3CQ6A 2YKVA 3N75A 3PDXA 1SFFA 2YKYA 1GD9A 2Z9UA 1M32A 2Z20A 3ASAA 2Q7WA 1V2EA 4LW4A 1JS6A 2VLFA 1JS3A 1RVUA 3ASBA 1I41A 4F5MA 3Q8NA 2YHKA 1ZODA 5K8BA 3HBXA 4CXRA 1AMSA 5DX5A 4ZDOA 3MEBA 3HQTA 4W91A 1AHYA 4M2JA 1C7OA 1CQ8A 1CL2A 3MC6A 2BWPA 2ZYJA 2W7MA 3F9TA 1FC4A 3B46A 1BJOB 1GEXA 1TOGA 2FYFA 4W5KA 5F9SA 1TASA 2BWOA 2V0YA 1O69A 1SZSA 1TOKA 4P3MA 5EQCA 4AOAA 1G7XA 4M2MA 4JEWA 2AY6A 2PB0A 3NNKA 4KAMA 3RBLA 4A0RA 3A8UX 4ZM3A 2VIAA 1LC7A 4A72A 2HUFA 3DXVA 2AY7A 3MAFB 1C4KA 4DBCA 4E1OA 1XI9A 2X5DA 1ASGA 8AATA 2VMPA 3VOMA 4F5LA 3EIBA 5C6UA 4A0HA 2Z61A 2VMXA 1W7MA 3FVUA 3W1HA 1YJSA 4WLJA 4F5JA 1KL2A 3A9YA 1YIYA 1B5PA 3DU4A 4W1WA 2AY1A 3B1DA 1ASEA 5EFSA 1MGVA 1TOIA 2EGYA 3PGYA 4K2IA 9AATA 1AMQA 5HXXA 4Q76A 2HORA 2FQ6A 3IF2A 3LVKA 4IXZA 1M0NA 3BV0A 1BW0A 4K2MA 3UAKA 1YIZA 1KL1A 2W7KA 2Z9VA 2GB3A 2DGLA 3JWAA 1GBNA 3EI6A 1H0CA 3DR4A 4LC3A 2NMPA 1AHEA 2ZY3A 1X0MA 4W1VA 1KMJA 4B9BA 2WK9A 4ADEA 3P1TA 3AEMA 2EH6A 2WK7A 4ADDA 1W7NA 2ZJGA 2BYLA 3H7FA 4OYTA 4LNMA 4N0BA 1UU0A 1V72A 3EI7A 2W7IA 4ATPA 4WXFA 3BWOA 3WX9A 4LNLA 1B4XA 4WYDA 4GE7A 2PB2A 2D65A 1MAQA 5HHYA 3ACZA 3VAXA 1DTYA 3BS8A 4KXKA 1ELUA 3GSBA 3LVJA 3FQAA 5FT4A 4A6TA 2EZ1A 4TV7A 3E6GA 3UWCA 2EO5A 4PFFA 1O4SA 3OKSA 2BIEA 4GEBA 2GQNA 3ELEA 5FT5A 4BHDA 5JAYA 1LC5A 4GE4A 3G8MA 4ZLVA 5I92A 4XQ2A 4AH3A 2OKKA 3FRKA 1MLZA 3F6TA 2JJHA 3GWPA 1RVYA 4Y0DA 1AICA 4EFFA 1KKJA 4QGRA 3LG0A 1X28A 4WYGA 1MDZA 1W7LA 1AX4A 4WYFA 1TATA 1C9CA 4HF8A 3QGUA 1OATA 1UKJA 1IAXA 2DR1A 4ZSYA 3BWNC 2CY8A 2V1PA 3RUYA 1ASFA 2TPLA 1SZKA 2YKXA 3BCBA 3II0A 4XEWA 2X3LA 2G6WA 3ZRRA 3TATA 3DODA 1S09A 2HUIA 1AMRA 5E3KA 5M4BA 3E77A 3NU8A 4WXGA 2DKBA 3WGBA 1GC3A 2HOZA 5EAVA 3F0HA 5FT8A 1I48A 4IY7A 4ZDLA 3VK2A 5G4IA 1OHYA 3GETA 2ZY5A 3R9AA 3PD6B 1S0AA 2FNUA 4E3QA 4UHNA 2ZC0A 2BHXA 3GR9A 3LV2A 3NYUA 4GRXA 1WYTB 1RV4A 2VGWA 1MDOA 2OGEA 2W8WA 4H51A 4UHMA 4A00A 1BQDA 2ZP7A 2XBNA 4XJPA 2JJFA 3EI8A 2QBTA 2X8UA 2DGMA 1V2FA 1BJNA 2R5EA 1PFFA 3AELA 3PD6A 3HL2A 3BB8A 2BYJA 1DJUA 1WYUA 5TF5A 1QZ9A 4R2NA 4HVKA 2F8JA 1WYTA 1O62A 1DGEA 2E7UA 3WCOA 2YRRA 2W8TA 1LC8A 2BWNA 1PMMA 1Z7DA 2VLHA 1DJ9A 1RV3A 3N0LA 3PJ0A 3VK4A 4L0OA 1N8PA 2AY9A 2EZ2A 3AV7A 3EIAA 1EJIA 4OBUA 1AJSB 1W3UA 4RM1A 3NU7A 4ZAHA 3AENB 3ZRPA 1CZCA 1WKGA 2YCTA 1QIRA 1IX6A 2DOUA 2C0RA 3NRAA 4XJMA 1IBJA 4R8DA 2HOXA 2VMYA 2YOBA 1GDEA 1E5EA 5BJ3A 3QHXA 4UQVA 3AEJC 3QPGA 2C44A 2YCPA 4WXBA 2VMZA 1V2DA 1AJSA 1AY4A 1AKCA 3AENA 3JU7A 4F5KA 3R4TA 4CVQA 5EIGB 1AHGA 1ELQA 3KE3A 1VEFA 4ZDPA 4GE9A 4MKJA 2OATA 2W7EA 3MKJA 1AAMA 4GDYA 1FG7A 3IHJA 3ISLA 4A6UA 4DGTA 3DZZA 1QJ3A 2X5FA 2W8UA 3B1EA 5EUNA 3CBFA 1X2AA 5G0AA 4PVFA 5G2QA 4NOGA 4XJOA 4BA5A 3B1CA 4RJ0A 5EIGA 2JGTA 4E3RA 1ASLA 2W7GA 4ZWMA 4JEVA 4J5UA 1ASBA 4RIZA 4XK1A 1AY8A 2HUUA 3PA9A 4EMYA 3WKRA 1EG5A 2BI1A 2CINA 3CAIA 1CZEA 3N5MA 1GC4A 2CB1A 2AEUA 3K40A 3USFA 4F4EA 5M4DA 4W8IA 3FFRA 3MBBA 2OQXA 3WGCA 4WB0B 3ZRQA 2CJGA 1SVVA 4A0GA 2BI9A 4J8LA 3LVMA 3HDOA 2AY5A 3KGWA 1GC0A 3NX3A 4JEXA 3WY7A 1CQ6A 1G7WA 1AIAA 3FSLA 1M0QA 1CL1A 5G2PA 2VMRA 4FFCA 3FQ7A 2O1BA
chains in the Genus database with same CATH superfamily
2FNIA 5M49A 1GC2A 2D5YA 4IYOB 1ECXA 4ZASA 3AEJA 4CBRA 3WZFA 3AOWA 3BN1A 4LNJA 1ZOBA 4WB0A 4AO4A 4PIWA 2CJHA 1J04A 1MDXA 4UOYA 5DB5A 1JG8A 1T3IA 4CXQA 3W1IA 2QB2A 1N2TA 3EI5A 3JZLA 4ITXA 5LH9A 1VP4A 4ADBA 4U2HA 1DJEA 1TOEA 5M46A 3EZ1A 3K28A 2AEVA 3E2FA 1X29A 4IYOA 4TMRA 4U1TA 3H14A 2WKAA 3L44A 1OHWA 2VMUA 4KYOA 1M0PA 2QA3A 3PAAA 4R5FA 1AY5A 2W7JA 3LWSA 4N0WA 2AY8A 2G7JA 1M0OA 4BQ0A 2OGAA 1N31A 1S08A 1LK9A 1SZUA 2W8JA 3FVSA 2ORDA 4IXOA 3RI6A 1H1CA 2EPJA 1U08A 5E5IA 2FN6A 2JG2A 2GMSA 1C7GA 3G7QA 4WYAA 3DYDA 3P6KA 2E7IA 2BIAA 3N4XA 3MC6C 1VJOA 3WLXA 1JF9A 2RFVA 3JWBA 1BT4A 1TPLA 2D63A 4WD2A 2WK8A 1S07A 5IWQA 1B5OA 2R5CB 3L8AA 4OCAA 1OXOA 1WYUB 2D61A 2W7DA 2Z9WA 3TCMA 5DJ1A 1SF2A 3DC1A 1YJYA 1ASNA 4TN4A 2Z1ZA 4EU1A 1WKHA 4F5HA 2D7ZA 1AIBA 1ARTA 4MQRA 4MKKA 4WLHA 4RLGA 4F5FA 3A2BA 1WYVB 3BCAA 1P3WA 1S06A 3GZCA 5D5SA 2R5CA 2VGZA 4XJLA 5D95A 5EUEA 1QITA 1UU1A 1CQ7A 2BI2A 2HOYA 3GZDC 4IXSA 5EUDA 2E7JA 3E9KA 2JJEA 1ASDA 1WYVA 2QB3A 2VMNA 2BKWA 2VGSA 3B8XA 3M5UA 3I5TA 3CQ4A 4JEZA 5G09A 4F5GA 3MAUA 4BMKA 2W7HA 2E54A 1TOJA 3TQXA 5EAAA 1ASAA 3NYSA 1C7NA 1AAWA 1D7VA 1MAPA 3EZSA 4O6ZA 3BWNA 4Q75A 5FT6A 1KMKA 4P7YA 1ARIA 4ZM4A 3FD0A 3K7YA 3AEPA 4MQPA 3FDDA 3HLMA 1W23A 3AEOA 2CSTA 1EQBA 4RKDA 2ZSLA 2CJDA 1ASCA 4K05A 3RQ1A 4LW2A 4MSOA 4OMAA 1OHVA 4RJYA 1J32A 3PDBB 4UHOA 2CANA 2Z1YA 3AEMC 3FVXA 3E2YA 3NYTA 3BCXA 1ZC9A 4I8AA 1ARHA 2VIBA 2R2NA 2VMOA 3NTJA 3QI6A 4AZKA 1AHXA 2ZUKA 1PG8A 4JF0A 1E5FA 1M6SA 2C81A 4MQQA 4H63Q 4WP0A 3EI9A 3FZ7A 7AATA 3FZ6A 3PPLA 4JF1A 3FQ8A 3I16A 4OBVA 1BKGA 3I4JA 1AMAA 1QJ5A 1AKAA 4ATQA 3PDBA 4B98A 1BJOA 3ELPA 1M7YA 2W7FA 4MGRA 2CH2A 5HDMA 2QLRA 3KKIA 2ZY4A 2AATA 2AY4A 3QN6A 1TARA 2HZPA 1FG3A 3VP6A 2Z9XA 3ECDA 1D7SA 1CS1A 1YAAA 5DJ9A 3GZDA 4A0FA 3DRDA 2D7YA 3GBXA 3MAFA 2HP2A 3KGXA 1CJ0A 1QISA 3LVLB 3COGA 4M2KA 1D2FA 3LY1A 4GSAA 4WYEA 4E77A 3RCHB 5E4ZA 4K2BA 4OC9A 2ZY2A 1SPAA 3NUBA 2JJGA 3GJUA 1B9IA 2GMUA 4Y0IA 3T32A 2VMQA 3FCRA 2CH1A 1B8GA 3HVYA 3W1JA 5BJ4A 1YJZA 2JISA 3UE8A 2HP1A 3RCHA 3FTBA 2FM1A 4IX8A 3WKSA 4JE5D 1YOOA 2XH1A 3TFUA 3D6KA 2CFBA 2VI8A 1ARGA 1IX7A 1AHFA 2BI5A 3CQ5A 4ITGA 4AZJA 3PIUA 1Z3ZA 3OP7A 4ZSWA 1AJRA 3RBFA 1UU2A 4ADCA 1KKPA 3ZZKA 1OXPA 2VMSA 3A9XA 3QBOA 1D7UA 2VI9A 1LW5A 3NUIA 2VMVA 3BC8A 4CBSA 3AATA 2VGUA 2PO3A 4JE5A 1LS3A 4W1XA 3TFTA 4MY5A 