4A6TA

Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp
Total Genus 176
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
176
sequence length
454
structure length
454
Chain Sequence
RTTSQWRELDAAHHLHPFTDTASLNQAGARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEELPFYNTFFKTTHPAVVELSSLLAEVTPAGFDRVFYTNSGSESVDTMIRMVRRYWDVQGKPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGDLPIPGMAHIEQPWWYKHGKDMTPDEFGVVAARWLEEKILEIGADKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFGRTGEWFGHQHFGFQPDLFTAAKGLSSGYLPIGAVFVGKRVAEGLIAGGDFNHGFTYSGHPVCAAVAHANVAALRDEGIVQRVKDDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAKRELFPDFGEIGTLCRDIFFRNNLIMRACGDHIVSAPPLVMTRAEVDEMLAVAERCLEEFEQTLKARGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structures of the Chromobacterium Violaceum Omega-Transaminase Reveal Major Structural Rearrangements Upon Binding of Coenzyme Plp.
pubmed doi rcsb
source organism Chromobacterium violaceum
molecule tags Transferase
molecule keywords OMEGA TRANSAMINASE
total genus 176
structure length 454
sequence length 454
chains with identical sequence B, C, D
ec nomenclature ec 2.6.1.18: Beta-alanine--pyruvate transaminase.
pdb deposition date 2011-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00202 Aminotran_3 Aminotransferase class-III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4a6tA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 4a6tA01
4CXRA 1D2FA 2JG2A 4JEZA 1ARHA 4UOYA 5K8BA 4BQ0A 3L44A 3BWNA 3K7YA 5E4ZA 2BYJA 2AEVA 1LC8A 4A0GA 3PJ0A 2HOYA 2D65A 3QI6A 1YAAA 3W1IA 1ELUA 1UU1A 5DJ9A 3QHXA 1AMSA 2ZSMA 2ZC0A 1SZUA 2O0RA 4GEBA 2AY1A 3MADA 2CANA 3RCHA 4F5HA 3CQ6A 3NX3A 4RIZA 4ZWMA 2VGWA 2X8UA 3R4TA 4Y0DA 4ZAHA 3N0LA 1ASLA 2GMSA 3VP6A 3QPGA 2BI2A 2R5EA 1Z7DA 4RAEA 2VMTA 3OKSA 1E5EA 4UHMA 1AIBA 1SFFA 1BQDA 4IYOA 4K2IA 3WCNA 4ITXA 1TOEA 1AIAA 1AJRA 3NYUA 2ZY2A 3ASAA 3EZSA 3B8XA 1ZODA 2E54A 2FN6A 4IW7A 2CFBA 4RM1A 1CJ0A 4WXBA 2VMYA 1W23A 1DFOA 4LW4A 3MAUA 5TF5A 4DBCA 1X29A 4XK1A 1AY8A 2R0TA 4WYGA 4IY7A 1B5OA 1LK9A 4E77A 2FNIA 4NOGA 2W7LA 1VEFA 1TOGA 2BI3A 3JWAA 2F8JA 4AH3A 1C0NA 1W7NA 2DKJA 1BJ4A 3ZRRA 1CQ7A 4WYEA 4WB0A 3B1DA 4U1TA 1I29A 1IX7A 2BI5A 2YKUA 2DGMA 1GBNA 4JE5D 1O61A 2VGUA 4UQVA 4W1VA 5AX8A 3WKSA 4A0HA 1D7RA 2VIAA 3E9KA 1ASBA 3HT4A 1GD9A 4KAMA 3H14A 3AOWA 2ZSLA 3VAXA 1AHYA 3ZZJA 1QJ5A 1AY4A 4F5FA 1M4NA 3EI5A 2E7IA 5IWQA 2D61A 4UHNA 8AATA 1MDOA 4GSAA 1MAPA 3PDXA 5J8QA 1E5FA 2Z9VA 3ECDA 3F9TA 3VOMA 1AKCA 1RV3A 3E2ZA 3FDDA 3JW9A 1OATA 2QB3A 4LNJA 1C9CA 1JF9A 2AY2A 3FKDA 4ZSYA 4AO4A 1W3UA 2VMUA 4FL0A 3VK3A 1MDZA 4FFCA 4JE5A 2VMNA 1O4SA 3EI8A 3NYTA 2W8WA 2ORDA 2CTZA 3FFRA 1SPAA 2CY8A 4XJPA 4OBUA 3AEMA 2OGEA 2X3LA 3AENB 4AO9A 2VIBA 4RKDA 1TASA 3L8AA 1BQAA 1W7LA 1KL1A 1YNUA 2GMUA 3FVSA 3TFUA 1UU0A 2CH2A 4WB0B 3WGBA 1M0QA 2CSTA 3MEBA 4ISYA 1BT4A 4OCAA 5G2PA 2HOZA 9AATA 2D5YA 3KE3A 4XEWA 3TATA 2OKKA 1AHFA 1FG7A 3FQ8A 5D5SA 2W7MA 5LHAA 1I43A 3NDNA 1M0OA 3ZRPA 3H7FA 2BI9A 2GB3A 1IJIA 2TPLA 2DKBA 1TPLA 3QN6A 1S08A 4F5LA 1IUGA 2HZPA 3K40A 5EIGB 1V2EA 4WXGA 3WKRA 3G7QA 1D7VA 1JS3A 4O6ZA 3AEPA 1KKJA 4WXFA 3BWNC 3KGXA 2QBTA 2CINA 4Y0IA 1OXPA 3E6GA 1WYUB 4ADEA 5C6UA 3AEMC 1T3IA 3VK4A 1XI9A 4L0OA 4E3QA 4J8LA 2YOBA 2BWPA 4AZKA 4E3RA 2V0YA 2AY6A 3RBLA 2BIAA 3LV2A 1LS3A 1AHGA 2R2NA 1J32A 3AEJC 5EAAA 4QGRA 1AKBA 1OHVA 1G4VA 1TARA 2C0RA 4MQRA 4EU1A 2VMQA 1G7XA 2WK9A 1OXOA 3FZ8A 4ADCA 3NTJA 2FM1A 2D7YA 3LVLB 1O62A 1YIZA 2VMVA 5FT6A 5G4IA 1DTYA 2BHXA 3AOVA 4JEVA 4KXKA 4EB5A 4CBRA 3MC6A 3PDBA 3HDOA 2VGZA 3DXWA 2QLRA 4ADBA 4A6TA 3ELPA 4Q6RA 2AY5A 1DGEA 2AEUA 3MAFA 4IXSA 4LC3A 1ZOBA 4LNMA 1WYVB 4P7YA 1LW5A 1WSTA 4IXOA 4ZM3A 4F5JA 4WYCA 5D95A 2DGLA 4A6UA 1X28A 3PGYA 3RBFA 3TCMA 1KKPA 3FFHA 3MBBA 2JJFA 4K2MA 4ADDA 1SZKA 2HUFA 3FVUA 1FG3A 3E2FA 4N0BA 3AEJA 2FYFA 4ZM4A 1UU2A 3UE8A 5M4DA 3NUIA 2EH6A 2W7EA 4JEYA 4BMKA 1PFFA 1I41A 2WKAA 2CH1A 3FVXA 1JG8A 4W5KA 1S09A 1QZ9A 1GEWA 3A9XA 1DJEA 3FQ7A 3LWSA 4TV7A 2EZ1A 1YJZA 4N0WA 3EI9A 4MY5A 2W7FA 4IYOB 2JGTA 4PVFA 1Z3ZA 3GBXA 2Z1YA 4RITA 1AICA 4F5IA 1AJSA 3LVJA 3MAFB 2W7KA 3DZZA 3EI6A 2YRIA 3ELEA 3GSBA 1PMMA 3HLMA 4Q76A 3LVKA 4XJOA 1MGVA 2QB2A 2YHKA 1LW4A 4P3MA 3FTBA 3FQAA 3LG0A 1CS1A 1CZCA 1EQBA 3UWCA 3TQXA 2EGYA 1LC5A 1B8GA 4K2BA 4BHDA 2GQNA 4IX8A 1B4XA 2D63A 3DU4A 1GC3A 3W1HA 2BI1A 3FRKA 4ZWVA 1V2FA 2JJHA 4A0RA 4WP0A 3WGCA 3F6TA 1IX8A 3HL2A 5EAVA 2CJHA 5EUNA 4E1OA 4MQQA 4HVKA 2YCPA 1CZEA 2D66A 1EJIA 1ARTA 3ATHA 3MKJA 2VLFA 3AV7A 1GEXA 1AMQA 2O1BA 2ZUKA 1JS6A 4OTLA 4RJYA 4AZJA 3USFA 1I48A 4UHOA 3PDBB 4EFFA 2VMRA 2HOXA 7AATA 3COGA 1ASGA 2Z9XA 2E7UA 3JZLA 1YIYA 1AX4A 2W7DA 1ORDA 2VMSA 1C7NA 2DR1A 4ZDLA 2AY3A 4HF8A 2C81A 4MSOA 4OC9A 1BS0A 3DODA 2W7JA 2EZ2A 4JF1A 1ZC9A 5FT8A 3HVYA 4XAUA 3DRDA 1M32A 1LKCA 3LY1A 4ZASA 4EMYA 1GC4A 3E2ZB 3FCRA 2NMPA 1AY5A 3KGWA 1IVRA 4F5GA 2EO5A 5DX5A 3I5TA 2FNUA 4R2NA 1QJ3A 1YJSA 1YOOA 3A8UX 4M2JA 4ATQA 1SF2A 3GZDC 4B9BA 1VJOA 3HMUA 1MAQA 3GWPA 3GZDA 3G0TA 1AHEA 1SVVA 3WLXA 2AY8A 1WYUA 2YCTA 1M6SA 1W7MA 1B9HA 4GDYA 4GE4A 4WLHA 4J5UA 3MC6C 4W1XA 5JAYA 4H51A 1X2AA 3ASBA 2G6WA 4PIWA 2VMWA 1ARSA 3DR4A 1QIRA 3FZ7A 1BJWA 1ASFA 1C4KA 2JISA 2JJGA 3BS8A 1IAYA 1S07A 2BYLA 3AATA 5FT4A 5HXXA 3AEOA 2VGTA 1U08A 4OYTA 2OGAA 4ZSWA 4CVQA 2Z20A 3NNKA 2Z9WA 5EIGA 1BW0A 5M46A 2PO3A 1AAWA 4ZDPA 1S0AA 5I92A 4XJLA 3I16A 2Z9UA 1ASNA 4ITGA 3ZZKA 2W8TA 4A6RA 5EUDA 4XJMA 3GZCA 1MDXA 3T32A 3PIUA 4M2MA 4OT8A 1KL2A 2BKWA 4U2HA 1ASCA 4ATPA 3PD6A 1RVYA 3A9ZA 1PG8A 4WD2A 2X5DA 5F8VA 3BCXA 3ACZA 1KMKA 2BWOA 3W1JA 2BIGA 5G0AA 4CXQA 2BIEA 1MLYA 3DC1A 2VLHA 2XH1A 5BJ3A 3HBXA 2C44A 4F4EA 3IF2A 3GR9A 3TFTA 1XEYA 2YKYA 1ASMA 3CBFA 3CQ5A 3RCHB 2VI9A 1IX6A 1BJOA 3WZFA 2V1PA 5F9SA 4MQPA 2AATA 5EUEA 5HDMA 4AOAA 2GSAA 4GE9A 1Y4IA 2O7CA 1WYTB 1TATA 3JTXA 1H1CA 1IBJA 2D64A 4JEWA 3D6KA 2W7IA 1CL2A 3GETA 4WLJA 2ZY5A 1LC7A 4R5FA 1ECXA 2PB0A 1VP4A 3NU7A 3E77A 3E2YA 1UKJA 3EUCA 3N75A 2AY7A 4ZLVA 2PB2A 4GRXA 1BKGA 2ZP7A 1PMOA 1H0CA 3RI6A 1ARGA 1DKAA 1EG5A 