1ASFA

The structural basis for the reduced activity of the y226f(y225f) active site mutant of e. coli aspartate aminotransferase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAFQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for the Reduced Activity of the Y226F(Y225F) Active Site Mutant of E. Coli Aspartate Aminotransferase
rcsb
source organism Escherichia coli
molecule tags Aminotransferase
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 116
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1asfA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1asfA01
4UOYA 2HUFA 4M2JA 3EZSA 3D6KA 2NMPA 3NUIA 3AOVA 3MEBA 1G4XA 2W7KA 3NYSA 4BQ0A 1JG8A 3FDDA 3OKSA 3AEMC 2VLHA 3L8AA 2CFBA 2YHKA 1T3IA 1EG5A 2W7IA 2BIGA 3MAFB 4WYAA 4ZWVA 3FQ7A 2PB0A 4A6UA 4HF8A 1JS3A 1MDXA 1V72A 4CVQA 5G0AA 1FG7A 3E9KA 3JTXA 1I29A 2YCTA 1KMJA 1AHFA 4LNLA 1AHGA 3K28A 2X3LA 3I4JA 2VMTA 4W1WA 2R5CB 2DKBA 4W1XA 1B8GA 5FT5A 3EIBA 5EAVA 3AV7A 5G4IA 1RVUA 3WCNA 1Y4IA 1B9HA 1E5FA 3ZZKA 3AOWA 2O1BA 3BCBA 2CJGA 4MQQA 2Q7WA 1AY4A 1C7GA 4I8AA 3TFUA 1DTYA 2YKYA 1DGEA 1CJ0A 2VGWA 1DKAA 5DJ9A 4WXFA 4WYCA 3MADA 3WGBA 2FNUA 1IX6A 3FKDA 1J32A 4LNMA 1IX7A 3HVYA 2ZSLA 3F6TA 1AHEA 2D66A 1GDEA 2DGMA 3E2FA 4JF1A 1I41A 2VI8A 3DR7A 1LC8A 5IWQA 2HOYA 4A72A 2VGUA 2W8TA 3NRAA 4WLHA 1DJEA 2YKVA 4AZJA 2QB3A 2Z67A 5TF5A 1Z3ZA 1BKGA 3NNKA 3A9YA 2QLRA 4TV7A 5BJ4A 1PMOA 2Z1ZA 4MSOA 2ORDA 1ASDA 2D61A 3TQXA 2FQ6A 3FD0A 1OHVA 4ZM4A 1SPAA 4GE4A 3GWPA 1ASFA 2E7IA 1TOEA 4ATPA 3FRKA 3NU7A 2W7DA 2CTZA 2ZY5A 4UQVA 2HORA 3A8UX 3EIAA 3PD6A 2Z1YA 5FT4A 3WLXA 4IYOA 3H14A 2VMQA 4B98A 2QBTA 2ZY2A 1KL1A 1UKJA 3GZDC 1ZC9A 2E7JA 2W7GA 2Z9UA 4P7YA 3COGA 1B5OA 1RVYA 3ZZJA 5K8BA 5M4DA 4GRXA 1ARSA 1OATA 2R2NA 3H7FA 3DZZA 4ATQA 2D64A 4OYTA 2W7HA 1QJ5A 2JISA 4WP0A 2AY6A 1JF9A 2D65A 4GDYA 4ADCA 1ARHA 3N75A 1BJOB 1YAAA 3FVUA 1C4KA 1C7OA 2CB1A 3PA9A 4ZAHA 1ARTA 3B1DA 1V2EA 2X5FA 4JEXA 4P3MA 3HDOA 3B1CA 4ZSWA 3MC6A 2FYFA 1SF2A 3FFRA 4F5FA 3UAKA 1IX8A 1VP4A 1ASCA 2BWOA 1AKCA 