3QM2A 1ORDA 4Y0HA 5G4JA 3DR7A 4A6RA 1IX8A 4OTLA 1BS0A 2D66A 3E2ZB 4RAEA 5F8VA 1ARSA 2CTZA 3ATHA 4JEYA 4F5IA 1WSTA 4R5ZA 2GSAA 5LHAA 3H9XA 1YNUA 3ZZJA 3HT4A 3WCNA 5J8QA 3FDBA 1GCKA 2O0RA 1M4NA 1IJIA 1D7RA 1G4VA 4EB5A 1PMOA 2AY2A 2VGTA 4OT8A 1O61A 4XAUA 1DKAA 1I29A 3HMUA 3JTXA 1DGDA 2DKJA 3E2ZA 4FL0A 4ISYA 2VGVA 3NDNA 4RITA 2VMWA 1LW4A 4AO9A 2O7CA 2C7TA 1IUGA 4IW7A 4DQ6A 1B9HA 2KFPA 1LKCA 1G4XA 2QMAA 2R0TA 1C0NA 1BQAA 1XEYA 2W7LA 4WBTA 1IVRA 4Q31A 1Y4IA 4WYCA 2VMTA 3VK3A 2YCNA 3A9ZA 2D64A 1GEWA 2VYCA 2YRIA 2Z67A 2ZSMA 2A1VA 1GEYA 3JW9A 4EB7A 2AY3A 1BJ4A 3FKDA 4RKCA 2BI3A 1AKBA 1DFOA 3MADA 2DGKA 1BJWA 5AX8A 3G0TA 2OKJA 4ZWVA 1QGNA 3FFHA 4PFNA 1MLYA 2YKUA 3DXWA 3EUCA 3AOVA 4BA4A 2W8VA 2BIGA 1I43A 1ASMA 1IAYA 3FZ8A 4Q6RA 3CQ6A 2YKVA 3N75A 3PDXA 1SFFA 2YKYA 1GD9A 2Z9UA 1M32A 2Z20A 3ASAA 2Q7WA 1V2EA 4LW4A 1JS6A 2VLFA 1JS3A 1RVUA 3ASBA 1I41A 4F5MA 3Q8NA 2YHKA 1ZODA 5K8BA 3HBXA 4CXRA 1AMSA 5DX5A 4ZDOA 3MEBA 3HQTA 4W91A 1AHYA 4M2JA 1C7OA 1CQ8A 1CL2A 3MC6A 2BWPA 2ZYJA 2W7MA 5KTBA 3F9TA 1FC4A 3B46A 1BJOB 1GEXA 1TOGA 2FYFA 4W5KA 5F9SA 1TASA 2BWOA 2V0YA 1O69A 1SZSA 1TOKA 4P3MA 5EQCA 4AOAA 1G7XA 4M2MA 4JEWA 2AY6A 2PB0A 3NNKA 4KAMA 3RBLA 4A0RA 3A8UX 4ZM3A 2VIAA 1LC7A 4A72A 2HUFA 3DXVA 2AY7A 3MAFB 1C4KA 4DBCA 4E1OA 1XI9A 2X5DA 1ASGA 8AATA 2VMPA 3VOMA 4F5LA 3EIBA 5C6UA 4A0HA 2Z61A 2VMXA 1W7MA 3FVUA 3W1HA 1YJSA 4WLJA 4F5JA 1KL2A 3A9YA 1YIYA 1B5PA 3DU4A 4W1WA 2AY1A 3B1DA 1ASEA 5EFSA 1MGVA 1TOIA 2QSRA 2EGYA 3PGYA 4K2IA 9AATA 1AMQA 5HXXA 4Q76A 2HORA 2FQ6A 3IF2A 3LVKA 4IXZA 1M0NA 3BV0A 1BW0A 4K2MA 3UAKA 1YIZA 1KL1A 2W7KA 2Z9VA 2GB3A 2DGLA 3JWAA 1GBNA 3EI6A 1H0CA 3DR4A 4LC3A 2NMPA 1AHEA 3N4RA 2ZY3A 1X0MA 4W1VA 1KMJA 4B9BA 2WK9A 4ADEA 3P1TA 3AEMA 2EH6A 2WK7A 4ADDA 1W7NA 2ZJGA 2BYLA 3H7FA 4OYTA 4LNMA 4N0BA 1UU0A 1V72A 3EI7A 2W7IA 4ATPA 4WXFA 2EYQA 3BWOA 3WX9A 3N4SA 4LNLA 1B4XA 4WYDA 4GE7A 2PB2A 2D65A 1MAQA 5HHYA 3ACZA 3VAXA 2WB6A 1DTYA 3BS8A 4KXKA 1ELUA 3GSBA 3LVJA 3FQAA 5FT4A 4A6TA 2EZ1A 4TV7A 3E6GA 3UWCA 2EO5A 4PFFA 1O4SA 3OKSA 2BIEA 4GEBA 2GQNA 3ELEA 5FT5A 4BHDA 5JAYA 1LC5A 4GE4A 3G8MA 4ZLVA 5I92A 4XQ2A 4AH3A 2OKKA 3FRKA 1MLZA 3F6TA 2JJHA 3GWPA 1RVYA 4Y0DA 1AICA 4EFFA 1KKJA 4QGRA 3LG0A 1X28A 4WYGA 1MDZA 1W7LA 1AX4A 4WYFA 1TATA 1C9CA 4HF8A 3QGUA 1OATA 1UKJA 1IAXA 2DR1A 4ZSYA 3BWNC 2CY8A 2V1PA 3RUYA 1ASFA 2TPLA 1SZKA 2YKXA 3BCBA 3II0A 4XEWA 2X3LA 2G6WA 3ZRRA 3TATA 3DODA 1S09A 2HUIA 1AMRA 5E3KA 5M4BA 3E77A 3NU8A 4WXGA 2DKBA 3WGBA 1GC3A 2HOZA 5EAVA 3F0HA 5FT8A 1I48A 4IY7A 4ZDLA 3VK2A 5G4IA 1OHYA 3GETA 2ZY5A 3R9AA 3PD6B 1S0AA 2FNUA 4E3QA 4UHNA 2ZC0A 2BHXA 3GR9A 3LV2A 3NYUA 4GRXA 1WYTB 1RV4A 2VGWA 1MDOA 2OGEA 2W8WA 4H51A 4UHMA 4A00A 1BQDA 2ZP7A 2XBNA 4XJPA 2JJFA 3EI8A 2QBTA 2X8UA 2DGMA 1V2FA 1BJNA 2R5EA 1PFFA 3AELA 3PD6A 3HL2A 3BB8A 2BYJA 1DJUA 1WYUA 5TF5A 1QZ9A 4R2NA 4HVKA 2F8JA 1WYTA 1O62A 1DGEA 2E7UA 3WCOA 2YRRA 2W8TA 1LC8A 2BWNA 1PMMA 1Z7DA 2VLHA 1DJ9A 1RV3A 3N0LA 3PJ0A 3VK4A 3N7NA 4L0OA 1N8PA 2AY9A 2EZ2A 3AV7A 3EIAA 1EJIA 4OBUA 1AJSB 1W3UA 4RM1A 3NU7A 4ZAHA 3AENB 3ZRPA 1CZCA 1WKGA 2YCTA 1QIRA 1IX6A 2DOUA 2C0RA 3NRAA 4XJMA 1IBJA 4R8DA 2HOXA 2VMYA 2YOBA 1GDEA 1E5EA 5BJ3A 3QHXA 4UQVA 3AEJC 3QPGA 2C44A 2YCPA 4WXBA 2VMZA 1V2DA 1AJSA 1KAFA 1AY4A 1AKCA 3AENA 3JU7A 4F5KA 3R4TA 4CVQA 5EIGB 1AHGA 1ELQA 3KE3A 1VEFA 4ZDPA 4GE9A 4MKJA 2OATA 2W7EA 3MKJA 2FKIA 1AAMA 4GDYA 1FG7A 3IHJA 3ISLA 4A6UA 4DGTA 3DZZA 1QJ3A 2X5FA 2W8UA 3B1EA 5EUNA 3CBFA 1X2AA 5G0AA 4PVFA 5G2QA 4NOGA 4XJOA 4BA5A 3B1CA 4RJ0A 5EIGA 2JGTA 4E3RA 1ASLA 2W7GA 4ZWMA 4JEVA 4J5UA 1ASBA 4RIZA 4XK1A 1AY8A 2HUUA 3PA9A 4EMYA 3WKRA 1EG5A 2BI1A 2CINA 3CAIA 1CZEA 3N5MA 1GC4A 2CB1A 2AEUA 3K40A 3USFA 4F4EA 5M4DA 4W8IA 3FFRA 3MBBA 2OQXA 3WGCA 4WB0B 3ZRQA 2CJGA 1SVVA 4A0GA 2BI9A 4J8LA 3LVMA 3HDOA 2AY5A 3KGWA 1GC0A 3NX3A 4JEXA 3WY7A 1CQ6A 1G7WA 1AIAA 3FSLA 1M0QA 1CL1A 5G2PA 2VMRA 4FFCA 3FQ7A 2O1BA
chains in the Genus database with same CATH topology
2FNIA 5M49A 1GC2A 2D5YA 4IYOB 1ECXA 4ZASA 3AEJA 4CBRA 3WZFA 3AOWA 3BN1A 4LNJA 1ZOBA 4WB0A 4AO4A 4PIWA 2CJHA 1J04A 1MDXA 4UOYA 5DB5A 1JG8A 1T3IA 4CXQA 3W1IA 2QB2A 1N2TA 3EI5A 3JZLA 4ITXA 5LH9A 1VP4A 4ADBA 4U2HA 1DJEA 1TOEA 5M46A 3EZ1A 3K28A 2AEVA 3E2FA 1X29A 4IYOA 4TMRA 4U1TA 3H14A 2WKAA 3L44A 1OHWA 2VMUA 4KYOA 1M0PA 2QA3A 3PAAA 4R5FA 1AY5A 2W7JA 3LWSA 4N0WA 2AY8A 2G7JA 1M0OA 4BQ0A 2OGAA 1N31A 1S08A 1LK9A 1SZUA 2W8JA 3FVSA 2ORDA 4IXOA 3RI6A 1H1CA 2EPJA 1U08A 5E5IA 2FN6A 2JG2A 2GMSA 1C7GA 3G7QA 4WYAA 3DYDA 3P6KA 2E7IA 2BIAA 3N4XA 3MC6C 1VJOA 3WLXA 1JF9A 2RFVA 3JWBA 1BT4A 1TPLA 2D63A 4WD2A 2WK8A 1S07A 5IWQA 1B5OA 2R5CB 3L8AA 4OCAA 1OXOA 1WYUB 2D61A 2W7DA 2Z9WA 3TCMA 5DJ1A 1SF2A 3DC1A 1YJYA 1ASNA 4TN4A 2Z1ZA 4EU1A 1WKHA 4F5HA 2D7ZA 1AIBA 1ARTA 4MQRA 4MKKA 4WLHA 4RLGA 4F5FA 3A2BA 1WYVB 3BCAA 1P3WA 1S06A 3GZCA 5D5SA 2R5CA 2VGZA 4XJLA 5D95A 5EUEA 1QITA 1UU1A 1CQ7A 2BI2A 2HOYA 3GZDC 4IXSA 5EUDA 2E7JA 3E9KA 2JJEA 1ASDA 1WYVA 2QB3A 2VMNA 2BKWA 2VGSA 3B8XA 3M5UA 3I5TA 3CQ4A 4JEZA 5G09A 4F5GA 3MAUA 4BMKA 2W7HA 2E54A 1TOJA 3TQXA 5EAAA 1ASAA 3NYSA 1C7NA 1AAWA 1D7VA 1MAPA 3EZSA 4O6ZA 3BWNA 4Q75A 5FT6A 1KMKA 4P7YA 1ARIA 4ZM4A 3FD0A 3K7YA 3AEPA 4MQPA 3FDDA 3HLMA 1W23A 3AEOA 2CSTA 1EQBA 4RKDA 2ZSLA 2CJDA 1ASCA 4K05A 3RQ1A 4LW2A 4MSOA 4OMAA 1OHVA 4RJYA 1J32A 3PDBB 4UHOA 2CANA 2Z1YA 3AEMC 3FVXA 3E2YA 3NYTA 3BCXA 1ZC9A 4I8AA 1ARHA 2VIBA 2R2NA 2VMOA 3NTJA 3QI6A 4AZKA 1AHXA 2ZUKA 1PG8A 4JF0A 1E5FA 1M6SA 2C81A 4MQQA 4H63Q 4WP0A 3EI9A 