3BCBA 3VK2A 2W7HA 1GDEA 3P1TA 5M49A 5EQCA 3QM2A 2YCNA 2Z67A 4JEXA 3EZ1A 1C7GA 4A00A 2AY9A 3NU8A 2OKJA 2JJEA 4M2KA 3IHJA 1IAXA 2OQXA 2CJDA 1CQ8A 2HP2A 1G7WA 2QA3A 5G4JA 3AENA 4LNLA 2WK7A 4ZDOA 4I8AA 3LVMA 3DR7A 4Y0HA 1RV4A 3DYDA 4WYDA 1D7SA 3BN1A 2VMZA 1DJUA 1S06A 4KYOA 2QMAA 4A0FA 3A9YA 1GC2A 4W1WA 3JU7A 1WYTA 3OP7A 3FZ6A 1AJSB 2VMXA 3FD0A 3ISLA 3RQ1A 3KKIA 5M4BA 1SZSA 1BJOB 4XQ2A 5G09A 1WYVA 3GJUA 1TOJA 1M0PA 3NUBA 4EB7A 2CB1A 2YKVA 4PFNA 4OBVA 2ZY4A 4R8DA 1KMJA 1X0MA 1DJ9A 2WK8A 4TMRA 5HHYA 1ELQA 3AELA 3BB8A 5E3KA 3B1EA 2EPJA 2DGKA 2X5FA 1G4XA 3N5MA 3DXVA 1RVUA 3I4JA 1M7YA 3PD6B 3ZRQA 2E7JA 1B5PA 2Z1ZA 2VMPA 5DB5A 4BA4A 1P3WA 4Q75A 3UAKA 2W7GA 4WYFA 3QBOA 3EIAA 3HQTA 2W8UA 1TOKA 2ZYJA 3PPLA 1AAMA 4LW2A 2C7TA 4OMAA 4RLGA 3WCOA 2XBNA 2HORA 3F0HA 4PFFA 1AHXA 1OHYA 2YKXA 3WY7A 3A2BA 4DQ6A 2R5CA 3CQ4A 3BCAA 1N31A 3PAAA 3B1CA 1TOIA 2FQ6A 5LH9A 1M0NA 2VYCA 4B98A 1QITA 3G8MA 2VMOA 2D7ZA 4R5ZA 1QGNA 4TN4A 5EFSA 3NYSA 2RFVA 1AMRA 1V72A 4GE7A 5DJ1A 4A72A 1QISA 3PA9A 3QGUA 1BJNA 3FSLA 2HP1A 2VGVA 4MKJA 1ASDA 2YRRA 1WKHA 1ASAA 3EI7A 5FT5A 1O69A 2Q7WA 3WX9A 5BJ4A 1V2DA 1CQ6A 3II0A 3BWOA 4CBSA 1ASEA 1C7OA 2W8JA 1J04A 3P6KA 2HUIA 1CL1A 2CJGA 4F5MA 4DGTA 1AKAA 1N2TA 4JF0A 1B9IA 4MKKA 3EIBA 4BA5A 1GC0A 1MLZA 2BWNA 2OATA 4WYAA 3NRAA 1ARIA 4RKCA 1AMAA 5G2QA 1FC4A 2Z61A 4WBTA 4IXZA 3R9AA 3CAIA 3M5UA 2ZY3A 1GCKA 1DGDA 4RJ0A 3BC8A 2VI8A 3FDBA 2VGSA 4F5KA 2DOUA 2AY4A 1YJYA 2HUUA 4W8IA 1OHWA 2ZJGA 5E5IA 1D7UA 1WKGA 3K28A 4Q31A 3RUYA 3BV0A 3JWBA 4MGRA 1GEYA 3B46A 2W8VA 4W91A 2R5CB 1N8PA 3Q8NA
chains in the Genus database with same CATH superfamily
4CXRA 1D2FA 2JG2A 4JEZA 1ARHA 4UOYA 5K8BA 4BQ0A 3L44A 3BWNA 3K7YA 5E4ZA 2BYJA 2AEVA 1LC8A 4A0GA 3PJ0A 2HOYA 2D65A 3QI6A 1YAAA 3W1IA 1ELUA 1UU1A 5DJ9A 3QHXA 1AMSA 2ZSMA 2ZC0A 1SZUA 2O0RA 4GEBA 2AY1A 3MADA 2CANA 3RCHA 4F5HA 3CQ6A 3NX3A 4RIZA 4ZWMA 2VGWA 2X8UA 3R4TA 4Y0DA 4ZAHA 3N0LA 1ASLA 2GMSA 3VP6A 3QPGA 2BI2A 2R5EA 1Z7DA 4RAEA 2VMTA 3OKSA 1E5EA 4UHMA 1AIBA 1SFFA 1BQDA 4IYOA 4K2IA 2FKIA 3WCNA 4ITXA 1TOEA 1AIAA 1AJRA 3NYUA 2ZY2A 3ASAA 3EZSA 2KFPA 3B8XA 1ZODA 2E54A 2FN6A 4IW7A 2CFBA 4RM1A 1CJ0A 4WXBA 2VMYA 1W23A 1DFOA 4LW4A 3MAUA 5TF5A 4DBCA 1X29A 4XK1A 1AY8A 2R0TA 4WYGA 4IY7A 1B5OA 1LK9A 4E77A 2FNIA 4NOGA 2W7LA 1VEFA 1TOGA 2BI3A 3JWAA 2F8JA 4AH3A 1C0NA 1W7NA 2DKJA 1BJ4A 3ZRRA 1CQ7A 4WYEA 4WB0A 3B1DA 4U1TA 1I29A 1IX7A 2BI5A 2YKUA 2DGMA 1GBNA 4JE5D 1O61A 2VGUA 4UQVA 4W1VA 5AX8A 3WKSA 4A0HA 1D7RA 2VIAA 3E9KA 1ASBA 3HT4A 1GD9A 4KAMA 3H14A 3AOWA 2ZSLA 3VAXA 1AHYA 3ZZJA 1QJ5A 1AY4A 4F5FA 1M4NA 3EI5A 2E7IA 5IWQA 2D61A 4UHNA 8AATA 1MDOA 4GSAA 1MAPA 3PDXA 5J8QA 1E5FA 2Z9VA 3ECDA 3F9TA 3VOMA 1AKCA 1RV3A 3E2ZA 3FDDA 3JW9A 1OATA 2QB3A 4LNJA 1C9CA 1JF9A 2AY2A 3FKDA 4ZSYA 4AO4A 1W3UA 2VMUA 4FL0A 3VK3A 1MDZA 4FFCA 4JE5A 2VMNA 1O4SA 3EI8A 3NYTA 2W8WA 2ORDA 2CTZA 3FFRA 1SPAA 2CY8A 4XJPA 4OBUA 3AEMA 2OGEA 2X3LA 3AENB 4AO9A 2VIBA 4RKDA 1TASA 3L8AA 1BQAA 1W7LA 1KL1A 1YNUA 2GMUA 3FVSA 3TFUA 1UU0A 2CH2A 4WB0B 3WGBA 1M0QA 2CSTA 3MEBA 4ISYA 1BT4A 4OCAA 5G2PA 2HOZA 9AATA 2D5YA 3KE3A 4XEWA 3TATA 2EYQA 2OKKA 1AHFA 1FG7A 3FQ8A 5D5SA 2W7MA 5LHAA 1I43A 3NDNA 1M0OA 3ZRPA 3N4RA 3H7FA 2BI9A 2GB3A 1IJIA 2TPLA 2DKBA 1TPLA 3QN6A 1S08A 4F5LA 1IUGA 2HZPA 3K40A 5EIGB 1V2EA 4WXGA 3WKRA 3G7QA 1D7VA 1JS3A 4O6ZA 3AEPA 1KKJA 4WXFA 3BWNC 3KGXA 2QBTA 2CINA 4Y0IA 1OXPA 3E6GA 1WYUB 4ADEA 5C6UA 3AEMC 1T3IA 3VK4A 1XI9A 4L0OA 4E3QA 4J8LA 2WB6A 2YOBA 2BWPA 4AZKA 4E3RA 2V0YA 4H63Q 2AY6A 3RBLA 2BIAA 3LV2A 1LS3A 1AHGA 2R2NA 1J32A 3AEJC 5EAAA 4QGRA 1AKBA 1OHVA 1G4VA 1TARA 2C0RA 4MQRA 4EU1A 2VMQA 1G7XA 2WK9A 1OXOA 3FZ8A 4ADCA 3NTJA 2FM1A 2D7YA 3LVLB 1O62A 1YIZA 2VMVA 5FT6A 5G4IA 3N4XA 1DTYA 2BHXA 3AOVA 4JEVA 4KXKA 4EB5A 4CBRA 3MC6A 3PDBA 3HDOA 2VGZA 3DXWA 2QLRA 4ADBA 4A6TA 3ELPA 4Q6RA 2AY5A 1DGEA 2AEUA 3MAFA 4IXSA 4LC3A 1ZOBA 4LNMA 1WYVB 4P7YA 1LW5A 1WSTA 4IXOA 4ZM3A 4F5JA 4WYCA 5D95A 2DGLA 4A6UA 1X28A 3PGYA 3RBFA 3TCMA 1KKPA 3FFHA 3MBBA 2JJFA 4K2MA 4ADDA 1SZKA 2HUFA 3FVUA 1FG3A 3E2FA 4N0BA 3AEJA 2FYFA 4ZM4A 1UU2A 3UE8A 5M4DA 3NUIA 2EH6A 2W7EA 4JEYA 4BMKA 1PFFA 1I41A 2WKAA 2CH1A 3FVXA 1JG8A 4W5KA 1S09A 1QZ9A 1GEWA 3A9XA 1DJEA 3FQ7A 3LWSA 4TV7A 3N4SA 2EZ1A 1YJZA 4N0WA 3EI9A 4MY5A 2W7FA 4IYOB 2JGTA 4PVFA 1Z3ZA 3GBXA 2Z1YA 4RITA 1AICA 4F5IA 1AJSA 3LVJA 3MAFB 2W7KA 3DZZA 3EI6A 2YRIA 3ELEA 3GSBA 1PMMA 3HLMA 4Q76A 3LVKA 4XJOA 1MGVA 2QB2A 2YHKA 1LW4A 4P3MA 3FTBA 3FQAA 3LG0A 1CS1A 1CZCA 1EQBA 3UWCA 3TQXA 2EGYA 1LC5A 1B8GA 4K2BA 4BHDA 2GQNA 4IX8A 1B4XA 2D63A 3DU4A 1GC3A 3W1HA 2BI1A 3FRKA 4ZWVA 1V2FA 2JJHA 4A0RA 4WP0A 3WGCA 3F6TA 1IX8A 3HL2A 5EAVA 2CJHA 5EUNA 2QSRA 4E1OA 4MQQA 4HVKA 2YCPA 1CZEA 2D66A 1EJIA 1ARTA 3ATHA 3MKJA 2VLFA 3AV7A 1GEXA 1AMQA 2O1BA 2ZUKA 1JS6A 4OTLA 4RJYA 4AZJA 3USFA 1I48A 4UHOA 3PDBB 4EFFA 2VMRA 2HOXA 7AATA 3COGA 1ASGA 2Z9XA 2E7UA 3JZLA 1YIYA 1AX4A 2W7DA 1ORDA 2VMSA 1C7NA 2DR1A 4ZDLA 2AY3A 4HF8A 2C81A 4MSOA 4OC9A 1BS0A 3DODA 2W7JA 2EZ2A 4JF1A 1KAFA 1ZC9A 5FT8A 3HVYA 4XAUA 3DRDA 1M32A 1LKCA 3LY1A 4ZASA 4EMYA 1GC4A 3E2ZB 3FCRA 2NMPA 1AY5A 3KGWA 1IVRA 4F5GA 2EO5A 5DX5A 3I5TA 2FNUA 4R2NA 1QJ3A 1YJSA 1YOOA 3A8UX 4M2JA 4ATQA 1SF2A 3GZDC 4B9BA 1VJOA 3HMUA 1MAQA 3GWPA 3GZDA 3G0TA 1AHEA 1SVVA 3WLXA 2AY8A 1WYUA 2YCTA 1M6SA 1W7MA 1B9HA 4GDYA 4GE4A 4WLHA 4J5UA 3MC6C 4W1XA 5JAYA 4H51A 1X2AA 3ASBA 2G6WA 4PIWA 2VMWA 1ARSA 3DR4A 1QIRA 3FZ7A 1BJWA 1ASFA 1C4KA 2JISA 2JJGA 3BS8A 1IAYA 1S07A 2BYLA 3AATA 5FT4A 5HXXA 3AEOA 2VGTA 1U08A 4OYTA 2A1VA 2OGAA 4ZSWA 4CVQA 2Z20A 3NNKA 2Z9WA 5EIGA 1BW0A 5M46A 2PO3A 1AAWA 4ZDPA 1S0AA 5I92A 4XJLA 3I16A 2Z9UA 1ASNA 4ITGA 3ZZKA 2W8TA 4A6RA 5EUDA 4XJMA 3GZCA 1MDXA 3T32A 3PIUA 4M2MA 4OT8A 1KL2A 2BKWA 4U2HA 1ASCA 4ATPA 3PD6A 1RVYA 3A9ZA 1PG8A 4WD2A 2X5DA 5F8VA 3BCXA 3ACZA 1KMKA 2BWOA 3W1JA 2BIGA 5G0AA 4CXQA 3H9XA 2BIEA 1MLYA 3DC1A 2VLHA 2XH1A 5BJ3A 3HBXA 2C44A 4F4EA 3IF2A 3GR9A 3TFTA 1XEYA 2YKYA 1ASMA 3CBFA 3CQ5A 3RCHB 2VI9A 1IX6A 1BJOA 3WZFA 2V1PA 5F9SA 4MQPA 2AATA 5EUEA 5HDMA 4AOAA 2GSAA 4GE9A 1Y4IA 2O7CA 1WYTB 1TATA 3JTXA 1H1CA 1IBJA 2D64A 4JEWA 3D6KA 2W7IA 1CL2A 3GETA 4WLJA 2ZY5A 1LC7A 2G7JA 4R5FA 1ECXA 2PB0A 1VP4A 3NU7A 3E77A 3E2YA 1UKJA 3EUCA 3N75A 2AY7A 4ZLVA 2PB2A 4GRXA 1BKGA 2ZP7A 1PMOA 1H0CA 3RI6A 1ARGA 1DKAA 1EG5A 3BCBA 3VK2A 2W7HA 1GDEA 3P1TA 5M49A 5EQCA 3QM2A 2YCNA 2Z67A 4JEXA 3EZ1A 1C7GA 4A00A 2AY9A 3NU8A 2OKJA 2JJEA 4M2KA 3IHJA 1IAXA 2OQXA 2CJDA 1CQ8A 2HP2A 1G7WA 2QA3A 5G4JA 3AENA 4LNLA 2WK7A 4ZDOA 4I8AA 3LVMA 3DR7A 4Y0HA 1RV4A 3DYDA 4WYDA 4K05A 1D7SA 3BN1A 2VMZA 1DJUA 1S06A 4KYOA 2QMAA 4A0FA 3N7NA 3A9YA 1GC2A 4W1WA 3JU7A 1WYTA 3OP7A 3FZ6A 1AJSB 2VMXA 3FD0A 3ISLA 3RQ1A 3KKIA 5M4BA 1SZSA 1BJOB 4XQ2A 5G09A 1WYVA 3GJUA 1TOJA 1M0PA 3NUBA 4EB7A 2CB1A 2YKVA 4PFNA 4OBVA 2ZY4A 4R8DA 1KMJA 1X0MA 1DJ9A 2WK8A 4TMRA 5HHYA 1ELQA 3AELA 3BB8A 5E3KA 3B1EA 2EPJA 2DGKA 2X5FA 1G4XA 3N5MA 3DXVA 1RVUA 3I4JA 1M7YA 3PD6B 3ZRQA 2E7JA 1B5PA 2Z1ZA 2VMPA 5DB5A 4BA4A 1P3WA 4Q75A 3UAKA 2W7GA 4WYFA 3QBOA 3EIAA 3HQTA 2W8UA 1TOKA 2ZYJA 3PPLA 1AAMA 4LW2A 2C7TA 4OMAA 4RLGA 3WCOA 2XBNA 2HORA 3F0HA 4PFFA 1AHXA 1OHYA 2YKXA 3WY7A 3A2BA 4DQ6A 2R5CA 3CQ4A 3BCAA 1N31A 3PAAA 3B1CA 1TOIA 2FQ6A 5LH9A 1M0NA 2VYCA 4B98A 1QITA 3G8MA 2VMOA 2D7ZA 4R5ZA 1QGNA 4TN4A 5EFSA 3NYSA 2RFVA 1AMRA 1V72A 4GE7A 5DJ1A 4A72A 1QISA 3PA9A 3QGUA 1BJNA 5KTBA 3FSLA 2HP1A 2VGVA 4MKJA 1ASDA 2YRRA 1WKHA 1ASAA 3EI7A 5FT5A 1O69A 2Q7WA 3WX9A 5BJ4A 1V2DA 1CQ6A 3II0A 3BWOA 4CBSA 1ASEA 1C7OA 2W8JA 1J04A 3P6KA 2HUIA 1CL1A 2CJGA 4F5MA 4DGTA 1AKAA 1N2TA 4JF0A 1B9IA 4MKKA 3EIBA 4BA5A 1GC0A 1MLZA 2BWNA 2OATA 4WYAA 3NRAA 1ARIA 4RKCA 1AMAA 5G2QA 1FC4A 2Z61A 4WBTA 4IXZA 3R9AA 3CAIA 3M5UA 2ZY3A 1GCKA 1DGDA 4RJ0A 3BC8A 2VI8A 3FDBA 2VGSA 4F5KA 2DOUA 2AY4A 1YJYA 2HUUA 4W8IA 1OHWA 2ZJGA 5E5IA 1D7UA 1WKGA 3K28A 4Q31A 3RUYA 3BV0A 3JWBA 4MGRA 1GEYA 3B46A 2W8VA 4W91A 2R5CB 1N8PA 3Q8NA
chains in the Genus database with same CATH topology
4CXRA 1D2FA 2JG2A 4JEZA 1ARHA 4UOYA 5K8BA 4BQ0A 3L44A 3BWNA 3K7YA 5E4ZA 2BYJA 2AEVA 1LC8A 4A0GA 3PJ0A 2HOYA 2D65A 3QI6A 1YAAA 3W1IA 1ELUA 1UU1A 5DJ9A 3QHXA 1AMSA 2ZSMA 2ZC0A 1SZUA 2O0RA 4GEBA 2AY1A 3MADA 2CANA 3RCHA 4F5HA 3CQ6A 3NX3A 4RIZA 4ZWMA 2VGWA 2X8UA 3R4TA 4Y0DA 4ZAHA 3N0LA 1ASLA 2GMSA 3VP6A 3QPGA 2BI2A 2R5EA 1Z7DA 4RAEA 2VMTA 3OKSA 1E5EA 4UHMA 1AIBA 1SFFA 1BQDA 4IYOA 4K2IA 2FKIA 3WCNA 4ITXA 1TOEA 1AIAA 1AJRA 3NYUA 2ZY2A 3ASAA 3EZSA 2KFPA 3B8XA 1ZODA 2E54A 2FN6A 4IW7A 2CFBA 4RM1A 1CJ0A 4WXBA 2VMYA 1W23A 1DFOA 4LW4A 3MAUA 5TF5A 4DBCA 1X29A 4XK1A 1AY8A 2R0TA 4WYGA 4IY7A 1B5OA 1LK9A 4E77A 2FNIA 4NOGA 2W7LA 1VEFA 1TOGA 2BI3A 3JWAA 2F8JA 4AH3A 1C0NA 1W7NA 2DKJA 1BJ4A 3ZRRA 1CQ7A 4WYEA 4WB0A 3B1DA 4U1TA 1I29A 1IX7A 2BI5A 2YKUA 2DGMA 1GBNA 4JE5D 1O61A 2VGUA 4UQVA 4W1VA 5AX8A 3WKSA 4A0HA 1D7RA 2VIAA 3E9KA 1ASBA 3HT4A 1GD9A 4KAMA 3H14A 3AOWA 2ZSLA 3VAXA 1AHYA 3ZZJA 1QJ5A 1AY4A 4F5FA 1M4NA 3EI5A 2E7IA 5IWQA 2D61A 4UHNA 8AATA 1MDOA 4GSAA 1MAPA 3PDXA 5J8QA 1E5FA 2Z9VA 3ECDA 3F9TA 3VOMA 1AKCA 1RV3A 3E2ZA 3FDDA 3JW9A 1OATA 2QB3A 4LNJA 1C9CA 1JF9A 2AY2A 3FKDA 4ZSYA 4AO4A 1W3UA 2VMUA 4FL0A 3VK3A 1MDZA 4FFCA 4JE5A 2VMNA 1O4SA 3EI8A 3NYTA 2W8WA 2ORDA 2CTZA 3FFRA 1SPAA 2CY8A 4XJPA 4OBUA 3AEMA 2OGEA 2X3LA 3AENB 4AO9A 2VIBA 4RKDA 1TASA 3L8AA 1BQAA 1W7LA 1KL1A 1YNUA 2GMUA 3FVSA 3TFUA 1UU0A 2CH2A 4WB0B 3WGBA 1M0QA 2CSTA 3MEBA 4ISYA 1BT4A 4OCAA 5G2PA 2HOZA 9AATA 2D5YA 3KE3A 4XEWA 3TATA 2EYQA 2OKKA 1AHFA 1FG7A 3FQ8A 5D5SA 2W7MA 5LHAA 1I43A 3NDNA 1M0OA 3ZRPA 3N4RA 3H7FA 2BI9A 2GB3A 1IJIA 2TPLA 2DKBA 1TPLA 3QN6A 1S08A 4F5LA 1IUGA 2HZPA 3K40A 5EIGB 1V2EA 4WXGA 3WKRA 3G7QA 1D7VA 1JS3A 4O6ZA 3AEPA 1KKJA 4WXFA 3BWNC 3KGXA 2QBTA 2CINA 4Y0IA 1OXPA 3E6GA 1WYUB 4ADEA 5C6UA 3AEMC 1T3IA 3VK4A 1XI9A 4L0OA 4E3QA 4J8LA 2WB6A 2YOBA 2BWPA 4AZKA 4E3RA 2V0YA 4H63Q 2AY6A 3RBLA 2BIAA 3LV2A 1LS3A 1AHGA 2R2NA 1J32A 3AEJC 5EAAA 4QGRA 1AKBA 1OHVA 1G4VA 1TARA 2C0RA 4MQRA 4EU1A 2VMQA 1G7XA 2WK9A 1OXOA 3FZ8A 4ADCA 3NTJA 2FM1A 2D7YA 3LVLB 1O62A 1YIZA 2VMVA 5FT6A 5G4IA 3N4XA 1DTYA 2BHXA 3AOVA 4JEVA 4KXKA 4EB5A 4CBRA 3MC6A 3PDBA 3HDOA 2VGZA 3DXWA 2QLRA 4ADBA 4A6TA 3ELPA 4Q6RA 2AY5A 1DGEA 2AEUA 3MAFA 4IXSA 4LC3A 1ZOBA 4LNMA 1WYVB 4P7YA 1LW5A 1WSTA 4IXOA 4ZM3A 4F5JA 4WYCA 5D95A 2DGLA 4A6UA 1X28A 3PGYA 3RBFA 3TCMA 1KKPA 3FFHA 3MBBA 2JJFA 4K2MA 4ADDA 1SZKA 2HUFA 3FVUA 1FG3A 3E2FA 4N0BA 3AEJA 2FYFA 4ZM4A 1UU2A 3UE8A 5M4DA 3NUIA 2EH6A 2W7EA 4JEYA 4BMKA 1PFFA 1I41A 2WKAA 2CH1A 3FVXA 1JG8A 4W5KA 1S09A 1QZ9A 1GEWA 3A9XA 1DJEA 3FQ7A 3LWSA 4TV7A 3N4SA 2EZ1A 1YJZA 4N0WA 3EI9A 4MY5A 2W7FA 4IYOB 2JGTA 4PVFA 1Z3ZA 3GBXA 2Z1YA 4RITA 1AICA 4F5IA 1AJSA 3LVJA 3MAFB 2W7KA 3DZZA 3EI6A 2YRIA 3ELEA 3GSBA 1PMMA 3HLMA 4Q76A 3LVKA 4XJOA 1MGVA 2QB2A 2YHKA 1LW4A 4P3MA 3FTBA 3FQAA 3LG0A 1CS1A 1CZCA 1EQBA 3UWCA 3TQXA 2EGYA 1LC5A 1B8GA 4K2BA 4BHDA 2GQNA 4IX8A 1B4XA 2D63A 3DU4A 1GC3A 3W1HA 2BI1A 3FRKA 4ZWVA 1V2FA 2JJHA 4A0RA 4WP0A 3WGCA 3F6TA 1IX8A 3HL2A 5EAVA 2CJHA 5EUNA 2QSRA 4E1OA 4MQQA 4HVKA 2YCPA 1CZEA 2D66A 1EJIA 1ARTA 3ATHA 3MKJA 2VLFA 3AV7A 1GEXA 1AMQA 2O1BA 2ZUKA 1JS6A 4OTLA 4RJYA 4AZJA 3USFA 1I48A 4UHOA 3PDBB 4EFFA 2VMRA 2HOXA 7AATA 3COGA 1ASGA 2Z9XA 2E7UA 3JZLA 1YIYA 1AX4A 2W7DA 1ORDA 2VMSA 1C7NA 2DR1A 4ZDLA 2AY3A 4HF8A 2C81A 4MSOA 4OC9A 1BS0A 3DODA 2W7JA 2EZ2A 4JF1A 1ZC9A 5FT8A 3HVYA 4XAUA 3DRDA 1M32A 1LKCA 3LY1A 4ZASA 4EMYA 1GC4A 3E2ZB 3FCRA 2NMPA 1AY5A 3KGWA 1IVRA 4F5GA 2EO5A 5DX5A 3I5TA 2FNUA 4R2NA 1QJ3A 1YJSA 1YOOA 3A8UX 4M2JA 4ATQA 1SF2A 3GZDC 4B9BA 1VJOA 3HMUA 1MAQA 3GWPA 3GZDA 3G0TA 1AHEA 1SVVA 3WLXA 2AY8A 1WYUA 2YCTA 1M6SA 1W7MA 1B9HA 4GDYA 4GE4A 4WLHA 4J5UA 3MC6C 4W1XA 5JAYA 4H51A 1X2AA 3ASBA 2G6WA 4PIWA 2VMWA 1ARSA 3DR4A 1QIRA 3FZ7A 1BJWA 1ASFA 1C4KA 2JISA 2JJGA 3BS8A 1IAYA 1S07A 2BYLA 3AATA 5FT4A 5HXXA 3AEOA 2VGTA 1U08A 4OYTA 2A1VA 2OGAA 4ZSWA 4CVQA 2Z20A 3NNKA 2Z9WA 5EIGA 1BW0A 5M46A 2PO3A 1AAWA 4ZDPA 1S0AA 5I92A 4XJLA 3I16A 2Z9UA 1ASNA 4ITGA 3ZZKA 2W8TA 4A6RA 5EUDA 4XJMA 3GZCA 1MDXA 3T32A 3PIUA 4M2MA 4OT8A 1KL2A 2BKWA 4U2HA 1ASCA 4ATPA 3PD6A 1RVYA 3A9ZA 1PG8A 4WD2A 2X5DA 5F8VA 3BCXA 3ACZA 1KMKA 