3LG0A 1I43A 1G7WA 2VLFA 3AEJA 3KKIA 4F5HA 4WBTA 3HLMA 2RFVA 4DGTA 1MDOA 4KXKA 3BWOA 1YJYA 1MGVA 1C0NA 1EJIA 3CQ5A 3LWSA 5EUEA 4O6ZA 4E77A 5DX5A 4Q75A 3RI6A 2BKWA 3WKSA 1ECXA 4IX8A 2BWNA 1B4XA 2W8VA 4Q31A 2GMSA 2AEVA 5JAYA 1SZKA 2BI5A 3BCXA 4IXZA 1ARGA 3AATA 4ZSYA 2YCNA 1GD9A 1D2FA 3NTJA 2D7ZA 5EQCA 4OBUA 1P3WA 3AEMA 3BC8A 1TARA 3EI5A 7AATA 1BT4A 4WB0B 1H0CA 3L44A 1CQ7A 2JJFA 1QGNA 3MBBA 2Z20A 1TPLA 2BYLA 3E2YA 3ECDA 3LY1A 1KKPA 3QGUA 3UWCA 2ZSMA 1M32A 3BS8A 2W7FA 2JGTA 1KMKA 2AY4A 3P6KA 2CINA 2VMZA 3ZRQA 5F9SA 2BYJA 2R5EA 1C7NA 1AICA 4UHMA 1LK9A 1AMSA 5BJ3A 4MQRA 1TOIA 1ARIA 4XJMA 4AZKA 1FC4A 1W7LA 3DR4A 3EI7A 1W7MA 2EPJA 4LC3A 2XH1A 3ZRRA 1AY8A 4KAMA 2G6WA 1H1CA 1ASMA 3K40A 5EAAA 4E3RA 1AJRA 5DB5A 4JEVA 1SZUA 2AY5A 3FQAA 3FQ8A 1LW4A 4OC9A 5M46A 3W1HA 4R2NA 2VIBA 3QN6A 4RJYA 4W8IA 3CQ4A 2VMRA 9AATA 1M6SA 4OTLA 5HXXA 1B9IA 1BJOA 1OHYA 4CXQA 4WYGA 1CS1A 3F0HA 2V1PA 3LVMA 1BS0A 2QB2A 1WYUA 4EB5A 1V2FA 3RQ1A 4AO4A 2HP1A 4Y0IA 3VK3A 4JEZA 4E3QA 1G4VA 1W23A 4Q76A 4A0FA 1BQAA 2HOXA 4AH3A 3QI6A 4F5MA 1OXPA 2EH6A 3A9ZA 1OXOA 3DYDA 3FDBA 3RBLA 4B9BA 4ZM3A 1ZOBA 2AEUA 2BIEA 3F9TA 3FZ8A 1BW0A 2X5DA 2ZJGA 4U1TA 2QA3A 5G2QA 2ZYJA 3CQ6A 2WK9A 1AJSA 5EUNA 1O62A 2DGKA 2VMPA 2HZPA 3B8XA 3LVKA 3MAUA 4LW2A 4F5KA 1O4SA 3IHJA 4TMRA 5G2PA 4F5LA 4ZDOA 2YRRA 2VMUA 1D7VA 4EB7A 4MY5A 2EO5A 4Y0DA 4ADBA 1YJSA 3PPLA 2YKUA 3FZ6A 1OHWA 4RITA 3RCHB 4OMAA 4F5IA 1ASGA 1AMQA 1ASBA 2GMUA 3VP6A 1AHXA 3II0A 3HMUA 4DQ6A 4XJOA 1LC5A 3I5TA 1D7RA 1IVRA 3HL2A 2ZY3A 3VAXA 3FTBA 2Z9VA 1UU2A 3PIUA 2WK8A 4BA5A 1X29A 4K2BA 4IXOA 3EZ1A 2CSTA 4OCAA 4RLGA 5FT8A 1X2AA 3PDBB 1XI9A 4LW4A 3AEOA 4M2MA 3ELEA 3JWAA 2BIAA 4K2MA 4A6RA 1X28A 1MDZA 3PGYA 2DOUA 4N0BA 1W3UA 1I48A 2BI9A 4WD2A 3AEJC 3EI8A 1M0OA 3WZFA 1CL2A 3ELPA 1TOJA 1AJSB 3N5MA 2D63A 4Q6RA 2R5CA 1CQ8A 1ASLA 1UU0A 4A6TA 4XJPA 3FFHA 1MLYA 2CY8A 1AKBA 5I92A 5F8VA 2O0RA 3RUYA 1W7NA 3E77A 4WYDA 1SFFA 3WKRA 5M49A 1YIZA 1CQ6A 4WXGA 1AMAA 3VOMA 3PAAA 2VYCA 3FVXA 3DXVA 3DU4A 3HQTA 4GEBA 1WYUB 1MAPA 1YJZA 