3FZ7A 7AATA 3FZ6A 3PPLA 4JF1A 3FQ8A 3I16A 4OBVA 1BKGA 3I4JA 1AMAA 1QJ5A 1AKAA 4ATQA 3PDBA 4B98A 1BJOA 3ELPA 1M7YA 2W7FA 4MGRA 2CH2A 5HDMA 2QLRA 3KKIA 2ZY4A 2AATA 2AY4A 3QN6A 1TARA 2HZPA 1FG3A 3VP6A 2Z9XA 3ECDA 1D7SA 1CS1A 1YAAA 5DJ9A 3GZDA 4A0FA 3DRDA 2D7YA 3GBXA 3MAFA 2HP2A 3KGXA 1CJ0A 1QISA 3LVLB 3COGA 4M2KA 1D2FA 3LY1A 4GSAA 4WYEA 4E77A 3RCHB 5E4ZA 4K2BA 4OC9A 2ZY2A 1SPAA 3NUBA 2JJGA 3GJUA 1B9IA 2GMUA 4Y0IA 3T32A 2VMQA 3FCRA 2CH1A 1B8GA 3HVYA 3W1JA 5BJ4A 1YJZA 2JISA 3UE8A 2HP1A 3RCHA 3FTBA 2FM1A 4IX8A 3WKSA 4JE5D 1YOOA 2XH1A 3TFUA 3D6KA 2CFBA 2VI8A 1ARGA 1IX7A 1AHFA 2BI5A 3CQ5A 4ITGA 4AZJA 3PIUA 1Z3ZA 3OP7A 4ZSWA 1AJRA 3RBFA 1UU2A 4ADCA 1KKPA 3ZZKA 1OXPA 2VMSA 3A9XA 3QBOA 1D7UA 2VI9A 1LW5A 3NUIA 2VMVA 3BC8A 4CBSA 3AATA 2VGUA 2PO3A 4JE5A 1LS3A 4W1XA 3TFTA 4MY5A 3QM2A 1ORDA 4Y0HA 5G4JA 3DR7A 4A6RA 1IX8A 4OTLA 1BS0A 2D66A 3E2ZB 4RAEA 5F8VA 1ARSA 2CTZA 3ATHA 4JEYA 4F5IA 1WSTA 4R5ZA 2GSAA 5LHAA 3H9XA 1YNUA 3ZZJA 3HT4A 3WCNA 5J8QA 3FDBA 1GCKA 2O0RA 1M4NA 1IJIA 1D7RA 1G4VA 4EB5A 1PMOA 2AY2A 2VGTA 4OT8A 1O61A 4XAUA 1DKAA 1I29A 3HMUA 3JTXA 1DGDA 2DKJA 3E2ZA 4FL0A 4ISYA 2VGVA 3NDNA 4RITA 2VMWA 1LW4A 4AO9A 2O7CA 2C7TA 1IUGA 4IW7A 4DQ6A 1B9HA 2KFPA 1LKCA 1G4XA 2QMAA 2R0TA 1C0NA 1BQAA 1XEYA 2W7LA 4WBTA 1IVRA 4Q31A 1Y4IA 4WYCA 2VMTA 3VK3A 2YCNA 3A9ZA 2D64A 1GEWA 2VYCA 2YRIA 2Z67A 2ZSMA 2A1VA 1GEYA 3JW9A 4EB7A 2AY3A 1BJ4A 3FKDA 4RKCA 2BI3A 1AKBA 1DFOA 3MADA 2DGKA 1BJWA 5AX8A 3G0TA 2OKJA 4ZWVA 1QGNA 3FFHA 4PFNA 1MLYA 2YKUA 3DXWA 3EUCA 3AOVA 4BA4A 2W8VA 2BIGA 1I43A 1ASMA 1IAYA 3FZ8A 4Q6RA 3CQ6A 2YKVA 3N75A 3PDXA 1SFFA 2YKYA 1GD9A 2Z9UA 1M32A 2Z20A 3ASAA 2Q7WA 1V2EA 4LW4A 1JS6A 2VLFA 1JS3A 1RVUA 3ASBA 1I41A 4F5MA 3Q8NA 2YHKA 1ZODA 5K8BA 3HBXA 4CXRA 1AMSA 5DX5A 4ZDOA 3MEBA 3HQTA 4W91A 1AHYA 4M2JA 1C7OA 1CQ8A 1CL2A 3MC6A 2BWPA 2ZYJA 2W7MA 5KTBA 3F9TA 1FC4A 3B46A 1BJOB 1GEXA 1TOGA 2FYFA 4W5KA 5F9SA 1TASA 2BWOA 2V0YA 1O69A 1SZSA 1TOKA 4P3MA 5EQCA 4AOAA 1G7XA 4M2MA 4JEWA 2AY6A 2PB0A 3NNKA 4KAMA 3RBLA 4A0RA 3A8UX 4ZM3A 2VIAA 1LC7A 4A72A 2HUFA 3DXVA 2AY7A 3MAFB 1C4KA 4DBCA 4E1OA 1XI9A 2X5DA 1ASGA 8AATA 2VMPA 3VOMA 4F5LA 3EIBA 5C6UA 4A0HA 2Z61A 2VMXA 1W7MA 3FVUA 3W1HA 1YJSA 4WLJA 4F5JA 1KL2A 3A9YA 1YIYA 1B5PA 3DU4A 4W1WA 2AY1A 3B1DA 1ASEA 5EFSA 1MGVA 1TOIA 2QSRA 2EGYA 3PGYA 4K2IA 9AATA 1AMQA 5HXXA 4Q76A 2HORA 2FQ6A 3IF2A 3LVKA 4IXZA 1M0NA 3BV0A 1BW0A 4K2MA 3UAKA 1YIZA 1KL1A 2W7KA 2Z9VA 2GB3A 2DGLA 3JWAA 1GBNA 3EI6A 1H0CA 3DR4A 4LC3A 2NMPA 1AHEA 3N4RA 2ZY3A 1X0MA 4W1VA 1KMJA 4B9BA 2WK9A 4ADEA 3P1TA 3AEMA 2EH6A 2WK7A 4ADDA 1W7NA 2ZJGA 2BYLA 3H7FA 4OYTA 4LNMA 4N0BA 1UU0A 1V72A 3EI7A 2W7IA 4ATPA 4WXFA 2EYQA 3BWOA 3WX9A 3N4SA 4LNLA 1B4XA 4WYDA 4GE7A 2PB2A 2D65A 1MAQA 5HHYA 3ACZA 3VAXA 2WB6A 1DTYA 3BS8A 4KXKA 1ELUA 3GSBA 3LVJA 3FQAA 5FT4A 4A6TA 2EZ1A 4TV7A 3E6GA 3UWCA 2EO5A 4PFFA 1O4SA 3OKSA 2BIEA 4GEBA 2GQNA 3ELEA 5FT5A 4BHDA 5JAYA 1LC5A 4GE4A 3G8MA 4ZLVA 5I92A 4XQ2A 4AH3A 2OKKA 3FRKA 1MLZA 3F6TA 2JJHA 3GWPA 1RVYA 4Y0DA 1AICA 4EFFA 1KKJA 4QGRA 3LG0A 1X28A 4WYGA 1MDZA 1W7LA 1AX4A 4WYFA 1TATA 1C9CA 4HF8A 3QGUA 1OATA 1UKJA 1IAXA 2DR1A 4ZSYA 3BWNC 2CY8A 2V1PA 3RUYA 1ASFA 2TPLA 1SZKA 2YKXA 3BCBA 3II0A 4XEWA 2X3LA 2G6WA 3ZRRA 3TATA 3DODA 1S09A 2HUIA 1AMRA 5E3KA 5M4BA 3E77A 3NU8A 4WXGA 2DKBA 3WGBA 1GC3A 2HOZA 5EAVA 3F0HA 5FT8A 1I48A 4IY7A 4ZDLA 3VK2A 5G4IA 1OHYA 3GETA 2ZY5A 3R9AA 3PD6B 1S0AA 2FNUA 4E3QA 4UHNA 2ZC0A 2BHXA 3GR9A 3LV2A 3NYUA 4GRXA 1WYTB 1RV4A 2VGWA 1MDOA 2OGEA 2W8WA 4H51A 4UHMA 4A00A 1BQDA 2ZP7A 2XBNA 4XJPA 2JJFA 3EI8A 2QBTA 2X8UA 2DGMA 1V2FA 1BJNA 2R5EA 1PFFA 3AELA 3PD6A 3HL2A 3BB8A 2BYJA 1DJUA 1WYUA 5TF5A 1QZ9A 4R2NA 4HVKA 2F8JA 1WYTA 1O62A 1DGEA 2E7UA 3WCOA 2YRRA 2W8TA 1LC8A 2BWNA 1PMMA 1Z7DA 2VLHA 1DJ9A 1RV3A 3N0LA 3PJ0A 3VK4A 3N7NA 4L0OA 1N8PA 2AY9A 2EZ2A 3AV7A 3EIAA 1EJIA 4OBUA 1AJSB 1W3UA 4RM1A 3NU7A 4ZAHA 3AENB 3ZRPA 1CZCA 1WKGA 2YCTA 1QIRA 1IX6A 2DOUA 2C0RA 3NRAA 4XJMA 1IBJA 4R8DA 2HOXA 2VMYA 2YOBA 1GDEA 1E5EA 5BJ3A 3QHXA 4UQVA 3AEJC 3QPGA 2C44A 2YCPA 4WXBA 2VMZA 1V2DA 1AJSA 1AY4A 1AKCA 3AENA 3JU7A 4F5KA 3R4TA 4CVQA 5EIGB 1AHGA 1ELQA 3KE3A 1VEFA 4ZDPA 4GE9A 4MKJA 2OATA 2W7EA 3MKJA 2FKIA 1AAMA 4GDYA 1FG7A 3IHJA 3ISLA 4A6UA 4DGTA 3DZZA 1QJ3A 2X5FA 2W8UA 3B1EA 5EUNA 3CBFA 1X2AA 5G0AA 4PVFA 5G2QA 4NOGA 4XJOA 4BA5A 3B1CA 4RJ0A 5EIGA 2JGTA 4E3RA 1ASLA 2W7GA 4ZWMA 4JEVA 4J5UA 1ASBA 4RIZA 4XK1A 1AY8A 2HUUA 3PA9A 4EMYA 3WKRA 1EG5A 2BI1A 2CINA 3CAIA 1CZEA 3N5MA 1GC4A 2CB1A 2AEUA 3K40A 3USFA 4F4EA 5M4DA 4W8IA 3FFRA 3MBBA 2OQXA 3WGCA 4WB0B 3ZRQA 2CJGA 1SVVA 4A0GA 2BI9A 4J8LA 3LVMA 3HDOA 2AY5A 3KGWA 1GC0A 3NX3A 4JEXA 3WY7A 1CQ6A 1G7WA 1AIAA 3FSLA 1M0QA 1CL1A 5G2PA 2VMRA 4FFCA 3FQ7A 2O1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FNI A;  5M49 A;  1GC2 A;  2D5Y A;  4IYO B;  1ECX A;  4ZAS A;  3AEJ A;  4CBR A;  3WZF A;  3AOW A;  3BN1 A;  4LNJ A;  1ZOB A;  4WB0 A;  4AO4 A;  4PIW A;  2CJH A;  1J04 A;  1MDX A;  4UOY A;  5DB5 A;  1JG8 A;  1T3I A;  4CXQ A;  3W1I A;  2QB2 A;  1N2T A;  3EI5 A;  3JZL A;  4ITX A;  5LH9 A;  1VP4 A;  4ADB A;  4U2H A;  1DJE A;  1TOE A;  5M46 A;  3EZ1 A;  3K28 A;  2AEV A;  3E2F A;  1X29 A;  4IYO A;  4TMR A;  4U1T A;  3H14 A;  2WKA A;  3L44 A;  1OHW A;  2VMU A;  4KYO A;  1M0P A;  2QA3 A;  3PAA A;  4R5F A;  1AY5 A;  2W7J A;  3LWS A;  4N0W A;  2AY8 A;  1M0O A;  4BQ0 A;  2OGA A;  1N31 A;  1S08 A;  1LK9 A;  1SZU A;  2W8J A;  3FVS A;  2ORD A;  4IXO A;  3RI6 A;  1H1C A;  2EPJ A;  1U08 A;  5E5I A;  2FN6 A;  2JG2 A;  2GMS A;  1C7G A;  3G7Q A;  4WYA A;  3DYD A;  3P6K A;  2E7I A;  2BIA A;  3MC6 C;  1VJO A;  3WLX A;  1JF9 A;  2RFV A;  3JWB A;  1BT4 A;  1TPL A;  2D63 A;  4WD2 A;  2WK8 A;  1S07 A;  5IWQ A;  1B5O A;  2R5C B;  3L8A A;  4OCA A;  1OXO A;  1WYU B;  2D61 A;  2W7D A;  2Z9W A;  3TCM A;  5DJ1 A;  1SF2 A;  3DC1 A;  1YJY A;  1ASN A;  4TN4 A;  2Z1Z A;  4EU1 A;  1WKH A;  4F5H A;  2D7Z A;  1AIB A;  1ART A;  4MQR A;  4MKK A;  4WLH A;  4RLG A;  4F5F A;  3A2B A;  1WYV B;  3BCA A;  1P3W A;  1S06 A;  3GZC A;  5D5S A;  2R5C A;  2VGZ A;  4XJL A;  5D95 A;  5EUE A;  1QIT A;  1UU1 A;  1CQ7 A;  2BI2 A;  2HOY A;  3GZD C;  4IXS A;  5EUD A;  2E7J A;  3E9K A;  2JJE A;  1ASD A;  1WYV A;  2QB3 A;  2VMN A;  2BKW A;  2VGS A;  3B8X A;  3M5U A;  3I5T A;  3CQ4 A;  4JEZ A;  5G09 A;  4F5G A;  3MAU A;  4BMK A;  2W7H A;  2E54 A;  1TOJ A;  3TQX A;  5EAA A;  1ASA A;  3NYS A;  1C7N A;  1AAW A;  1D7V A;  1MAP A;  3EZS A;  4O6Z A;  3BWN A;  4Q75 A;  5FT6 A;  1KMK A;  4P7Y A;  1ARI A;  4ZM4 A;  3FD0 A;  3K7Y A;  3AEP A;  4MQP A;  3FDD A;  3HLM A;  1W23 A;  3AEO A;  2CST A;  1EQB A;  4RKD A;  2ZSL A;  2CJD A;  1ASC A;  3RQ1 A;  4LW2 A;  4MSO A;  4OMA A;  1OHV A;  4RJY A;  1J32 A;  3PDB B;  4UHO A;  2CAN A;  2Z1Y A;  3AEM C;  3FVX A;  3E2Y A;  3NYT A;  3BCX A;  1ZC9 A;  4I8A A;  1ARH A;  2VIB A;  2R2N A;  2VMO A;  3NTJ A;  3QI6 A;  4AZK A;  1AHX A;  2ZUK A;  1PG8 A;  4JF0 A;  1E5F A;  1M6S A;  2C81 A;  4MQQ A;  4WP0 A;  3EI9 A;  3FZ7 A;  7AAT A;  3FZ6 A;  3PPL A;  4JF1 A;  3FQ8 A;  3I16 A;  4OBV A;  1BKG A;  3I4J A;  1AMA A;  1QJ5 A;  1AKA A;  4ATQ A;  3PDB A;  4B98 A;  1BJO A;  3ELP A;  1M7Y A;  2W7F A;  4MGR A;  2CH2 A;  5HDM A;  2QLR A;  3KKI A;  2ZY4 A;  2AAT A;  2AY4 A;  3QN6 A;  1TAR A;  2HZP A;  1FG3 A;  3VP6 A;  2Z9X A;  3ECD A;  1D7S A;  1CS1 A;  1YAA A;  5DJ9 A;  3GZD A;  4A0F A;  3DRD A;  2D7Y A;  3GBX A;  3MAF A;  2HP2 A;  3KGX A;  1CJ0 A;  1QIS A;  3LVL B;  3COG A;  4M2K A;  1D2F A;  3LY1 A;  4GSA A;  4WYE A;  4E77 A;  3RCH B;  5E4Z A;  4K2B A;  4OC9 A;  2ZY2 A;  1SPA A;  3NUB A;  2JJG A;  3GJU A;  1B9I A;  2GMU A;  4Y0I A;  3T32 A;  2VMQ A;  3FCR A;  2CH1 A;  1B8G A;  3HVY A;  3W1J A;  5BJ4 A;  1YJZ A;  2JIS A;  3UE8 A;  2HP1 A;  3RCH A;  3FTB A;  2FM1 A;  4IX8 A;  3WKS A;  4JE5 D;  1YOO A;  2XH1 A;  3TFU A;  3D6K A;  2CFB A;  2VI8 A;  1ARG A;  1IX7 A;  1AHF A;  2BI5 A;  3CQ5 A;  4ITG A;  4AZJ A;  3PIU A;  1Z3Z A;  3OP7 A;  4ZSW A;  1AJR A;  3RBF A;  1UU2 A;  4ADC A;  1KKP A;  3ZZK A;  1OXP A;  2VMS A;  3A9X A;  3QBO A;  1D7U A;  2VI9 A;  1LW5 A;  3NUI A;  2VMV A;  3BC8 A;  4CBS A;  3AAT A;  2VGU A;  2PO3 A;  4JE5 A;  1LS3 A;  4W1X A;  3TFT A;  4MY5 A;  3QM2 A;  1ORD A;  4Y0H A;  5G4J A;  3DR7 A;  4A6R A;  1IX8 A;  4OTL A;  1BS0 A;  2D66 A;  3E2Z B;  4RAE A;  5F8V A;  1ARS A;  2CTZ A;  3ATH A;  4JEY A;  4F5I A;  1WST A;  4R5Z A;  2GSA A;  5LHA A;  1YNU A;  3ZZJ A;  3HT4 A;  3WCN A;  5J8Q A;  3FDB A;  1GCK A;  2O0R A;  1M4N A;  1IJI A;  1D7R A;  1G4V A;  4EB5 A;  1PMO A;  2AY2 A;  2VGT A;  4OT8 A;  1O61 A;  4XAU A;  1DKA A;  1I29 A;  3HMU A;  3JTX A;  1DGD A;  2DKJ A;  3E2Z A;  4FL0 A;  4ISY A;  2VGV A;  3NDN A;  4RIT A;  2VMW A;  1LW4 A;  4AO9 A;  2O7C A;  2C7T A;  1IUG A;  4IW7 A;  4DQ6 A;  1B9H A;  1LKC A;  1G4X A;  2QMA A;  2R0T A;  1C0N A;  1BQA A;  1XEY A;  2W7L A;  4WBT A;  1IVR A;  4Q31 A;  1Y4I A;  4WYC A;  2VMT A;  3VK3 A;  2YCN A;  3A9Z A;  2D64 A;  1GEW A;  2VYC A;  2YRI A;  2Z67 A;  2ZSM A;  1GEY A;  3JW9 A;  4EB7 A;  2AY3 A;  1BJ4 A;  3FKD A;  4RKC A;  2BI3 A;  1AKB A;  1DFO A;  3MAD A;  2DGK A;  1BJW A;  5AX8 A;  3G0T A;  2OKJ A;  4ZWV A;  1QGN A;  3FFH A;  4PFN A;  1MLY A;  2YKU A;  3DXW A;  3EUC A;  3AOV A;  4BA4 A;  2W8V A;  2BIG A;  1I43 A;  1ASM A;  1IAY A;  3FZ8 A;  4Q6R A;  3CQ6 A;  2YKV A;  3N75 A;  3PDX A;  1SFF A;  2YKY A;  1GD9 A;  2Z9U A;  1M32 A;  2Z20 A;  3ASA A;  2Q7W A;  1V2E A;  4LW4 A;  1JS6 A;  2VLF A;  1JS3 A;  1RVU A;  3ASB A;  1I41 A;  4F5M A;  3Q8N A;  2YHK A;  1ZOD A;  5K8B A;  3HBX A;  4CXR A;  1AMS A;  5DX5 A;  4ZDO A;  3MEB A;  3HQT A;  4W91 A;  1AHY A;  4M2J A;  1C7O A;  1CQ8 A;  1CL2 A;  3MC6 A;  2BWP A;  2ZYJ A;  2W7M A;  3F9T A;  1FC4 A;  3B46 A;  1BJO B;  1GEX A;  1TOG A;  2FYF A;  4W5K A;  5F9S A;  1TAS A;  2BWO A;  2V0Y A;  1O69 A;  1SZS A;  1TOK A;  4P3M A;  5EQC A;  4AOA A;  1G7X A;  4M2M A;  4JEW A;  2AY6 A;  2PB0 A;  3NNK A;  4KAM A;  3RBL A;  4A0R A;  3A8U X;  4ZM3 A;  2VIA A;  1LC7 A;  4A72 A;  2HUF A;  3DXV A;  2AY7 A;  3MAF B;  1C4K A;  4DBC A;  4E1O A;  1XI9 A;  2X5D A;  1ASG A;  8AAT A;  2VMP A;  3VOM A;  4F5L A;  3EIB A;  5C6U A;  4A0H A;  2Z61 A;  2VMX A;  1W7M A;  3FVU A;  3W1H A;  1YJS A;  4WLJ A;  4F5J A;  1KL2 A;  3A9Y A;  1YIY A;  1B5P A;  3DU4 A;  4W1W A;  2AY1 A;  3B1D A;  1ASE A;  5EFS A;  1MGV A;  1TOI A;  2EGY A;  3PGY A;  4K2I A;  9AAT A;  1AMQ A;  5HXX A;  4Q76 A;  2HOR A;  2FQ6 A;  3IF2 A;  3LVK A;  4IXZ A;  1M0N A;  3BV0 A;  1BW0 A;  4K2M A;  3UAK A;  1YIZ A;  1KL1 A;  2W7K A;  2Z9V A;  2GB3 A;  2DGL A;  3JWA A;  1GBN A;  3EI6 A;  1H0C A;  3DR4 A;  4LC3 A;  2NMP A;  1AHE A;  2ZY3 A;  1X0M A;  4W1V A;  1KMJ A;  4B9B A;  2WK9 A;  4ADE A;  3P1T A;  3AEM A;  2EH6 A;  2WK7 A;  4ADD A;  1W7N A;  2ZJG A;  2BYL A;  3H7F A;  4OYT A;  4LNM A;  4N0B A;  1UU0 A;  1V72 A;  3EI7 A;  2W7I A;  4ATP A;  4WXF