2BWOA 3W1JA 2BIGA 5G0AA 4CXQA 3H9XA 2BIEA 1MLYA 3DC1A 2VLHA 2XH1A 5BJ3A 3HBXA 2C44A 4F4EA 3IF2A 3GR9A 3TFTA 1XEYA 2YKYA 1ASMA 3CBFA 3CQ5A 3RCHB 2VI9A 1IX6A 1BJOA 3WZFA 2V1PA 5F9SA 4MQPA 2AATA 5EUEA 5HDMA 4AOAA 2GSAA 4GE9A 1Y4IA 2O7CA 1WYTB 1TATA 3JTXA 1H1CA 1IBJA 2D64A 4JEWA 3D6KA 2W7IA 1CL2A 3GETA 4WLJA 2ZY5A 1LC7A 2G7JA 4R5FA 1ECXA 2PB0A 1VP4A 3NU7A 3E77A 3E2YA 1UKJA 3EUCA 3N75A 2AY7A 4ZLVA 2PB2A 4GRXA 1BKGA 2ZP7A 1PMOA 1H0CA 3RI6A 1ARGA 1DKAA 1EG5A 3BCBA 3VK2A 2W7HA 1GDEA 3P1TA 5M49A 5EQCA 3QM2A 2YCNA 2Z67A 4JEXA 3EZ1A 1C7GA 4A00A 2AY9A 3NU8A 2OKJA 2JJEA 4M2KA 3IHJA 1IAXA 2OQXA 2CJDA 1CQ8A 2HP2A 1G7WA 2QA3A 5G4JA 3AENA 4LNLA 2WK7A 4ZDOA 4I8AA 3LVMA 3DR7A 4Y0HA 1RV4A 3DYDA 4WYDA 4K05A 1D7SA 3BN1A 2VMZA 1DJUA 1S06A 4KYOA 2QMAA 4A0FA 3N7NA 3A9YA 1GC2A 4W1WA 3JU7A 1WYTA 3OP7A 3FZ6A 1AJSB 2VMXA 3FD0A 3ISLA 3RQ1A 3KKIA 5M4BA 1SZSA 1BJOB 4XQ2A 5G09A 1WYVA 3GJUA 1TOJA 1M0PA 3NUBA 4EB7A 2CB1A 2YKVA 4PFNA 4OBVA 2ZY4A 4R8DA 1KMJA 1X0MA 1DJ9A 2WK8A 4TMRA 5HHYA 1ELQA 3AELA 3BB8A 5E3KA 3B1EA 2EPJA 2DGKA 2X5FA 1G4XA 3N5MA 3DXVA 1RVUA 3I4JA 1M7YA 3PD6B 3ZRQA 2E7JA 1B5PA 2Z1ZA 2VMPA 5DB5A 4BA4A 1P3WA 4Q75A 3UAKA 2W7GA 4WYFA 3QBOA 3EIAA 3HQTA 2W8UA 1TOKA 2ZYJA 3PPLA 1AAMA 4LW2A 2C7TA 4OMAA 4RLGA 3WCOA 2XBNA 2HORA 3F0HA 4PFFA 1AHXA 1OHYA 2YKXA 3WY7A 3A2BA 4DQ6A 2R5CA 3CQ4A 3BCAA 1N31A 3PAAA 3B1CA 1TOIA 2FQ6A 5LH9A 1M0NA 2VYCA 4B98A 1QITA 3G8MA 2VMOA 2D7ZA 4R5ZA 1QGNA 4TN4A 5EFSA 3NYSA 2RFVA 1AMRA 1V72A 4GE7A 5DJ1A 4A72A 1QISA 3PA9A 3QGUA 1BJNA 5KTBA 3FSLA 2HP1A 2VGVA 4MKJA 1ASDA 2YRRA 1WKHA 1ASAA 3EI7A 5FT5A 1O69A 2Q7WA 3WX9A 5BJ4A 1V2DA 1CQ6A 3II0A 3BWOA 4CBSA 1ASEA 1C7OA 2W8JA 1J04A 3P6KA 2HUIA 1CL1A 2CJGA 4F5MA 4DGTA 1AKAA 1N2TA 4JF0A 1B9IA 4MKKA 3EIBA 4BA5A 1GC0A 1MLZA 2BWNA 2OATA 4WYAA 3NRAA 1ARIA 4RKCA 1AMAA 5G2QA 1FC4A 2Z61A 4WBTA 4IXZA 3R9AA 3CAIA 3M5UA 2ZY3A 1GCKA 1DGDA 4RJ0A 3BC8A 2VI8A 3FDBA 2VGSA 4F5KA 2DOUA 2AY4A 1YJYA 2HUUA 4W8IA 1OHWA 2ZJGA 5E5IA 1D7UA 1WKGA 3K28A 4Q31A 3RUYA 3BV0A 3JWBA 4MGRA 1GEYA 3B46A 2W8VA 4W91A 2R5CB 1N8PA 3Q8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CXR A;  1D2F A;  2JG2 A;  4JEZ A;  1ARH A;  4UOY A;  5K8B A;  4BQ0 A;  3L44 A;  3BWN A;  3K7Y A;  5E4Z A;  2BYJ A;  2AEV A;  1LC8 A;  4A0G A;  3PJ0 A;  2HOY A;  2D65 A;  3QI6 A;  1YAA A;  3W1I A;  1ELU A;  1UU1 A;  5DJ9 A;  3QHX A;  1AMS A;  2ZSM A;  2ZC0 A;  1SZU A;  2O0R A;  4GEB A;  2AY1 A;  3MAD A;  2CAN A;  3RCH A;  4F5H A;  3CQ6 A;  3NX3 A;  4RIZ A;  4ZWM A;  2VGW A;  2X8U A;  3R4T A;  4Y0D A;  4ZAH A;  3N0L A;  1ASL A;  2GMS A;  3VP6 A;  3QPG A;  2BI2 A;  2R5E A;  1Z7D A;  4RAE A;  2VMT A;  3OKS A;  1E5E A;  4UHM A;  1AIB A;  1SFF A;  1BQD A;  4IYO A;  4K2I A;  3WCN A;  4ITX A;  1TOE A;  1AIA A;  1AJR A;  3NYU A;  2ZY2 A;  3ASA A;  3EZS A;  3B8X A;  1ZOD A;  2E54 A;  2FN6 A;  4IW7 A;  2CFB A;  4RM1 A;  1CJ0 A;  4WXB A;  2VMY A;  1W23 A;  1DFO A;  4LW4 A;  3MAU A;  5TF5 A;  4DBC A;  1X29 A;  4XK1 A;  1AY8 A;  2R0T A;  4WYG A;  4IY7 A;  1B5O A;  1LK9 A;  4E77 A;  2FNI A;  4NOG A;  2W7L A;  1VEF A;  1TOG A;  2BI3 A;  3JWA A;  2F8J A;  4AH3 A;  1C0N A;  1W7N A;  2DKJ A;  1BJ4 A;  3ZRR A;  1CQ7 A;  4WYE A;  4WB0 A;  3B1D A;  4U1T A;  1I29 A;  1IX7 A;  2BI5 A;  2YKU A;  2DGM A;  1GBN A;  4JE5 D;  1O61 A;  2VGU A;  4UQV A;  4W1V A;  5AX8 A;  3WKS A;  4A0H A;  1D7R A;  2VIA A;  3E9K A;  1ASB A;  3HT4 A;  1GD9 A;  4KAM A;  3H14 A;  3AOW A;  2ZSL A;  3VAX A;  1AHY A;  3ZZJ A;  1QJ5 A;  1AY4 A;  4F5F A;  1M4N A;  3EI5 A;  2E7I A;  5IWQ A;  2D61 A;  4UHN A;  8AAT A;  1MDO A;  4GSA A;  1MAP A;  3PDX A;  5J8Q A;  1E5F A;  2Z9V A;  3ECD A;  3F9T A;  3VOM A;  1AKC A;  1RV3 A;  3E2Z A;  3FDD A;  3JW9 A;  1OAT A;  2QB3 A;  4LNJ A;  1C9C A;  1JF9 A;  2AY2 A;  3FKD A;  4ZSY A;  4AO4 A;  1W3U A;  2VMU A;  4FL0 A;  3VK3 A;  1MDZ A;  4FFC A;  4JE5 A;  2VMN A;  1O4S A;  3EI8 A;  3NYT A;  2W8W A;  2ORD A;  2CTZ A;  3FFR A;  1SPA A;  2CY8 A;  4XJP A;  4OBU A;  3AEM A;  2OGE A;  2X3L A;  3AEN B;  4AO9 A;  2VIB A;  4RKD A;  1TAS A;  3L8A A;  1BQA A;  1W7L A;  1KL1 A;  1YNU A;  2GMU A;  3FVS A;  3TFU A;  1UU0 A;  2CH2 A;  4WB0 B;  3WGB A;  1M0Q A;  2CST A;  3MEB A;  4ISY A;  1BT4 A;  4OCA A;  5G2P A;  2HOZ A;  9AAT A;  2D5Y A;  3KE3 A;  4XEW A;  3TAT A;  2OKK A;  1AHF A;  1FG7 A;  3FQ8 A;  5D5S A;  2W7M A;  5LHA A;  1I43 A;  3NDN A;  1M0O A;  3ZRP A;  3H7F A;  2BI9 A;  2GB3 A;  1IJI A;  2TPL A;  2DKB A;  1TPL A;  3QN6 A;  1S08 A;  4F5L A;  1IUG A;  2HZP A;  3K40 A;  5EIG B;  1V2E A;  4WXG A;  3WKR A;  3G7Q A;  1D7V A;  1JS3 A;  4O6Z A;  3AEP A;  1KKJ A;  4WXF A;  3BWN C;  3KGX A;  2QBT A;  2CIN A;  4Y0I A;  1OXP A;  3E6G A;  1WYU B;  4ADE A;  5C6U A;  3AEM C;  1T3I A;  3VK4 A;  1XI9 A;  4L0O A;  4E3Q A;  4J8L A;  2YOB A;  2BWP A;  4AZK A;  4E3R A;  2V0Y A;  2AY6 A;  3RBL A;  2BIA A;  3LV2 A;  1LS3 A;  1AHG A;  2R2N A;  1J32 A;  3AEJ C;  5EAA A;  4QGR A;  1AKB A;  1OHV A;  1G4V A;  1TAR A;  2C0R A;  4MQR A;  4EU1 A;  2VMQ A;  1G7X A;  2WK9 A;  1OXO A;  3FZ8 A;  4ADC A;  3NTJ A;  2FM1 A;  2D7Y A;  3LVL B;  1O62 A;  1YIZ A;  2VMV A;  5FT6 A;  5G4I A;  1DTY A;  2BHX A;  3AOV A;  4JEV A;  4KXK A;  4EB5 A;  4CBR A;  3MC6 A;  3PDB A;  3HDO A;  2VGZ A;  3DXW A;  2QLR A;  4ADB A;  4A6T A;  3ELP A;  4Q6R A;  2AY5 A;  1DGE A;  2AEU A;  3MAF A;  4IXS A;  4LC3 A;  1ZOB A;  4LNM A;  1WYV B;  4P7Y A;  1LW5 A;  1WST A;  4IXO A;  4ZM3 A;  4F5J A;  4WYC A;  5D95 A;  2DGL A;  4A6U A;  1X28 A;  3PGY A;  3RBF A;  3TCM A;  1KKP A;  3FFH A;  3MBB A;  2JJF A;  4K2M A;  4ADD A;  1SZK A;  2HUF A;  3FVU A;  1FG3 A;  3E2F A;  4N0B A;  3AEJ A;  2FYF A;  4ZM4 A;  1UU2 A;  3UE8 A;  5M4D A;  3NUI A;  2EH6 A;  2W7E A;  4JEY A;  4BMK A;  1PFF A;  1I41 A;  2WKA A;  2CH1 A;  3FVX A;  1JG8 A;  4W5K A;  1S09 A;  1QZ9 A;  1GEW A;  3A9X A;  1DJE A;  3FQ7 A;  3LWS A;  4TV7 A;  2EZ1 A;  1YJZ A;  4N0W A;  3EI9 A;  4MY5 A;  2W7F A;  4IYO B;  2JGT A;  4PVF A;  1Z3Z A;  3GBX A;  2Z1Y