2JG2A 2CH2A 3AELA 3EI9A 1O69A 2AY9A 3UE8A 1S09A 3I16A 3TATA 2YKXA 2F8JA 4BA4A 2AATA 2HUUA 3WCOA 1CZCA 3NYUA 4ZASA 1M7YA 2E7UA 3B1EA 2C0RA 2W8JA 1YOOA 2ZC0A 2WKAA 1GC4A 2JJGA 2OQXA 3E2ZA 3IF2A 3NDNA 4L0OA 1LC7A 2VGTA 4EMYA 2FNIA 3WGCA 1QJ3A 2ZUKA 4ADDA 4XK1A 3BWNC 1AAMA 4A0HA 1M0PA 1GC2A 2QMAA 4UHOA 3TCMA 1M0NA 3PJ0A 4CBRA 5G4JA 2VGZA 4ZWMA 4W1VA 1WYTB 4QGRA 2CANA 2PB2A 2BI2A 2FM1A 2VGVA 1D7UA 4ITXA 3HBXA 4OT8A 4JF0A 3QM2A 4EU1A 1GC0A 4JE5A 1BJWA 3B46A 2D5YA 2OKKA 1BJ4A 1QIRA 2W7LA 1IBJA 3JW9A 1ZODA 1MLZA 4FL0A 2FN6A 3M5UA 4J8LA 1WYVA 2VMWA 3ZRPA 3QPGA 4WB0A 1SVVA 3DRDA 2YCPA 4H51A 3ATHA 1D7SA 3FZ7A 3KE3A 1S07A 3NUBA 1AX4A 1V2DA 1WYTA 3GETA 3P1TA 4R8DA 5M4BA 3TFTA 4ISYA 1N8PA 4JEWA 4J5UA 1M4NA 2EZ2A 4BHDA 2CJHA 1DGDA 1AIBA 3MAFA 3DC1A 4BMKA 1PMMA 1X0MA 4NOGA 3FCRA 5E3KA 5EUDA 3A9XA 3VK2A 1ASEA 5HDMA 2Z9WA 1AKAA 3BV0A 3NX3A 4CXRA 3G0TA 1BJNA 3JWBA 5LH9A 3R9AA 2VMYA 1PG8A 3E2ZB 3JZLA 5D95A 4ZDPA 4MGRA 2VMVA 1BQDA 2W7JA 2VI9A 2BI3A 1DFOA 1IAXA 4XEWA 5EIGA 4WLJA 4PVFA 4DBCA 1GEYA 1TOGA 3KGWA 3W1IA 3WX9A 2DR1A 1Z7DA 5J8QA 1KL2A 1U08A 1GCKA 2AY1A 4WYEA 1YIYA 1JS6A 1PFFA 2W8WA 3EUCA 2HUIA 2OATA 3OP7A 4ZLVA 4F4EA 3PDXA 2D7YA 1QITA 1VJOA 2XBNA 3JU7A 3LVJA 2C44A 2W8UA 1G7XA 4TN4A 4W91A 1O61A 4WXBA 1CZEA 2ZP7A 2W7EA 5LHAA 4GSAA 4WYFA 4ADEA 4PFNA 1AIAA 1E5EA 4RKCA 2E54A 2DGLA 3Q8NA 1YNUA 5EFSA 2PO3A 2HOZA 5HHYA 1QISA 3E6GA 4AO9A 4CBSA 1EQBA 1ASNA 4IYOB 4IW7A 5E5IA 2OGAA 2JJEA 3BCAA 4MKJA 4RKDA 3PD6B 3ISLA 1IJIA 1N2TA 4R5FA 3MKJA 5E4ZA 3W1JA 2EGYA 1M0QA 2JJHA 4KYOA 4E1OA 3QBOA 2C7TA 2AY7A 1TASA 2BWPA 3AENB 4JEYA 4MQPA 3ASAA 1AAWA 4F5JA 4Y0HA 1N31A 4PFFA 1DJ9A 4MKKA 2DKJA 1TOKA 1S0AA 3BWNA 3PDBA 2Z61A 2C81A 3HT4A 2AY2A 1IUGA 3EI6A 1S06A 1FG3A 2OKJA 3G7QA 3A2BA 3LVLB 2R0TA 3QHXA 4K2IA 2W7MA 3RBFA 1LW5A 5AX8A 2VMSA 1SZSA 4XJLA 1GEWA 3T32A 3WY7A 2TPLA 3BB8A 3NU8A 2CH1A 3RCHA 1VEFA 3DODA 1RV3A 4FFCA 2CJDA 3LV2A 1LS3A 1GEXA 2VGSA 2VMNA 4F5GA 4PIWA 1RV4A 2GSAA 1S08A 4XQ2A 3FSLA 1B5PA 1WSTA 2VMOA 3GZDA 3VK4A 3FVSA 3DXWA 3AENA 