A;  3BWO A;  3WX9 A;  4LNL A;  1B4X A;  4WYD A;  4GE7 A;  2PB2 A;  2D65 A;  1MAQ A;  5HHY A;  3ACZ A;  3VAX A;  1DTY A;  3BS8 A;  4KXK A;  1ELU A;  3GSB A;  3LVJ A;  3FQA A;  5FT4 A;  4A6T A;  2EZ1 A;  4TV7 A;  3E6G A;  3UWC A;  2EO5 A;  4PFF A;  1O4S A;  3OKS A;  2BIE A;  4GEB A;  2GQN A;  3ELE A;  5FT5 A;  4BHD A;  5JAY A;  1LC5 A;  4GE4 A;  3G8M A;  4ZLV A;  5I92 A;  4XQ2 A;  4AH3 A;  2OKK A;  3FRK A;  1MLZ A;  3F6T A;  2JJH A;  3GWP A;  1RVY A;  4Y0D A;  1AIC A;  4EFF A;  1KKJ A;  4QGR A;  3LG0 A;  1X28 A;  4WYG A;  1MDZ A;  1W7L A;  1AX4 A;  4WYF A;  1TAT A;  1C9C A;  4HF8 A;  3QGU A;  1OAT A;  1UKJ A;  1IAX A;  2DR1 A;  4ZSY A;  3BWN C;  2CY8 A;  2V1P A;  3RUY A;  1ASF A;  2TPL A;  1SZK A;  2YKX A;  3BCB A;  3II0 A;  4XEW A;  2X3L A;  2G6W A;  3ZRR A;  3TAT A;  3DOD A;  1S09 A;  2HUI A;  1AMR A;  5E3K A;  5M4B A;  3E77 A;  3NU8 A;  4WXG A;  2DKB A;  3WGB A;  1GC3 A;  2HOZ A;  5EAV A;  3F0H A;  5FT8 A;  1I48 A;  4IY7 A;  4ZDL A;  3VK2 A;  5G4I A;  1OHY A;  3GET A;  2ZY5 A;  3R9A A;  3PD6 B;  1S0A A;  2FNU A;  4E3Q A;  4UHN A;  2ZC0 A;  2BHX A;  3GR9 A;  3LV2 A;  3NYU A;  4GRX A;  1WYT B;  1RV4 A;  2VGW A;  1MDO A;  2OGE A;  2W8W A;  4H51 A;  4UHM A;  4A00 A;  1BQD A;  2ZP7 A;  2XBN A;  4XJP A;  2JJF A;  3EI8 A;  2QBT A;  2X8U A;  2DGM A;  1V2F A;  1BJN A;  2R5E A;  1PFF A;  3AEL A;  3PD6 A;  3HL2 A;  3BB8 A;  2BYJ A;  1DJU A;  1WYU A;  5TF5 A;  1QZ9 A;  4R2N A;  4HVK A;  2F8J A;  1WYT A;  1O62 A;  1DGE A;  2E7U A;  3WCO A;  2YRR A;  2W8T A;  1LC8 A;  2BWN A;  1PMM A;  1Z7D A;  2VLH A;  1DJ9 A;  1RV3 A;  3N0L A;  3PJ0 A;  3VK4 A;  4L0O A;  1N8P A;  2AY9 A;  2EZ2 A;  3AV7 A;  3EIA A;  1EJI A;  4OBU A;  1AJS B;  1W3U A;  4RM1 A;  3NU7 A;  4ZAH A;  3AEN B;  3ZRP A;  1CZC A;  1WKG A;  2YCT A;  1QIR A;  1IX6 A;  2DOU A;  2C0R A;  3NRA A;  4XJM A;  1IBJ A;  4R8D A;  2HOX A;  2VMY A;  2YOB A;  1GDE A;  1E5E A;  5BJ3 A;  3QHX A;  4UQV A;  3AEJ C;  3QPG A;  2C44 A;  2YCP A;  4WXB A;  2VMZ A;  1V2D A;  1AJS A;  1AY4 A;  1AKC A;  3AEN A;  3JU7 A;  4F5K A;  3R4T A;  4CVQ A;  5EIG B;  1AHG A;  1ELQ A;  3KE3 A;  1VEF A;  4ZDP A;  4GE9 A;  4MKJ A;  2OAT A;  2W7E A;  3MKJ A;  1AAM A;  4GDY A;  1FG7 A;  3IHJ A;  3ISL A;  4A6U A;  4DGT A;  3DZZ A;  1QJ3 A;  2X5F A;  2W8U A;  3B1E A;  5EUN A;  3CBF A;  1X2A A;  5G0A A;  4PVF A;  5G2Q A;  4NOG A;  4XJO A;  4BA5 A;  3B1C A;  4RJ0 A;  5EIG A;  2JGT A;  4E3R A;  1ASL A;  2W7G A;  4ZWM A;  4JEV A;  4J5U A;  1ASB A;  4RIZ A;  4XK1 A;  1AY8 A;  2HUU A;  3PA9 A;  4EMY A;  3WKR A;  1EG5 A;  2BI1 A;  2CIN A;  3CAI A;  1CZE A;  3N5M A;  1GC4 A;  2CB1 A;  2AEU A;  3K40 A;  3USF A;  4F4E A;  5M4D A;  4W8I A;  3FFR A;  3MBB A;  2OQX A;  3WGC A;  4WB0 B;  3ZRQ A;  2CJG A;  1SVV A;  4A0G A;  2BI9 A;  4J8L A;  3LVM A;  3HDO A;  2AY5 A;  3KGW A;  1GC0 A;  3NX3 A;  4JEX A;  3WY7 A;  1CQ6 A;  1G7W A;  1AIA A;  3FSL A;  1M0Q A;  1CL1 A;  5G2P A;  2VMR A;  4FFC A;  3FQ7 A;  2O1B A; 
#chains in the Genus database with same CATH topology
 2FNI A;  5M49 A;  1GC2 A;  2D5Y A;  4IYO B;  1ECX A;  4ZAS A;  3AEJ A;  4CBR A;  3WZF A;  3AOW A;  3BN1 A;  4LNJ A;  1ZOB A;  4WB0 A;  4AO4 A;  4PIW A;  2CJH A;  1J04 A;  1MDX A;  4UOY A;  5DB5 A;  1JG8 A;  1T3I A;  4CXQ A;  3W1I A;  2QB2 A;  1N2T A;  3EI5 A;  3JZL A;  4ITX A;  5LH9 A;  1VP4 A;  4ADB A;  4U2H A;  1DJE A;  1TOE A;  5M46 A;  3EZ1 A;  3K28 A;  2AEV A;  3E2F A;  1X29 A;  4IYO A;  4TMR A;  4U1T A;  3H14 A;  2WKA A;  3L44 A;  1OHW A;  2VMU A;  4KYO A;  1M0P A;  2QA3 A;  3PAA A;  4R5F A;  1AY5 A;  2W7J A;  3LWS A;  4N0W A;  2AY8 A;  2G7J A;  1M0O A;  4BQ0 A;  2OGA A;  1N31 A;  1S08 A;  1LK9 A;  1SZU A;  2W8J A;  3FVS A;  2ORD A;  4IXO A;  3RI6 A;  1H1C A;  2EPJ A;  1U08 A;  5E5I A;  2FN6 A;  2JG2 A;  2GMS A;  1C7G A;  3G7Q A;  4WYA A;  3DYD A;  3P6K A;  2E7I A;  2BIA A;  3N4X A;  3MC6 C;  1VJO A;  3WLX A;  1JF9 A;  2RFV A;  3JWB A;  1BT4 A;  1TPL A;  2D63 A;  4WD2 A;  2WK8 A;  1S07 A;  5IWQ A;  1B5O A;  2R5C B;  3L8A A;  4OCA A;  1OXO A;  1WYU B;  2D61 A;  2W7D A;  2Z9W A;  3TCM A;  5DJ1 A;  1SF2 A;  3DC1 A;  1YJY A;  1ASN A;  4TN4 A;  2Z1Z A;  4EU1 A;  1WKH A;  4F5H A;  2D7Z A;  1AIB A;  1ART A;  4MQR A;  4MKK A;  4WLH A;  4RLG A;  4F5F A;  3A2B A;  1WYV B;  3BCA A;  1P3W A;  1S06 A;  3GZC A;  5D5S A;  2R5C A;  2VGZ A;  4XJL A;  5D95 A;  5EUE A;  1QIT A;  1UU1 A;  1CQ7 A;  2BI2 A;  2HOY A;  3GZD C;  4IXS A;  5EUD A;  2E7J A;  3E9K A;  2JJE A;  1ASD A;  1WYV A;  2QB3 A;  2VMN A;  2BKW A;  2VGS A;  3B8X A;  3M5U A;  3I5T A;  3CQ4 A;  4JEZ A;  5G09 A;  4F5G A;  3MAU A;  4BMK A;  2W7H A;  2E54 A;  1TOJ A;  3TQX A;  5EAA A;  1ASA A;  3NYS A;  1C7N A;  1AAW A;  1D7V A;  1MAP A;  3EZS A;  4O6Z A;  3BWN A;  4Q75 A;  5FT6 A;  1KMK A;  4P7Y A;  1ARI A;  4ZM4 A;  3FD0 A;  3K7Y A;  3AEP A;  4MQP A;  3FDD A;  3HLM A;  1W23 A;  3AEO A;  2CST A;  1EQB A;  4RKD A;  2ZSL A;  2CJD A;  1ASC A;  4K05 A;  3RQ1 A;  4LW2 A;  4MSO A;  4OMA A;  1OHV A;  4RJY A;  1J32 A;  3PDB B;  4UHO A;  2CAN A;  2Z1Y A;  3AEM C;  3FVX A;  3E2Y A;  3NYT A;  3BCX A;  1ZC9 A;  4I8A A;  1ARH A;  2VIB A;  2R2N A;  2VMO A;  3NTJ A;  3QI6 A;  4AZK A;  1AHX A;  2ZUK A;  1PG8 A;  4JF0 A;  1E5F A;  1M6S A;  2C81 A;  4MQQ A;  4H63 Q;  4WP0 A;  3EI9 A;  3FZ7 A;  7AAT A;  3FZ6 A;  3PPL A;  4JF1 A;  3FQ8 A;  3I16 A;  4OBV A;  1BKG A;  3I4J A;  1AMA A;  1QJ5 A;  