A;  4RIT A;  1AIC A;  4F5I A;  1AJS A;  3LVJ A;  3MAF B;  2W7K A;  3DZZ A;  3EI6 A;  2YRI A;  3ELE A;  3GSB A;  1PMM A;  3HLM A;  4Q76 A;  3LVK A;  4XJO A;  1MGV A;  2QB2 A;  2YHK A;  1LW4 A;  4P3M A;  3FTB A;  3FQA A;  3LG0 A;  1CS1 A;  1CZC A;  1EQB A;  3UWC A;  3TQX A;  2EGY A;  1LC5 A;  1B8G A;  4K2B A;  4BHD A;  2GQN A;  4IX8 A;  1B4X A;  2D63 A;  3DU4 A;  1GC3 A;  3W1H A;  2BI1 A;  3FRK A;  4ZWV A;  1V2F A;  2JJH A;  4A0R A;  4WP0 A;  3WGC A;  3F6T A;  1IX8 A;  3HL2 A;  5EAV A;  2CJH A;  5EUN A;  4E1O A;  4MQQ A;  4HVK A;  2YCP A;  1CZE A;  2D66 A;  1EJI A;  1ART A;  3ATH A;  3MKJ A;  2VLF A;  3AV7 A;  1GEX A;  1AMQ A;  2O1B A;  2ZUK A;  1JS6 A;  4OTL A;  4RJY A;  4AZJ A;  3USF A;  1I48 A;  4UHO A;  3PDB B;  4EFF A;  2VMR A;  2HOX A;  7AAT A;  3COG A;  1ASG A;  2Z9X A;  2E7U A;  3JZL A;  1YIY A;  1AX4 A;  2W7D A;  1ORD A;  2VMS A;  1C7N A;  2DR1 A;  4ZDL A;  2AY3 A;  4HF8 A;  2C81 A;  4MSO A;  4OC9 A;  1BS0 A;  3DOD A;  2W7J A;  2EZ2 A;  4JF1 A;  1ZC9 A;  5FT8 A;  3HVY A;  4XAU A;  3DRD A;  1M32 A;  1LKC A;  3LY1 A;  4ZAS A;  4EMY A;  1GC4 A;  3E2Z B;  3FCR A;  2NMP A;  1AY5 A;  3KGW A;  1IVR A;  4F5G A;  2EO5 A;  5DX5 A;  3I5T A;  2FNU A;  4R2N A;  1QJ3 A;  1YJS A;  1YOO A;  3A8U X;  4M2J A;  4ATQ A;  1SF2 A;  3GZD C;  4B9B A;  1VJO A;  3HMU A;  1MAQ A;  3GWP A;  3GZD A;  3G0T A;  1AHE A;  1SVV A;  3WLX A;  2AY8 A;  1WYU A;  2YCT A;  1M6S A;  1W7M A;  1B9H A;  4GDY A;  4GE4 A;  4WLH A;  4J5U A;  3MC6 C;  4W1X A;  5JAY A;  4H51 A;  1X2A A;  3ASB A;  2G6W A;  4PIW A;  2VMW A;  1ARS A;  3DR4 A;  1QIR A;  3FZ7 A;  1BJW A;  1ASF A;  1C4K A;  2JIS A;  2JJG A;  3BS8 A;  1IAY A;  1S07 A;  2BYL A;  3AAT A;  5FT4 A;  5HXX A;  3AEO A;  2VGT A;  1U08 A;  4OYT A;  2OGA A;  4ZSW A;  4CVQ A;  2Z20 A;  3NNK A;  2Z9W A;  5EIG A;  1BW0 A;  5M46 A;  2PO3 A;  1AAW A;  4ZDP A;  1S0A A;  5I92 A;  4XJL A;  3I16 A;  2Z9U A;  1ASN A;  4ITG A;  3ZZK A;  2W8T A;  4A6R A;  5EUD A;  4XJM A;  3GZC A;  1MDX A;  3T32 A;  3PIU A;  4M2M A;  4OT8 A;  1KL2 A;  2BKW A;  4U2H A;  1ASC A;  4ATP A;  3PD6 A;  1RVY A;  3A9Z A;  1PG8 A;  4WD2 A;  2X5D A;  5F8V A;  3BCX A;  3ACZ A;  1KMK A;  2BWO A;  3W1J A;  2BIG A;  5G0A A;  4CXQ A;  2BIE A;  1MLY A;  3DC1 A;  2VLH A;  2XH1 A;  5BJ3 A;  3HBX A;  2C44 A;  4F4E A;  3IF2 A;  3GR9 A;  3TFT A;  1XEY A;  2YKY A;  1ASM A;  3CBF A;  3CQ5 A;  3RCH B;  2VI9 A;  1IX6 A;  1BJO A;  3WZF A;  2V1P A;  5F9S A;  4MQP A;  2AAT A;  5EUE A;  5HDM A;  4AOA A;  2GSA A;  4GE9 A;  1Y4I A;  2O7C A;  1WYT B;  1TAT A;  3JTX A;  1H1C A;  1IBJ A;  2D64 A;  4JEW A;  3D6K A;  2W7I A;  1CL2 A;  3GET A;  4WLJ A;  2ZY5 A;  1LC7 A;  4R5F A;  1ECX A;  2PB0 A;  1VP4 A;  3NU7 A;  3E77 A;  3E2Y A;  1UKJ A;  3EUC A;  3N75 A;  2AY7 A;  4ZLV A;  2PB2 A;  4GRX A;  1BKG A;  2ZP7 A;  1PMO A;  1H0C A;  3RI6 A;  1ARG A;  1DKA A;  1EG5 A;  3BCB A;  3VK2 A;  2W7H A;  1GDE A;  3P1T A;  5M49 A;  5EQC A;  3QM2 A;  2YCN A;  2Z67 A;  4JEX A;  3EZ1 A;  1C7G A;  4A00 A;  2AY9 A;  3NU8 A;  2OKJ A;  2JJE A;  4M2K A;  3IHJ A;  1IAX A;  2OQX A;  2CJD A;  1CQ8 A;  2HP2 A;  1G7W A;  2QA3 A;  5G4J A;  3AEN A;  4LNL A;  2WK7 A;  4ZDO A;  4I8A A;  3LVM A;  3DR7 A;  4Y0H A;  1RV4 A;  3DYD A;  4WYD A;  1D7S A;  3BN1 A;  2VMZ A;  1DJU A;  1S06 A;  4KYO A;  2QMA A;  4A0F A;  3A9Y A;  1GC2 A;  4W1W A;  3JU7 A;  1WYT A;  3OP7 A;  3FZ6 A;  1AJS B;  2VMX A;  3FD0 A;  3ISL A;  3RQ1 A;  3KKI A;  5M4B A;  1SZS A;  1BJO B;  4XQ2 A;  5G09 A;  1WYV A;  3GJU A;  1TOJ A;  1M0P A;  3NUB A;  4EB7 A;  2CB1 A;  2YKV A;  4PFN A;  4OBV A;  2ZY4 A;  4R8D A;  1KMJ A;  1X0M A;  1DJ9 A;  2WK8 A;  4TMR A;  5HHY A;  1ELQ A;  3AEL A;  3BB8 A;  5E3K A;  3B1E A;  2EPJ A;  2DGK A;  2X5F A;  1G4X A;  3N5M A;  3DXV A;  1RVU A;  3I4J A;  1M7Y A;  3PD6 B;  3ZRQ A;  2E7J A;  1B5P A;  2Z1Z A;  2VMP A;  5DB5 A;  4BA4 A;  1P3W A;  4Q75 A;  3UAK A;  2W7G A;  4WYF A;  3QBO A;  3EIA A;  3HQT A;  2W8U A;  1TOK A;  2ZYJ A;  3PPL A;  1AAM A;  4LW2 A;  2C7T A;  4OMA A;  4RLG A;  3WCO A;  2XBN A;  2HOR A;  3F0H A;  4PFF A;  1AHX A;  1OHY A;  2YKX A;  3WY7 A;  3A2B A;  4DQ6 A;  2R5C A;  3CQ4 A;  3BCA A;  1N31 A;  3PAA A;  3B1C A;  1TOI A;  2FQ6 A;  5LH9 A;  1M0N A;  2VYC A;  4B98 A;  1QIT A;  3G8M A;  2VMO A;  2D7Z A;  4R5Z A;  1QGN A;  4TN4 A;  5EFS A;  3NYS A;  2RFV A;  1AMR A;  1V72 A;  4GE7 A;  5DJ1 A;  4A72 A;  1QIS A;  3PA9 A;  3QGU A;  1BJN A;  3FSL A;  2HP1 A;  2VGV A;  4MKJ A;  1ASD A;  2YRR A;  1WKH A;  1ASA A;  3EI7 A;  5FT5 A;  1O69 A;  2Q7W A;  3WX9 A;  5BJ4 A;  1V2D A;  1CQ6 A;  3II0 A;  3BWO A;  4CBS A;  1ASE A;  1C7O A;  2W8J A;  1J04 A;  3P6K A;  2HUI A;  1CL1 A;  2CJG A;  4F5M A;  4DGT A;  1AKA A;  1N2T A;  4JF0 A;  1B9I A;  4MKK A;  3EIB A;  4BA5 A;  1GC0 A;  1MLZ A;  2BWN A;  2OAT A;  4WYA A;  3NRA A;  1ARI A;  4RKC A;  1AMA A;  5G2Q A;  1FC4 A;  2Z61 A;  4WBT A;  4IXZ A;  3R9A A;  3CAI A;  3M5U A;  2ZY3 A;  1GCK A;  1DGD A;  4RJ0 A;  3BC8 A;  2VI8 A;  3FDB A;  2VGS A;  4F5K A;  2DOU A;  2AY4 A;  1YJY A;  2HUU A;  4W8I A;  1OHW A;  2ZJG A;  5E5I A;  1D7U A;  1WKG A;  3K28 A;  4Q31 A;  3RUY A;  3BV0 A;  3JWB A;  4MGR A;  1GEY A;  3B46 A;  2W8V A;  4W91 A;  2R5C B;  1N8P A;  3Q8N A; 
#chains in the Genus database with same CATH topology