1AKA A;  4ATQ A;  3PDB A;  4B98 A;  1BJO A;  3ELP A;  1M7Y A;  2W7F A;  4MGR A;  2CH2 A;  5HDM A;  2QLR A;  3KKI A;  2ZY4 A;  2AAT A;  2AY4 A;  3QN6 A;  1TAR A;  2HZP A;  1FG3 A;  3VP6 A;  2Z9X A;  3ECD A;  1D7S A;  1CS1 A;  1YAA A;  5DJ9 A;  3GZD A;  4A0F A;  3DRD A;  2D7Y A;  3GBX A;  3MAF A;  2HP2 A;  3KGX A;  1CJ0 A;  1QIS A;  3LVL B;  3COG A;  4M2K A;  1D2F A;  3LY1 A;  4GSA A;  4WYE A;  4E77 A;  3RCH B;  5E4Z A;  4K2B A;  4OC9 A;  2ZY2 A;  1SPA A;  3NUB A;  2JJG A;  3GJU A;  1B9I A;  2GMU A;  4Y0I A;  3T32 A;  2VMQ A;  3FCR A;  2CH1 A;  1B8G A;  3HVY A;  3W1J A;  5BJ4 A;  1YJZ A;  2JIS A;  3UE8 A;  2HP1 A;  3RCH A;  3FTB A;  2FM1 A;  4IX8 A;  3WKS A;  4JE5 D;  1YOO A;  2XH1 A;  3TFU A;  3D6K A;  2CFB A;  2VI8 A;  1ARG A;  1IX7 A;  1AHF A;  2BI5 A;  3CQ5 A;  4ITG A;  4AZJ A;  3PIU A;  1Z3Z A;  3OP7 A;  4ZSW A;  1AJR A;  3RBF A;  1UU2 A;  4ADC A;  1KKP A;  3ZZK A;  1OXP A;  2VMS A;  3A9X A;  3QBO A;  1D7U A;  2VI9 A;  1LW5 A;  3NUI A;  2VMV A;  3BC8 A;  4CBS A;  3AAT A;  2VGU A;  2PO3 A;  4JE5 A;  1LS3 A;  4W1X A;  3TFT A;  4MY5 A;  3QM2 A;  1ORD A;  4Y0H A;  5G4J A;  3DR7 A;  4A6R A;  1IX8 A;  4OTL A;  1BS0 A;  2D66 A;  3E2Z B;  4RAE A;  5F8V A;  1ARS A;  2CTZ A;  3ATH A;  4JEY A;  4F5I A;  1WST A;  4R5Z A;  2GSA A;  5LHA A;  3H9X A;  1YNU A;  3ZZJ A;  3HT4 A;  3WCN A;  5J8Q A;  3FDB A;  1GCK A;  2O0R A;  1M4N A;  1IJI A;  1D7R A;  1G4V A;  4EB5 A;  1PMO A;  2AY2 A;  2VGT A;  4OT8 A;  1O61 A;  4XAU A;  1DKA A;  1I29 A;  3HMU A;  3JTX A;  1DGD A;  2DKJ A;  3E2Z A;  4FL0 A;  4ISY A;  2VGV A;  3NDN A;  4RIT A;  2VMW A;  1LW4 A;  4AO9 A;  2O7C A;  2C7T A;  1IUG A;  4IW7 A;  4DQ6 A;  1B9H A;  2KFP A;  1LKC A;  1G4X A;  2QMA A;  2R0T A;  1C0N A;  1BQA A;  1XEY A;  2W7L A;  4WBT A;  1IVR A;  4Q31 A;  1Y4I A;  4WYC A;  2VMT A;  3VK3 A;  2YCN A;  3A9Z A;  2D64 A;  1GEW A;  2VYC A;  2YRI A;  2Z67 A;  2ZSM A;  2A1V A;  1GEY A;  3JW9 A;  4EB7 A;  2AY3 A;  1BJ4 A;  3FKD A;  4RKC A;  2BI3 A;  1AKB A;  1DFO A;  3MAD A;  2DGK A;  1BJW A;  5AX8 A;  3G0T A;  2OKJ A;  4ZWV A;  1QGN A;  3FFH A;  4PFN A;  1MLY A;  2YKU A;  3DXW A;  3EUC A;  3AOV A;  4BA4 A;  2W8V A;  2BIG A;  1I43 A;  1ASM A;  1IAY A;  3FZ8 A;  4Q6R A;  3CQ6 A;  2YKV A;  3N75 A;  3PDX A;  1SFF A;  2YKY A;  1GD9 A;  2Z9U A;  1M32 A;  2Z20 A;  3ASA A;  2Q7W A;  1V2E A;  4LW4 A;  1JS6 A;  2VLF A;  1JS3 A;  1RVU A;  3ASB A;  1I41 A;  4F5M A;  3Q8N A;  2YHK A;  1ZOD A;  5K8B A;  3HBX A;  4CXR A;  1AMS A;  5DX5 A;  4ZDO A;  3MEB A;  3HQT A;  4W91 A;  1AHY A;  4M2J A;  1C7O A;  1CQ8 A;  1CL2 A;  3MC6 A;  2BWP A;  2ZYJ A;  2W7M A;  5KTB A;  3F9T A;  1FC4 A;  3B46 A;  1BJO B;  1GEX A;  1TOG A;  2FYF A;  4W5K A;  5F9S A;  1TAS A;  2BWO A;  2V0Y A;  1O69 A;  1SZS A;  1TOK A;  4P3M A;  5EQC A;  4AOA A;  1G7X A;  4M2M A;  4JEW A;  2AY6 A;  2PB0 A;  3NNK A;  4KAM A;  3RBL A;  4A0R A;  3A8U X;  4ZM3 A;  2VIA A;  1LC7 A;  4A72 A;  2HUF A;  3DXV A;  2AY7 A;  3MAF B;  1C4K A;  4DBC A;  4E1O A;  1XI9 A;  2X5D A;  1ASG A;  8AAT A;  2VMP A;  3VOM A;  4F5L A;  3EIB A;  5C6U A;  4A0H A;  2Z61 A;  2VMX A;  1W7M A;  3FVU A;  3W1H A;  1YJS A;  4WLJ A;  4F5J A;  1KL2 A;  3A9Y A;  1YIY A;  1B5P A;  3DU4 A;  4W1W A;  2AY1 A;  3B1D A;  1ASE A;  5EFS A;  1MGV A;  1TOI A;  2QSR A;  2EGY A;  3PGY A;  4K2I A;  9AAT A;  1AMQ A;  5HXX A;  4Q76 A;  2HOR A;  2FQ6 A;  3IF2 A;  3LVK A;  4IXZ A;  1M0N A;  3BV0 A;  1BW0 A;  4K2M A;  3UAK A;  1YIZ A;  1KL1 A;  2W7K A;  2Z9V A;  2GB3 A;  2DGL A;  3JWA A;  1GBN A;  3EI6 A;  1H0C A;  3DR4 A;  4LC3 A;  2NMP A;  1AHE A;  3N4R A;  2ZY3 A;  1X0M A;  4W1V A;  1KMJ A;  4B9B A;  2WK9 A;  4ADE A;  3P1T A;  3AEM A;  2EH6 A;  2WK7 A;  4ADD A;  1W7N A;  2ZJG A;  2BYL A;  3H7F A;  4OYT A;  4LNM A;  4N0B A;  1UU0 A;  1V72 A;  3EI7 A;  2W7I A;  4ATP A;  4WXF A;  2EYQ A;  3BWO A;  3WX9 A;  3N4S A;  4LNL A;  1B4X A;  4WYD A;  4GE7 A;  2PB2 A;  2D65 A;  1MAQ A;  5HHY A;  3ACZ A;  3VAX A;  2WB6 A;  1DTY A;  3BS8 A;  4KXK A;  1ELU A;  3GSB A;  3LVJ A;  3FQA A;  5FT4 A;  4A6T A;  2EZ1 A;  4TV7 A;  3E6G A;  3UWC A;  2EO5 A;  4PFF A;  1O4S A;  3OKS A;  2BIE A;  4GEB A;  2GQN A;  3ELE A;  5FT5 A;  4BHD A;  5JAY A;  1LC5 A;  4GE4 A;  3G8M A;  4ZLV A;  5I92 A;  4XQ2 A;  4AH3 A;  2OKK A;  3FRK A;  1MLZ A;  3F6T A;  2JJH A;  3GWP A;  1RVY A;  4Y0D A;  1AIC A;  4EFF A;  1KKJ A;  4QGR A;  3LG0 A;  1X28 A;  4WYG A;  1MDZ A;  1W7L A;  1AX4 A;  4WYF A;  1TAT A;  1C9C A;  4HF8 A;  3QGU A;  1OAT A;  1UKJ A;  1IAX A;  2DR1 A;  4ZSY A;  3BWN C;  2CY8 A;  2V1P A;  3RUY A;  1ASF A;  2TPL A;  1SZK A;  2YKX A;  3BCB A;  3II0 A;  4XEW A;  2X3L A;  2G6W A;  3ZRR A;  3TAT A;  3DOD A;  1S09 A;  2HUI A;  1AMR A;  5E3K A;  5M4B A;  3E77 A;  3NU8 A;  4WXG A;  2DKB A;  3WGB A;  1GC3 A;  2HOZ A;  5EAV A;  3F0H A;  5FT8 A;  1I48 A;  4IY7 A;  4ZDL A;  3VK2 A;  5G4I A;  1OHY A;  3GET A;  2ZY5 A;  3R9A A;  3PD6 B;  1S0A A;  2FNU A;  4E3Q A;  4UHN A;  2ZC0 A;  2BHX A;  3GR9 A;  3LV2 A;  3NYU A;  4GRX A;  1WYT B;  1RV4 A;  2VGW A;  1MDO A;  2OGE A;  2W8W A;  4H51 A;  4UHM A;  4A00 A;  1BQD A;  2ZP7 A;  2XBN A;  4XJP A;  2JJF A;  3EI8 A;  2QBT A;  2X8U A;  2DGM A;  1V2F A;  1BJN A;  2R5E A;  1PFF A;  3AEL A;  3PD6 A;  3HL2 A;  3BB8 A;  2BYJ A;  1DJU A;  1WYU A;  5TF5 A;  1QZ9 A;  4R2N A;  4HVK A;  2F8J A;  1WYT A;  1O62 A;  1DGE A;  2E7U A;  3WCO A;  2YRR A;  2W8T A;  1LC8 A;  2BWN A;  1PMM A;  1Z7D A;  2VLH A;  1DJ9 A;  1RV3 A;  3N0L A;  3PJ0 A;  3VK4 A;  3N7N A;  4L0O A;  1N8P A;  2AY9 A;  2EZ2 A;  3AV7 A;  3EIA A;  1EJI A;  4OBU A;  1AJS B;  1W3U A;  4RM1 A;  3NU7 A;  4ZAH A;  3AEN B;  3ZRP A;  1CZC A;  1WKG A;  2YCT A;  1QIR A;  1IX6 A;  2DOU A;  2C0R A;  3NRA A;  4XJM A;  1IBJ A;  4R8D A;  2HOX A;  2VMY A;  2YOB A;  1GDE A;  1E5E A;  5BJ3 A;  3QHX A;  4UQV A;  3AEJ C;  3QPG A;  2C44 A;  2YCP A;  4WXB A;  2VMZ A;  1V2D A;  1AJS A;  1KAF A;  1AY4 A;  1AKC A;  3AEN A;  3JU7 A;  4F5K A;  3R4T A;  4CVQ A;  5EIG B;  1AHG A;  1ELQ A;  3KE3 A;  1VEF A;  4ZDP A;  4GE9 A;  4MKJ A;  2OAT A;  2W7E A;  3MKJ A;  2FKI A;  1AAM A;  4GDY A;  1FG7 A;  3IHJ A;  3ISL A;  4A6U A;  4DGT A;  3DZZ A;  1QJ3 A;  2X5F A;  2W8U A;  3B1E A;  5EUN A;  3CBF A;  1X2A A;  5G0A A;  4PVF A;  5G2Q A;  4NOG A;  4XJO A;  4BA5 A;  3B1C A;  4RJ0 A;  5EIG A;  2JGT A;  4E3R A;  1ASL A;  2W7G A;  4ZWM A;  4JEV A;  4J5U A;  1ASB A;  4RIZ A;  4XK1 A;  1AY8 A;  2HUU A;  3PA9 A;  4EMY A;  3WKR A;  1EG5 A;  2BI1 A;  2CIN A;  3CAI A;  1CZE A;  3N5M A;  1GC4 A;  2CB1 A;  2AEU A;  3K40 A;  3USF A;  4F4E A;  5M4D A;  4W8I A;  3FFR A;  3MBB A;  2OQX A;  3WGC A;  4WB0 B;  3ZRQ A;  2CJG A;  1SVV A;  4A0G A;  2BI9 A;  4J8L A;  3LVM A;  3HDO A;  2AY5 A;  3KGW A;  1GC0 A;  3NX3 A;  4JEX A;  3WY7 A;  1CQ6 A;  1G7W A;  1AIA A;  3FSL A;  1M0Q A;  1CL1 A;  5G2P A;  2VMR A;  4FFC A;  3FQ7 A;  2O1B A; 
#chains in the Genus database with same CATH homology
 2FNI A;  5M49 A;  1GC2 A;  2D5Y A;  4IYO B;  1ECX A;  4ZAS A;  3AEJ A;  4CBR A;  3WZF A;  3AOW A;  3BN1 A;  4LNJ A;  1ZOB A;  4WB0 A;  4AO4 A;  4PIW A;  2CJH A;  1J04 A;  1MDX A;  4UOY A;  5DB5 A;  1JG8 A;  1T3I A;  4CXQ A;  3W1I A;  2QB2 A;  1N2T A;  3EI5 A;  3JZL A;  4ITX A;  5LH9 A;  1VP4 A;  4ADB A;  4U2H A;  1DJE A;  1TOE A;  5M46 A;  3EZ1 A;  3K28 A;  2AEV A;  3E2F A;  1X29 A;  4IYO A;  4TMR A;  4U1T A;  3H14 A;  2WKA A;  3L44 A;  1OHW A;  2VMU A;  4KYO A;  1M0P A;  2QA3 A;  3PAA A;  4R5F A;  1AY5 A;  2W7J A;  3LWS A;  4N0W A;  2AY8 A;  2G7J A;  1M0O A;  4BQ0 A;  2OGA A;  1N31 A;  1S08 A;  1LK9 A;  1SZU A;  2W8J A;  3FVS A;  2ORD A;  4IXO A;  3RI6 A;  1H1C A;  2EPJ A;  1U08 A;  5E5I A;  2FN6 A;  2JG2 A;  2GMS A;  1C7G A;  3G7Q A;  4WYA A;  3DYD A;  3P6K A;  2E7I A;  2BIA A;  3N4X A;  3MC6 C;  1VJO A;  3WLX A;  1JF9 A;  2RFV A;  3JWB A;  1BT4 A;  1TPL A;  2D63 A;  4WD2 A;  2WK8 A;  1S07 A;  5IWQ A;  1B5O A;  2R5C B;  3L8A A;  4OCA A;  1OXO A;  1WYU B;  2D61 A;  2W7D A;  2Z9W A;  3TCM A;  5DJ1 A;  1SF2 A;  3DC1 A;  1YJY A;  1ASN A;  4TN4 A;  2Z1Z A;  4EU1 A;  1WKH A;  4F5H A;  2D7Z A;  1AIB A;  1ART A;  4MQR A;  4MKK A;  4WLH A;  4RLG A;  4F5F A;  3A2B A;  1WYV B;  3BCA A;  1P3W A;  1S06 A;  3GZC A;  5D5S A;  2R5C A;  2VGZ A;  4XJL A;  5D95 A;  5EUE A;  1QIT A;  1UU1 A;  1CQ7 A;  2BI2 A;  2HOY A;  3GZD C;  4IXS A;  5EUD A;  2E7J A;  3E9K A;  2JJE A;  1ASD A;  1WYV A;  2QB3 A;  2VMN A;  2BKW A;  2VGS A;  3B8X A;  3M5U A;  3I5T A;  3CQ4 A;  4JEZ A;  5G09 A;  4F5G A;  3MAU A;  4BMK A;  2W7H A;  2E54 A;  1TOJ A;  3TQX A;  5EAA A;  1ASA A;  3NYS A;  1C7N A;  1AAW A;  1D7V A;  1MAP A;  3EZS A;  4O6Z A;  3BWN A;  4Q75 A;  5FT6 A;  1KMK A;  4P7Y A;  1ARI A;  4ZM4 A;  3FD0 A;  3K7Y A;  3AEP A;  4MQP A;  3FDD A;  3HLM A;  1W23 A;  3AEO A;  2CST A;  1EQB A;  4RKD A;  2ZSL A;  2CJD A;  1ASC A;  4K05 A;  3RQ1 A;  4LW2 A;  4MSO A;  4OMA A;  1OHV A;  4RJY A;  1J32 A;  3PDB B;  4UHO A;  2CAN A;  2Z1Y A;  3AEM C;  3FVX A;  3E2Y A;  3NYT A;  3BCX A;  1ZC9 A;  4I8A A;  1ARH A;  2VIB A;  2R2N A;  2VMO A;  3NTJ A;  3QI6 A;  4AZK A;  1AHX A;  2ZUK A;  1PG8 A;  4JF0 A;  1E5F A;  1M6S A;  2C81 A;  4MQQ A;  4H63 Q;  4WP0 A;  3EI9 A;  3FZ7 A;  7AAT A;  3FZ6 A;  3PPL A;  4JF1 A;  3FQ8 A;  3I16 A;  4OBV A;  1BKG A;  3I4J A;  1AMA A;  1QJ5 A;  1AKA A;  4ATQ A;  3PDB A;  4B98 A;  1BJO A;  3ELP A;  1M7Y A;  2W7F A;  4MGR A;  2CH2 A;  5HDM A;  2QLR A;  3KKI A;  2ZY4 A;  2AAT A;  2AY4 A;  3QN6 A;  1TAR A;  2HZP A;  1FG3 A;  3VP6 A;  2Z9X A;  3ECD A;  1D7S A;  1CS1 A;  1YAA A;  5DJ9 A;  3GZD A;  4A0F A;  3DRD A;  2D7Y A;  3GBX A;  3MAF A;  2HP2 A;  3KGX A;  1CJ0 A;  1QIS A;  3LVL B;  3COG A;  4M2K A;  1D2F A;  3LY1 A;  4GSA A;  4WYE A;  4E77 A;  3RCH B;  5E4Z A;  4K2B A;  4OC9 A;  2ZY2 A;  1SPA A;  3NUB A;  2JJG A;  3GJU A;  1B9I A;  2GMU A;  4Y0I A;  3T32 A;  2VMQ A;  3FCR A;  2CH1 A;  1B8G A;  3HVY A;  3W1J A;  5BJ4 A;  1YJZ A;  2JIS A;  3UE8 A;  2HP1 A;  3RCH A;  3FTB A;  2FM1 A;  4IX8 A;  3WKS A;  4JE5 D;  1YOO A;  2XH1 A;  3TFU A;  3D6K A;  2CFB A;  2VI8 A;  1ARG A;  1IX7 A;  1AHF A;  2BI5 A;  3CQ5 A;  4ITG A;  4AZJ A;  3PIU A;  1Z3Z A;  3OP7 A;  4ZSW A;  1AJR A;  3RBF A;  1UU2 A;  4ADC A;  1KKP A;  3ZZK A;  1OXP A;  2VMS A;  3A9X A;  3QBO A;  1D7U A;  2VI9 A;  1LW5 A;  3NUI A;  2VMV A;  3BC8 A;  4CBS A;  3AAT A;  2VGU A;  2PO3 A;  4JE5 A;  1LS3 A;  4W1X A;  3TFT A;  4MY5 A;  3QM2 A;  1ORD A;  4Y0H A;  5G4J A;  3DR7 A;  4A6R A;  1IX8 A;  4OTL A;  1BS0 A;  2D66 A;  3E2Z B;  4RAE A;  5F8V A;  1ARS A;  2CTZ A;  3ATH A;  4JEY A;  4F5I A;  1WST A;  4R5Z A;  2GSA A;  5LHA A;  3H9X A;  1YNU A;  3ZZJ A;  3HT4 A;  3WCN A;  5J8Q A;  3FDB A;  1GCK A;  2O0R A;  1M4N A;  1IJI A;  1D7R A;  1G4V A;  4EB5 A;  1PMO A;  2AY2 A;  2VGT A;  4OT8 A;  1O61 A;  4XAU A;  1DKA A;  1I29 