 4CXR A;  1D2F A;  2JG2 A;  4JEZ A;  1ARH A;  4UOY A;  5K8B A;  4BQ0 A;  3L44 A;  3BWN A;  3K7Y A;  5E4Z A;  2BYJ A;  2AEV A;  1LC8 A;  4A0G A;  3PJ0 A;  2HOY A;  2D65 A;  3QI6 A;  1YAA A;  3W1I A;  1ELU A;  1UU1 A;  5DJ9 A;  3QHX A;  1AMS A;  2ZSM A;  2ZC0 A;  1SZU A;  2O0R A;  4GEB A;  2AY1 A;  3MAD A;  2CAN A;  3RCH A;  4F5H A;  3CQ6 A;  3NX3 A;  4RIZ A;  4ZWM A;  2VGW A;  2X8U A;  3R4T A;  4Y0D A;  4ZAH A;  3N0L A;  1ASL A;  2GMS A;  3VP6 A;  3QPG A;  2BI2 A;  2R5E A;  1Z7D A;  4RAE A;  2VMT A;  3OKS A;  1E5E A;  4UHM A;  1AIB A;  1SFF A;  1BQD A;  4IYO A;  4K2I A;  2FKI A;  3WCN A;  4ITX A;  1TOE A;  1AIA A;  1AJR A;  3NYU A;  2ZY2 A;  3ASA A;  3EZS A;  2KFP A;  3B8X A;  1ZOD A;  2E54 A;  2FN6 A;  4IW7 A;  2CFB A;  4RM1 A;  1CJ0 A;  4WXB A;  2VMY A;  1W23 A;  1DFO A;  4LW4 A;  3MAU A;  5TF5 A;  4DBC A;  1X29 A;  4XK1 A;  1AY8 A;  2R0T A;  4WYG A;  4IY7 A;  1B5O A;  1LK9 A;  4E77 A;  2FNI A;  4NOG A;  2W7L A;  1VEF A;  1TOG A;  2BI3 A;  3JWA A;  2F8J A;  4AH3 A;  1C0N A;  1W7N A;  2DKJ A;  1BJ4 A;  3ZRR A;  1CQ7 A;  4WYE A;  4WB0 A;  3B1D A;  4U1T A;  1I29 A;  1IX7 A;  2BI5 A;  2YKU A;  2DGM A;  1GBN A;  4JE5 D;  1O61 A;  2VGU A;  4UQV A;  4W1V A;  5AX8 A;  3WKS A;  4A0H A;  1D7R A;  2VIA A;  3E9K A;  1ASB A;  3HT4 A;  1GD9 A;  4KAM A;  3H14 A;  3AOW A;  2ZSL A;  3VAX A;  1AHY A;  3ZZJ A;  1QJ5 A;  1AY4 A;  4F5F A;  1M4N A;  3EI5 A;  2E7I A;  5IWQ A;  2D61 A;  4UHN A;  8AAT A;  1MDO A;  4GSA A;  1MAP A;  3PDX A;  5J8Q A;  1E5F A;  2Z9V A;  3ECD A;  3F9T A;  3VOM A;  1AKC A;  1RV3 A;  3E2Z A;  3FDD A;  3JW9 A;  1OAT A;  2QB3 A;  4LNJ A;  1C9C A;  1JF9 A;  2AY2 A;  3FKD A;  4ZSY A;  4AO4 A;  1W3U A;  2VMU A;  4FL0 A;  3VK3 A;  1MDZ A;  4FFC A;  4JE5 A;  2VMN A;  1O4S A;  3EI8 A;  3NYT A;  2W8W A;  2ORD A;  2CTZ A;  3FFR A;  1SPA A;  2CY8 A;  4XJP A;  4OBU A;  3AEM A;  2OGE A;  2X3L A;  3AEN B;  4AO9 A;  2VIB A;  4RKD A;  1TAS A;  3L8A A;  1BQA A;  1W7L A;  1KL1 A;  1YNU A;  2GMU A;  3FVS A;  3TFU A;  1UU0 A;  2CH2 A;  4WB0 B;  3WGB A;  1M0Q A;  2CST A;  3MEB A;  4ISY A;  1BT4 A;  4OCA A;  5G2P A;  2HOZ A;  9AAT A;  2D5Y A;  3KE3 A;  4XEW A;  3TAT A;  2EYQ A;  2OKK A;  1AHF A;  1FG7 A;  3FQ8 A;  5D5S A;  2W7M A;  5LHA A;  1I43 A;  3NDN A;  1M0O A;  3ZRP A;  3N4R A;  3H7F A;  2BI9 A;  2GB3 A;  1IJI A;  2TPL A;  2DKB A;  1TPL A;  3QN6 A;  1S08 A;  4F5L A;  1IUG A;  2HZP A;  3K40 A;  5EIG B;  1V2E A;  4WXG A;  3WKR A;  3G7Q A;  1D7V A;  1JS3 A;  4O6Z A;  3AEP A;  1KKJ A;  4WXF A;  3BWN C;  3KGX A;  2QBT A;  2CIN A;  4Y0I A;  1OXP A;  3E6G A;  1WYU B;  4ADE A;  5C6U A;  3AEM C;  1T3I A;  3VK4 A;  1XI9 A;  4L0O A;  4E3Q A;  4J8L A;  2WB6 A;  2YOB A;  2BWP A;  4AZK A;  4E3R A;  2V0Y A;  4H63 Q;  2AY6 A;  3RBL A;  2BIA A;  3LV2 A;  1LS3 A;  1AHG A;  2R2N A;  1J32 A;  3AEJ C;  5EAA A;  4QGR A;  1AKB A;  1OHV A;  1G4V A;  1TAR A;  2C0R A;  4MQR A;  4EU1 A;  2VMQ A;  1G7X A;  2WK9 A;  1OXO A;  3FZ8 A;  4ADC A;  3NTJ A;  2FM1 A;  2D7Y A;  3LVL B;  1O62 A;  1YIZ A;  2VMV A;  5FT6 A;  5G4I A;  3N4X A;  1DTY A;  2BHX A;  3AOV A;  4JEV A;  4KXK A;  4EB5 A;  4CBR A;  3MC6 A;  3PDB A;  3HDO A;  2VGZ A;  3DXW A;  2QLR A;  4ADB A;  4A6T A;  3ELP A;  4Q6R A;  2AY5 A;  1DGE A;  2AEU A;  3MAF A;  4IXS A;  4LC3 A;  1ZOB A;  4LNM A;  1WYV B;  4P7Y A;  1LW5 A;  1WST A;  4IXO A;  4ZM3 A;  4F5J A;  4WYC A;  5D95 A;  2DGL A;  4A6U A;  1X28 A;  3PGY A;  3RBF A;  3TCM A;  1KKP A;  3FFH A;  3MBB A;  2JJF A;  4K2M A;  4ADD A;  1SZK A;  2HUF A;  3FVU A;  1FG3 A;  3E2F A;  4N0B A;  3AEJ A;  2FYF A;  4ZM4 A;  1UU2 A;  3UE8 A;  5M4D A;  3NUI A;  2EH6 A;  2W7E A;  4JEY A;  4BMK A;  1PFF A;  1I41 A;  2WKA A;  2CH1 A;  3FVX A;  1JG8 A;  4W5K A;  1S09 A;  1QZ9 A;  1GEW A;  3A9X A;  1DJE A;  3FQ7 A;  3LWS A;  4TV7 A;  3N4S A;  2EZ1 A;  1YJZ A;  4N0W A;  3EI9 A;  4MY5 A;  2W7F A;  4IYO B;  2JGT A;  4PVF A;  1Z3Z A;  3GBX A;  2Z1Y A;  4RIT A;  1AIC A;  4F5I A;  1AJS A;  3LVJ A;  3MAF B;  2W7K A;  3DZZ A;  3EI6 A;  2YRI A;  3ELE A;  3GSB A;  1PMM A;  3HLM A;  4Q76 A;  3LVK A;  4XJO A;  1MGV A;  2QB2 A;  2YHK A;  1LW4 A;  4P3M A;  3FTB A;  3FQA A;  3LG0 A;  1CS1 A;  1CZC A;  1EQB A;  3UWC A;  3TQX A;  2EGY A;  1LC5 A;  1B8G A;  4K2B A;  4BHD A;  2GQN A;  4IX8 A;  1B4X A;  2D63 A;  3DU4 A;  1GC3 A;  3W1H A;  2BI1 A;  3FRK A;  4ZWV A;  1V2F A;  2JJH A;  4A0R A;  4WP0 A;  3WGC A;  3F6T A;  1IX8 A;  3HL2 A;  5EAV A;  2CJH A;  5EUN A;  2QSR A;  4E1O A;  4MQQ A;  4HVK A;  2YCP A;  1CZE A;  2D66 A;  1EJI A;  1ART A;  3ATH A;  3MKJ A;  2VLF A;  3AV7 A;  1GEX A;  1AMQ A;  2O1B A;  2ZUK A;  1JS6 A;  4OTL A;  4RJY A;  4AZJ A;  3USF A;  1I48 A;  4UHO A;  3PDB B;  4EFF A;  2VMR A;  2HOX A;  7AAT A;  3COG A;  1ASG A;  2Z9X A;  2E7U A;  3JZL A;  1YIY A;  1AX4 A;  2W7D A;  1ORD A;  2VMS A;  1C7N A;  2DR1 A;  4ZDL A;  2AY3 A;  4HF8 A;  2C81 A;  4MSO A;  4OC9 A;  1BS0 A;  3DOD A;  2W7J A;  2EZ2 A;  4JF1 A;  1KAF A;  1ZC9 A;  5FT8 A;  3HVY A;  4XAU A;  3DRD A;  1M32 A;  1LKC A;  3LY1 A;  4ZAS A;  4EMY A;  1GC4 A;  3E2Z B;  3FCR A;  2NMP A;  1AY5 A;  3KGW A;  1IVR A;  4F5G A;  2EO5 A;  5DX5 A;  3I5T A;  2FNU A;  4R2N A;  1QJ3 A;  1YJS A;  1YOO A;  3A8U X;  4M2J A;  4ATQ A;  1SF2 A;  3GZD C;  4B9B A;  1VJO A;  3HMU A;  1MAQ A;  3GWP A;  3GZD A;  3G0T A;  1AHE A;  1SVV A;  3WLX A;  2AY8 A;  1WYU A;  2YCT A;  1M6S A;  1W7M A;  1B9H A;  4GDY A;  4GE4 A;  4WLH A;  4J5U A;  3MC6 C;  4W1X A;  5JAY A;  4H51 A;  1X2A A;  3ASB A;  2G6W A;  4PIW A;  2VMW A;  1ARS A;  3DR4 A;  1QIR A;  3FZ7 A;  1BJW A;  1ASF A;  1C4K A;  2JIS A;  2JJG A;  3BS8 A;  1IAY A;  1S07 A;  2BYL A;  3AAT A;  5FT4 A;  5HXX A;  3AEO A;  2VGT A;  1U08 A;  4OYT A;  2A1V A;  2OGA A;  4ZSW A;  4CVQ A;  2Z20 A;  3NNK A;  2Z9W A;  5EIG A;  1BW0 A;  5M46 A;  2PO3 A;  1AAW A;  4ZDP A;  1S0A A;  5I92 A;  4XJL A;  3I16 A;  2Z9U A;  1ASN A;  4ITG A;  3ZZK A;  2W8T A;  4A6R A;  5EUD A;  4XJM A;  3GZC A;  1MDX A;  3T32 A;  3PIU A;  4M2M A;  4OT8 A;  1KL2 A;  2BKW A;  4U2H A;  1ASC A;  4ATP A;  3PD6 A;  1RVY A;  3A9Z A;  1PG8 A;  4WD2 A;  2X5D A;  5F8V A;  3BCX A;  3ACZ A;  1KMK A;  2BWO A;  3W1J A;  2BIG A;  5G0A A;  4CXQ A;  3H9X A;  2BIE A;  1MLY A;  3DC1 A;  2VLH A;  2XH1 A;  5BJ3 A;  3HBX A;  2C44 A;  4F4E A;  3IF2 A;  3GR9 A;  3TFT A;  1XEY A;  2YKY A;  1ASM A;  3CBF A;  3CQ5 A;  3RCH B;  2VI9 A;  1IX6 A;  1BJO A;  3WZF A;  2V1P A;  5F9S A;  4MQP A;  2AAT A;  5EUE A;  5HDM A;  4AOA A;  2GSA A;  4GE9 A;  1Y4I A;  2O7C A;  1WYT B;  1TAT A;  3JTX A;  1H1C A;  1IBJ A;  2D64 A;  4JEW A;  3D6K A;  2W7I A;  1CL2 A;  3GET A;  4WLJ A;  2ZY5 A;  1LC7 