A;  3HMU A;  3JTX A;  1DGD A;  2DKJ A;  3E2Z A;  4FL0 A;  4ISY A;  2VGV A;  3NDN A;  4RIT A;  2VMW A;  1LW4 A;  4AO9 A;  2O7C A;  2C7T A;  1IUG A;  4IW7 A;  4DQ6 A;  1B9H A;  2KFP A;  1LKC A;  1G4X A;  2QMA A;  2R0T A;  1C0N A;  1BQA A;  1XEY A;  2W7L A;  4WBT A;  1IVR A;  4Q31 A;  1Y4I A;  4WYC A;  2VMT A;  3VK3 A;  2YCN A;  3A9Z A;  2D64 A;  1GEW A;  2VYC A;  2YRI A;  2Z67 A;  2ZSM A;  2A1V A;  1GEY A;  3JW9 A;  4EB7 A;  2AY3 A;  1BJ4 A;  3FKD A;  4RKC A;  2BI3 A;  1AKB A;  1DFO A;  3MAD A;  2DGK A;  1BJW A;  5AX8 A;  3G0T A;  2OKJ A;  4ZWV A;  1QGN A;  3FFH A;  4PFN A;  1MLY A;  2YKU A;  3DXW A;  3EUC A;  3AOV A;  4BA4 A;  2W8V A;  2BIG A;  1I43 A;  1ASM A;  1IAY A;  3FZ8 A;  4Q6R A;  3CQ6 A;  2YKV A;  3N75 A;  3PDX A;  1SFF A;  2YKY A;  1GD9 A;  2Z9U A;  1M32 A;  2Z20 A;  3ASA A;  2Q7W A;  1V2E A;  4LW4 A;  1JS6 A;  2VLF A;  1JS3 A;  1RVU A;  3ASB A;  1I41 A;  4F5M A;  3Q8N A;  2YHK A;  1ZOD A;  5K8B A;  3HBX A;  4CXR A;  1AMS A;  5DX5 A;  4ZDO A;  3MEB A;  3HQT A;  4W91 A;  1AHY A;  4M2J A;  1C7O A;  1CQ8 A;  1CL2 A;  3MC6 A;  2BWP A;  2ZYJ A;  2W7M A;  5KTB A;  3F9T A;  1FC4 A;  3B46 A;  1BJO B;  1GEX A;  1TOG A;  2FYF A;  4W5K A;  5F9S A;  1TAS A;  2BWO A;  2V0Y A;  1O69 A;  1SZS A;  1TOK A;  4P3M A;  5EQC A;  4AOA A;  1G7X A;  4M2M A;  4JEW A;  2AY6 A;  2PB0 A;  3NNK A;  4KAM A;  3RBL A;  4A0R A;  3A8U X;  4ZM3 A;  2VIA A;  1LC7 A;  4A72 A;  2HUF A;  3DXV A;  2AY7 A;  3MAF B;  1C4K A;  4DBC A;  4E1O A;  1XI9 A;  2X5D A;  1ASG A;  8AAT A;  2VMP A;  3VOM A;  4F5L A;  3EIB A;  5C6U A;  4A0H A;  2Z61 A;  2VMX A;  1W7M A;  3FVU A;  3W1H A;  1YJS A;  4WLJ A;  4F5J A;  1KL2 A;  3A9Y A;  1YIY A;  1B5P A;  3DU4 A;  4W1W A;  2AY1 A;  3B1D A;  1ASE A;  5EFS A;  1MGV A;  1TOI A;  2QSR A;  2EGY A;  3PGY A;  4K2I A;  9AAT A;  1AMQ A;  5HXX A;  4Q76 A;  2HOR A;  2FQ6 A;  3IF2 A;  3LVK A;  4IXZ A;  1M0N A;  3BV0 A;  1BW0 A;  4K2M A;  3UAK A;  1YIZ A;  1KL1 A;  2W7K A;  2Z9V A;  2GB3 A;  2DGL A;  3JWA A;  1GBN A;  3EI6 A;  1H0C A;  3DR4 A;  4LC3 A;  2NMP A;  1AHE A;  3N4R A;  2ZY3 A;  1X0M A;  4W1V A;  1KMJ A;  4B9B A;  2WK9 A;  4ADE A;  3P1T A;  3AEM A;  2EH6 A;  2WK7 A;  4ADD A;  1W7N A;  2ZJG A;  2BYL A;  3H7F A;  4OYT A;  4LNM A;  4N0B A;  1UU0 A;  1V72 A;  3EI7 A;  2W7I A;  4ATP A;  4WXF A;  2EYQ A;  3BWO A;  3WX9 A;  3N4S A;  4LNL A;  1B4X A;  4WYD A;  4GE7 A;  2PB2 A;  2D65 A;  1MAQ A;  5HHY A;  3ACZ A;  3VAX A;  2WB6 A;  1DTY A;  3BS8 A;  4KXK A;  1ELU A;  3GSB A;  3LVJ A;  3FQA A;  5FT4 A;  4A6T A;  2EZ1 A;  4TV7 A;  3E6G A;  3UWC A;  2EO5 A;  4PFF A;  1O4S A;  3OKS A;  2BIE A;  4GEB A;  2GQN A;  3ELE A;  5FT5 A;  4BHD A;  5JAY A;  1LC5 A;  4GE4 A;  3G8M A;  4ZLV A;  5I92 A;  4XQ2 A;  4AH3 A;  2OKK A;  3FRK A;  1MLZ A;  3F6T A;  2JJH A;  3GWP A;  1RVY A;  4Y0D A;  1AIC A;  4EFF A;  1KKJ A;  4QGR A;  3LG0 A;  1X28 A;  4WYG A;  1MDZ A;  1W7L A;  1AX4 A;  4WYF A;  1TAT A;  1C9C A;  4HF8 A;  3QGU A;  1OAT A;  1UKJ A;  1IAX A;  2DR1 A;  4ZSY A;  3BWN C;  2CY8 A;  2V1P A;  3RUY A;  1ASF A;  2TPL A;  1SZK A;  2YKX A;  3BCB A;  3II0 A;  4XEW A;  2X3L A;  2G6W A;  3ZRR A;  3TAT A;  3DOD A;  1S09 A;  2HUI A;  1AMR A;  5E3K A;  5M4B A;  3E77 A;  3NU8 A;  4WXG A;  2DKB A;  3WGB A;  1GC3 A;  2HOZ A;  5EAV A;  3F0H A;  5FT8 A;  1I48 A;  4IY7 A;  4ZDL A;  3VK2 A;  5G4I A;  1OHY A;  3GET A;  2ZY5 A;  3R9A A;  3PD6 B;  1S0A A;  2FNU A;  4E3Q A;  4UHN A;  2ZC0 A;  2BHX A;  3GR9 A;  3LV2 A;  3NYU A;  4GRX A;  1WYT B;  1RV4 A;  2VGW A;  1MDO A;  2OGE A;  2W8W A;  4H51 A;  4UHM A;  4A00 A;  1BQD A;  2ZP7 A;  2XBN A;  4XJP A;  2JJF A;  3EI8 A;  2QBT A;  2X8U A;  2DGM A;  1V2F A;  1BJN A;  2R5E A;  1PFF A;  3AEL A;  3PD6 A;  3HL2 A;  3BB8 A;  2BYJ A;  1DJU A;  1WYU A;  5TF5 A;  1QZ9 A;  4R2N A;  4HVK A;  2F8J A;  1WYT A;  1O62 A;  1DGE A;  2E7U A;  3WCO A;  2YRR A;  2W8T A;  1LC8 A;  2BWN A;  1PMM A;  1Z7D A;  2VLH A;  1DJ9 A;  1RV3 A;  3N0L A;  3PJ0 A;  3VK4 A;  3N7N A;  4L0O A;  1N8P A;  2AY9 A;  2EZ2 A;  3AV7 A;  3EIA A;  1EJI A;  4OBU A;  1AJS B;  1W3U A;  4RM1 A;  3NU7 A;  4ZAH A;  3AEN B;  3ZRP A;  1CZC A;  1WKG A;  2YCT A;  1QIR A;  1IX6 A;  2DOU A;  2C0R A;  3NRA A;  4XJM A;  1IBJ A;  4R8D A;  2HOX A;  2VMY A;  2YOB A;  1GDE A;  1E5E A;  5BJ3 A;  3QHX A;  4UQV A;  3AEJ C;  3QPG A;  2C44 A;  2YCP A;  4WXB A;  2VMZ A;  1V2D A;  1AJS A;  1AY4 A;  1AKC A;  3AEN A;  3JU7 A;  4F5K A;  3R4T A;  4CVQ A;  5EIG B;  1AHG A;  1ELQ A;  3KE3 A;  1VEF A;  4ZDP A;  4GE9 A;  4MKJ A;  2OAT A;  2W7E A;  3MKJ A;  2FKI A;  1AAM A;  4GDY A;  1FG7 A;  3IHJ A;  3ISL A;  4A6U A;  4DGT A;  3DZZ A;  1QJ3 A;  2X5F A;  2W8U A;  3B1E A;  5EUN A;  3CBF A;  1X2A A;  5G0A A;  4PVF A;  5G2Q A;  4NOG A;  4XJO A;  4BA5 A;  3B1C A;  4RJ0 A;  5EIG A;  2JGT A;  4E3R A;  1ASL A;  2W7G A;  4ZWM A;  4JEV A;  4J5U A;  1ASB A;  4RIZ A;  4XK1 A;  1AY8 A;  2HUU A;  3PA9 A;  4EMY A;  3WKR A;  1EG5 A;  2BI1 A;  2CIN A;  3CAI A;  1CZE A;  3N5M A;  1GC4 A;  2CB1 A;  2AEU A;  3K40 A;  3USF A;  4F4E A;  5M4D A;  4W8I A;  3FFR A;  3MBB A;  2OQX A;  3WGC A;  4WB0 B;  3ZRQ A;  2CJG A;  1SVV A;  4A0G A;  2BI9 A;  4J8L A;  3LVM A;  3HDO A;  2AY5 A;  3KGW A;  1GC0 A;  3NX3 A;  4JEX A;  3WY7 A;  1CQ6 A;  1G7W A;  1AIA A;  3FSL A;  1M0Q A;  1CL1 A;  5G2P A;  2VMR A;  4FFC A;  3FQ7 A;  2O1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...