A;  2G7J A;  4R5F A;  1ECX A;  2PB0 A;  1VP4 A;  3NU7 A;  3E77 A;  3E2Y A;  1UKJ A;  3EUC A;  3N75 A;  2AY7 A;  4ZLV A;  2PB2 A;  4GRX A;  1BKG A;  2ZP7 A;  1PMO A;  1H0C A;  3RI6 A;  1ARG A;  1DKA A;  1EG5 A;  3BCB A;  3VK2 A;  2W7H A;  1GDE A;  3P1T A;  5M49 A;  5EQC A;  3QM2 A;  2YCN A;  2Z67 A;  4JEX A;  3EZ1 A;  1C7G A;  4A00 A;  2AY9 A;  3NU8 A;  2OKJ A;  2JJE A;  4M2K A;  3IHJ A;  1IAX A;  2OQX A;  2CJD A;  1CQ8 A;  2HP2 A;  1G7W A;  2QA3 A;  5G4J A;  3AEN A;  4LNL A;  2WK7 A;  4ZDO A;  4I8A A;  3LVM A;  3DR7 A;  4Y0H A;  1RV4 A;  3DYD A;  4WYD A;  4K05 A;  1D7S A;  3BN1 A;  2VMZ A;  1DJU A;  1S06 A;  4KYO A;  2QMA A;  4A0F A;  3N7N A;  3A9Y A;  1GC2 A;  4W1W A;  3JU7 A;  1WYT A;  3OP7 A;  3FZ6 A;  1AJS B;  2VMX A;  3FD0 A;  3ISL A;  3RQ1 A;  3KKI A;  5M4B A;  1SZS A;  1BJO B;  4XQ2 A;  5G09 A;  1WYV A;  3GJU A;  1TOJ A;  1M0P A;  3NUB A;  4EB7 A;  2CB1 A;  2YKV A;  4PFN A;  4OBV A;  2ZY4 A;  4R8D A;  1KMJ A;  1X0M A;  1DJ9 A;  2WK8 A;  4TMR A;  5HHY A;  1ELQ A;  3AEL A;  3BB8 A;  5E3K A;  3B1E A;  2EPJ A;  2DGK A;  2X5F A;  1G4X A;  3N5M A;  3DXV A;  1RVU A;  3I4J A;  1M7Y A;  3PD6 B;  3ZRQ A;  2E7J A;  1B5P A;  2Z1Z A;  2VMP A;  5DB5 A;  4BA4 A;  1P3W A;  4Q75 A;  3UAK A;  2W7G A;  4WYF A;  3QBO A;  3EIA A;  3HQT A;  2W8U A;  1TOK A;  2ZYJ A;  3PPL A;  1AAM A;  4LW2 A;  2C7T A;  4OMA A;  4RLG A;  3WCO A;  2XBN A;  2HOR A;  3F0H A;  4PFF A;  1AHX A;  1OHY A;  2YKX A;  3WY7 A;  3A2B A;  4DQ6 A;  2R5C A;  3CQ4 A;  3BCA A;  1N31 A;  3PAA A;  3B1C A;  1TOI A;  2FQ6 A;  5LH9 A;  1M0N A;  2VYC A;  4B98 A;  1QIT A;  3G8M A;  2VMO A;  2D7Z A;  4R5Z A;  1QGN A;  4TN4 A;  5EFS A;  3NYS A;  2RFV A;  1AMR A;  1V72 A;  4GE7 A;  5DJ1 A;  4A72 A;  1QIS A;  3PA9 A;  3QGU A;  1BJN A;  5KTB A;  3FSL A;  2HP1 A;  2VGV A;  4MKJ A;  1ASD A;  2YRR A;  1WKH A;  1ASA A;  3EI7 A;  5FT5 A;  1O69 A;  2Q7W A;  3WX9 A;  5BJ4 A;  1V2D A;  1CQ6 A;  3II0 A;  3BWO A;  4CBS A;  1ASE A;  1C7O A;  2W8J A;  1J04 A;  3P6K A;  2HUI A;  1CL1 A;  2CJG A;  4F5M A;  4DGT A;  1AKA A;  1N2T A;  4JF0 A;  1B9I A;  4MKK A;  3EIB A;  4BA5 A;  1GC0 A;  1MLZ A;  2BWN A;  2OAT A;  4WYA A;  3NRA A;  1ARI A;  4RKC A;  1AMA A;  5G2Q A;  1FC4 A;  2Z61 A;  4WBT A;  4IXZ A;  3R9A A;  3CAI A;  3M5U A;  2ZY3 A;  1GCK A;  1DGD A;  4RJ0 A;  3BC8 A;  2VI8 A;  3FDB A;  2VGS A;  4F5K A;  2DOU A;  2AY4 A;  1YJY A;  2HUU A;  4W8I A;  1OHW A;  2ZJG A;  5E5I A;  1D7U A;  1WKG A;  3K28 A;  4Q31 A;  3RUY A;  3BV0 A;  3JWB A;  4MGR A;  1GEY A;  3B46 A;  2W8V A;  4W91 A;  2R5C B;  1N8P A;  3Q8N A; 
#chains in the Genus database with same CATH homology
 4CXR A;  1D2F A;  2JG2 A;  4JEZ A;  1ARH A;  4UOY A;  5K8B A;  4BQ0 A;  3L44 A;  3BWN A;  3K7Y A;  5E4Z A;  2BYJ A;  2AEV A;  1LC8 A;  4A0G A;  3PJ0 A;  2HOY A;  2D65 A;  3QI6 A;  1YAA A;  3W1I A;  1ELU A;  1UU1 A;  5DJ9 A;  3QHX A;  1AMS A;  2ZSM A;  2ZC0 A;  1SZU A;  2O0R A;  4GEB A;  2AY1 A;  3MAD A;  2CAN A;  3RCH A;  4F5H A;  3CQ6 A;  3NX3 A;  4RIZ A;  4ZWM A;  2VGW A;  2X8U A;  3R4T A;  4Y0D A;  4ZAH A;  3N0L A;  1ASL A;  2GMS A;  3VP6 A;  3QPG A;  2BI2 A;  2R5E A;  1Z7D A;  4RAE A;  2VMT A;  3OKS A;  1E5E A;  4UHM A;  1AIB A;  1SFF A;  1BQD A;  4IYO A;  4K2I A;  2FKI A;  3WCN A;  4ITX A;  1TOE A;  1AIA A;  1AJR A;  3NYU A;  2ZY2 A;  3ASA A;  3EZS A;  2KFP A;  3B8X A;  1ZOD A;  2E54 A;  2FN6 A;  4IW7 A;  2CFB A;  4RM1 A;  1CJ0 A;  4WXB A;  2VMY A;  1W23 A;  1DFO A;  4LW4 A;  3MAU A;  5TF5 A;  4DBC A;  1X29 A;  4XK1 A;  1AY8 A;  2R0T A;  4WYG A;  4IY7 A;  1B5O A;  1LK9 A;  4E77 A;  2FNI A;  4NOG A;  2W7L A;  1VEF A;  1TOG A;  2BI3 A;  3JWA A;  2F8J A;  4AH3 A;  1C0N A;  1W7N A;  2DKJ A;  1BJ4 A;  3ZRR A;  1CQ7 A;  4WYE A;  4WB0 A;  3B1D A;  4U1T A;  1I29 A;  1IX7 A;  2BI5 A;  2YKU A;  2DGM A;  1GBN A;  4JE5 D;  1O61 A;  2VGU A;  4UQV A;  4W1V A;  5AX8 A;  3WKS A;  4A0H A;  1D7R A;  2VIA A;  3E9K A;  1ASB A;  3HT4 A;  1GD9 A;  4KAM A;  3H14 A;  3AOW A;  2ZSL A;  3VAX A;  1AHY A;  3ZZJ A;  1QJ5 A;  1AY4 A;  4F5F A;  1M4N A;  3EI5 A;  2E7I A;  5IWQ A;  2D61 A;  4UHN A;  8AAT A;  1MDO A;  4GSA A;  1MAP A;  3PDX A;  5J8Q A;  1E5F A;  2Z9V A;  3ECD A;  3F9T A;  3VOM A;  1AKC A;  1RV3 A;  3E2Z A;  3FDD A;  3JW9 A;  1OAT A;  2QB3 A;  4LNJ A;  1C9C A;  1JF9 A;  2AY2 A;  3FKD A;  4ZSY A;  4AO4 A;  1W3U A;  2VMU A;  4FL0 A;  3VK3 A;  1MDZ A;  4FFC A;  4JE5 A;  2VMN A;  1O4S A;  3EI8 A;  3NYT A;  2W8W A;  2ORD A;  2CTZ A;  3FFR A;  1SPA A;  2CY8 A;  4XJP A;  4OBU A;  3AEM A;  2OGE A;  2X3L A;  3AEN B;  4AO9 A;  2VIB A;  4RKD A;  1TAS A;  3L8A A;  1BQA A;  1W7L A;  1KL1 A;  1YNU A;  2GMU A;  3FVS A;  3TFU A;  1UU0 A;  2CH2 A;  4WB0 B;  3WGB A;  1M0Q A;  2CST A;  3MEB A;  4ISY A;  1BT4 A;  4OCA A;  5G2P A;  2HOZ A;  9AAT A;  2D5Y A;  3KE3 A;  4XEW A;  3TAT A;  2EYQ A;  2OKK A;  1AHF A;  1FG7 A;  3FQ8 A;  5D5S A;  2W7M A;  5LHA A;  1I43 A;  3NDN A;  1M0O A;  3ZRP A;  3N4R A;  3H7F A;  2BI9 A;  2GB3 A;  1IJI A;  2TPL A;  2DKB A;  1TPL A;  3QN6 A;  1S08 A;  4F5L A;  1IUG A;  2HZP A;  3K40 A;  5EIG B;  1V2E A;  4WXG A;  3WKR A;  3G7Q A;  1D7V A;  1JS3 A;  4O6Z A;  3AEP A;  1KKJ A;  4WXF A;  3BWN C;  3KGX A;  2QBT A;  2CIN A;  4Y0I A;  1OXP A;  3E6G A;  1WYU B;  4ADE A;  5C6U A;  3AEM C;  1T3I A;  3VK4 A;  1XI9 A;  4L0O A;  4E3Q A;  4J8L A;  2WB6 A;  2YOB A;  2BWP A;  4AZK A;  4E3R A;  2V0Y A;  4H63 Q;  2AY6 A;  3RBL A;  2BIA A;  3LV2 A;  1LS3 A;  1AHG A;  2R2N A;  1J32 A;  3AEJ C;  5EAA A;  4QGR A;  1AKB A;  1OHV A;  1G4V A;  1TAR A;  2C0R A;  4MQR A;  4EU1 A;  2VMQ A;  1G7X A;  2WK9 A;  1OXO A;  3FZ8 A;  4ADC A;  3NTJ A;  2FM1 A;  2D7Y A;  3LVL B;  1O62 A;  1YIZ A;  2VMV A;  5FT6 A;  5G4I A;  3N4X A;  1DTY A;  2BHX A;  3AOV A;  4JEV A;  4KXK A;  4EB5 A;  4CBR A;  3MC6 A;  3PDB A;  3HDO A;  2VGZ A;  3DXW A;  2QLR A;  4ADB A;  4A6T A;  3ELP A;  4Q6R A;  2AY5 A;  1DGE A;  2AEU A;  3MAF A;  4IXS A;  4LC3 A;  1ZOB A;  4LNM A;  1WYV B;  4P7Y A;  1LW5 A;  1WST A;  4IXO A;  4ZM3 A;  4F5J A;  4WYC A;  5D95 A;  2DGL A;  4A6U A;  1X28 A;  3PGY A;  3RBF A;  3TCM A;  1KKP A;  3FFH A;  3MBB A;  2JJF A;  4K2M A;  4ADD A;  1SZK A;  2HUF A;  3FVU A;  1FG3 A;  3E2F A;  4N0B A;  3AEJ A;  2FYF A;  4ZM4 A;  1UU2 A;  3UE8 A;  5M4D A;  3NUI A;  2EH6 A;  2W7E A;  4JEY A;  4BMK A;  1PFF A;  1I41 A;  2WKA A;  2CH1 A;  3FVX A;  1JG8 A;  4W5K A;  1S09 A;  1QZ9 A;  1GEW A;  3A9X A;  1DJE A;  3FQ7 A;  3LWS A;  4TV7 A;  3N4S A;  2EZ1 A;  1YJZ A;  4N0W A;  3EI9 A;  4MY5 A;  2W7F A;  4IYO B;  2JGT A;  4PVF A;  1Z3Z A;  3GBX A;  2Z1Y A;  4RIT A;  1AIC A;  4F5I A;  1AJS A;  3LVJ A;  3MAF B;  2W7K A;  3DZZ A;  3EI6 A;  2YRI A;  3ELE A;  3GSB A;  1PMM A;  3HLM A;  4Q76 A;  3LVK A;  4XJO A;  1MGV A;  2QB2 A;  2YHK A;  1LW4 A;  4P3M A;  3FTB A;  3FQA A;  3LG0 A;  1CS1 A;  1CZC A;  1EQB A;  3UWC A;  3TQX A;  2EGY A;  1LC5 A;  1B8G A;  4K2B A;  4BHD A;  2GQN A;  4IX8 A;  1B4X A;  2D63 A;  3DU4 A;  1GC3 A;  3W1H A;  2BI1 A;  3FRK A;  4ZWV A;  1V2F A;  2JJH A;  4A0R A;  4WP0 A;  3WGC A;  3F6T A;  1IX8 A;  3HL2 A;  5EAV A;  2CJH A;  5EUN A;  2QSR A;  4E1O A;  4MQQ A;  4HVK A;  2YCP A;  1CZE A;  2D66 A;  1EJI A;  1ART A;  3ATH A;  3MKJ A;  2VLF A;  3AV7 A;  1GEX A;  1AMQ A;  2O1B A;  2ZUK A;  1JS6 A;  4OTL A;  4RJY A;  4AZJ A;  3USF A;  1I48 A;  4UHO A;  3PDB B;  4EFF A;  2VMR A;  2HOX A;  7AAT A;  3COG A;  1ASG A;  2Z9X A;  2E7U A;  3JZL A;  1YIY A;  1AX4 A;  2W7D A;  1ORD A;  2VMS A;  1C7N A;  2DR1 A;  4ZDL A;  2AY3 A;  4HF8 A;  2C81 A;  4MSO A;  4OC9 A;  1BS0 A;  3DOD A;  2W7J A;  2EZ2 A;  4JF1 A;  1ZC9 A;  5FT8 A;  3HVY A;  4XAU A;  3DRD A;  1M32 A;  1LKC A;  3LY1 A;  4ZAS A;  4EMY A;  1GC4 A;  3E2Z B;  3FCR A;  2NMP A;  1AY5 A;  3KGW A;  1IVR A;  4F5G A;  2EO5 A;  5DX5 A;  3I5T A;  2FNU A;  4R2N A;  1QJ3 A;  1YJS A;  1YOO A;  3A8U X;  4M2J A;  4ATQ A;  1SF2 A;  3GZD C;  4B9B A;  1VJO A;  3HMU A;  1MAQ A;  3GWP A;  3GZD A;  3G0T A;  1AHE A;  1SVV A;  3WLX A;  2AY8 A;  1WYU A;  2YCT A;  1M6S A;  1W7M A;  1B9H A;  4GDY A;  4GE4 A;  4WLH A;  4J5U A;  3MC6 C;  4W1X A;  5JAY A;  4H51 A;  1X2A A;  3ASB A;  2G6W A;  4PIW A;  2VMW A;  1ARS A;  3DR4 A;  1QIR A;  3FZ7 A;  1BJW A;  1ASF A;  1C4K A;  2JIS A;  2JJG A;  3BS8 A;  1IAY A;  1S07 A;  2BYL A;  3AAT A;  5FT4 A;  5HXX A;  3AEO A;  2VGT A;  1U08 A;  4OYT A;  2A1V A;  2OGA A;  4ZSW A;  4CVQ A;  2Z20 A;  3NNK A;  2Z9W A;  5EIG A;  1BW0 A;  5M46 A;  2PO3 A;  1AAW A;  4ZDP A;  1S0A A;  5I92 A;  4XJL A;  3I16 A;  2Z9U A;  1ASN A;  4ITG A;  3ZZK A;  2W8T A;  4A6R A;  5EUD A;  4XJM A;  3GZC A;  1MDX A;  3T32 A;  3PIU A;  4M2M A;  4OT8 A;  1KL2 A;  2BKW A;  4U2H A;  1ASC A;  4ATP A;  3PD6 A;  1RVY A;  3A9Z A;  1PG8 A;  4WD2 A;  2X5D A;  5F8V A;  3BCX A;  3ACZ A;  1KMK A;  2BWO A;  3W1J A;  2BIG A;  5G0A A;  4CXQ A;  3H9X A;  2BIE A;  1MLY A;  3DC1 A;  2VLH A;  2XH1 A;  5BJ3 A;  3HBX A;  2C44 A;  4F4E A;  3IF2 A;  3GR9 A;  3TFT A;  1XEY A;  2YKY A;  1ASM A;  3CBF A;  3CQ5 A;  3RCH B;  2VI9 A;  1IX6 A;  1BJO A;  3WZF A;  2V1P A;  5F9S A;  4MQP A;  2AAT A;  5EUE A;  5HDM A;  4AOA A;  2GSA A;  4GE9 A;  1Y4I A;  2O7C A;  1WYT B;  1TAT A;  3JTX A;  1H1C A;  1IBJ A;  2D64 A;  4JEW A;  3D6K A;  2W7I A;  1CL2 A;  3GET A;  4WLJ A;  2ZY5 A;  1LC7 A;  2G7J A;  4R5F A;  1ECX A;  2PB0 A;  1VP4 A;  3NU7 A;  3E77 A;  3E2Y A;  1UKJ A;  3EUC A;  3N75 A;  2AY7 A;  4ZLV A;  2PB2 A;  4GRX A;  1BKG A;  2ZP7 A;  1PMO A;  1H0C A;  3RI6 A;  1ARG A;  1DKA A;  1EG5 A;  3BCB A;  3VK2 A;  2W7H A;  1GDE A;  3P1T A;  5M49 A;  5EQC A;  3QM2 A;  2YCN A;  2Z67 A;  4JEX A;  3EZ1 A;  1C7G A;  4A00 A;  2AY9 A;  3NU8 A;  2OKJ A;  2JJE A;  4M2K A;  3IHJ A;  1IAX A;  2OQX A;  2CJD A;  1CQ8 A;  2HP2 A;  1G7W A;  2QA3 A;  5G4J A;  3AEN A;  4LNL A;  2WK7 A;  4ZDO A;  4I8A A;  3LVM A;  3DR7 A;  4Y0H A;  1RV4 A;  3DYD A;  4WYD A;  4K05 A;  1D7S A;  3BN1 A;  2VMZ A;  1DJU A;  1S06 A;  4KYO A;  2QMA A;  4A0F A;  3N7N A;  3A9Y A;  1GC2 A;  4W1W A;  3JU7 A;  1WYT A;  3OP7 A;  3FZ6 A;  1AJS B;  2VMX A;  3FD0 A;  3ISL A;  3RQ1 A;  3KKI A;  5M4B A;  1SZS A;  1BJO B;  4XQ2 A;  5G09 A;  1WYV A;  3GJU A;  1TOJ A;  1M0P A;  3NUB A;  4EB7 A;  2CB1 A;  2YKV A;  4PFN A;  4OBV A;  2ZY4 A;  4R8D A;  1KMJ A;  1X0M A;  1DJ9 A;  2WK8 A;  4TMR A;  5HHY A;  1ELQ A;  3AEL A;  3BB8 A;  5E3K A;  3B1E A;  2EPJ A;  2DGK A;  2X5F A;  1G4X A;  3N5M A;  3DXV A;  1RVU A;  3I4J A;  1M7Y A;  3PD6 B;  3ZRQ A;  2E7J A;  1B5P A;  2Z1Z A;  2VMP A;  5DB5 A;  4BA4 A;  1P3W A;  4Q75 A;  3UAK A;  2W7G A;  4WYF A;  3QBO A;  3EIA A;  3HQT A;  2W8U A;  1TOK A;  2ZYJ A;  3PPL A;  1AAM A;  4LW2 A;  2C7T A;  4OMA A;  4RLG A;  3WCO A;  2XBN A;  2HOR A;  3F0H A;  4PFF A;  1AHX A;  1OHY A;  2YKX A;  3WY7 A;  3A2B A;  4DQ6 A;  2R5C A;  3CQ4 A;  3BCA A;  1N31 A;  3PAA A;  3B1C A;  1TOI A;  2FQ6 A;  5LH9 A;  1M0N A;  2VYC A;  4B98 A;  1QIT A;  3G8M A;  2VMO A;  2D7Z A;  4R5Z A;  1QGN A;  4TN4 A;  5EFS A;  3NYS A;  2RFV A;  1AMR A;  1V72 A;  4GE7 A;  5DJ1 A;  4A72 A;  1QIS A;  3PA9 A;  3QGU A;  1BJN A;  5KTB A;  3FSL A;  2HP1 A;  2VGV A;  4MKJ A;  1ASD A;  2YRR A;  1WKH A;  1ASA A;  3EI7 A;  5FT5 A;  1O69 A;  2Q7W A;  3WX9 A;  5BJ4 A;  1V2D A;  1CQ6 A;  3II0 A;  3BWO A;  4CBS A;  1ASE A;  1C7O A;  2W8J A;  1J04 A;  3P6K A;  2HUI A;  1CL1 A;  2CJG A;  4F5M A;  4DGT A;  1AKA A;  1N2T A;  4JF0 A;  1B9I A;  4MKK A;  3EIB A;  4BA5 A;  1GC0 A;  1MLZ A;  2BWN A;  2OAT A;  4WYA A;  3NRA A;  1ARI A;  4RKC A;  1AMA A;  5G2Q A;  1FC4 A;  2Z61 A;  4WBT A;  4IXZ A;  3R9A A;  3CAI A;  3M5U A;  2ZY3 A;  1GCK A;  1DGD A;  4RJ0 A;  3BC8 A;  2VI8 A;  3FDB A;  2VGS A;  4F5K A;  2DOU A;  2AY4 A;  1YJY A;  2HUU A;  4W8I A;  1OHW A;  2ZJG A;  5E5I A;  1D7U A;  1WKG A;  3K28 A;  4Q31 A;  3RUY A;  3BV0 A;  3JWB A;  4MGR A;  1GEY A;  3B46 A;  2W8V A;  4W91 A;  2R5C B;  1N8P A;  3Q8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...