4JE5D 4W5KA 3ACZA 4HVKA 4IY7A 4M2KA 4GE9A 1J04A 1CL1A 3GJUA 1WYVB 3G8MA 4UHNA 4IXSA 2VIAA 1GC3A 2BI1A 2HP2A 1ASAA 1UU1A 2OGEA 2X8UA 3CAIA 1AY5A 4RIZA 2Z9XA 3R4TA 4RAEA 5DJ1A 2O7CA 3ASBA 4GE7A 1KKJA 1C9CA 4U2HA 1TATA 2ZY4A 5G09A 4R5ZA 4A00A 3CBFA 3USFA 4A0RA 2WK7A 5D5SA 2V0YA 3MC6C 4RM1A 3KGXA 2VMXA 3GSBA 4RJ0A 4LNJA 1IAYA 2AY3A 4A0GA 5C6UA 1LKCA 1ORDA 4ZDLA 3NYTA 3N0LA 1DJUA 1WKGA 3GBXA 1WKHA 3AEPA 4AOAA 1AHYA 3K7YA 1GBNA 2GB3A 4EFFA 5FT6A 4ITGA 1MAQA 8AATA 2YOBA 1AMRA 4XAUA 5EIGB 2GQNA 1ELUA 1QZ9A 3GZCA 2YRIA 3GR9A 2BHXA 1XEYA 3BN1A 4N0WA 2AY8A 4OBVA 2EZ1A 1ELQA
chains in the Genus database with same CATH superfamily
4UOYA 2HUFA 4M2JA 3EZSA 3D6KA 2NMPA 3NUIA 3AOVA 3MEBA 1G4XA 2W7KA 3NYSA 4BQ0A 1JG8A 2A1VA 3FDDA 3OKSA 3AEMC 5KTBA 2VLHA 3L8AA 2CFBA 2YHKA 1T3IA 1EG5A 2W7IA 2BIGA 3MAFB 4WYAA 4ZWVA 3FQ7A 2PB0A 4A6UA 3N4RA 4HF8A 1JS3A 1MDXA 1V72A 4CVQA 5G0AA 1FG7A 3E9KA 3JTXA 1I29A 2YCTA 1KMJA 1AHFA 4LNLA 1AHGA 3K28A 2X3LA 3I4JA 2VMTA 4W1WA 2R5CB 2DKBA 4W1XA 1B8GA 5FT5A 3EIBA 5EAVA 3AV7A 5G4IA 1RVUA 3WCNA 1Y4IA 1B9HA 1E5FA 3ZZKA 3AOWA 2O1BA 3BCBA 2CJGA 4MQQA 2Q7WA 1AY4A 1C7GA 4I8AA 3TFUA 1DTYA 2YKYA 1DGEA 1CJ0A 2VGWA 1DKAA 5DJ9A 4WXFA 4WYCA 3MADA 3WGBA 2FNUA 1IX6A 3FKDA 1J32A 4LNMA 1IX7A 3HVYA 2ZSLA 3F6TA 1AHEA 2D66A 1GDEA 2DGMA 3E2FA 4JF1A 1I41A 2VI8A 3DR7A 1LC8A 5IWQA 2HOYA 4A72A 2VGUA 2W8TA 3NRAA 4WLHA 1DJEA 2YKVA 4AZJA 2G7JA 2QB3A 2Z67A 5TF5A 1Z3ZA 1BKGA 3NNKA 3A9YA 2QLRA 4TV7A 5BJ4A 1PMOA 2Z1ZA 4MSOA 2ORDA 1ASDA 2D61A 3TQXA 2FQ6A 3FD0A 1OHVA 4ZM4A 1SPAA 4GE4A 3GWPA 1ASFA 2E7IA 1TOEA 4ATPA 3FRKA 3NU7A 2W7DA 2CTZA 2ZY5A 4UQVA 2HORA 3A8UX 3EIAA 3PD6A 2Z1YA 5FT4A 3WLXA 4IYOA 3H14A 2VMQA 4B98A 2QBTA 2ZY2A 1KL1A 1UKJA 3GZDC 1ZC9A 2E7JA 2W7GA 2Z9UA 4P7YA 3COGA 1B5OA 1RVYA 3ZZJA 5K8BA 5M4DA 4GRXA 1ARSA 1OATA 2R2NA 3H7FA 3DZZA 4ATQA 2D64A 4OYTA 2W7HA 1QJ5A 2JISA 4WP0A 2AY6A 1JF9A 2D65A 4GDYA 4ADCA 1ARHA 3N75A 1BJOB 1YAAA 3FVUA 1C4KA 1C7OA 2CB1A 3PA9A 4ZAHA 1ARTA 4H63Q 3B1DA 1V2EA 2X5FA 4JEXA 4P3MA 3HDOA 3B1CA 4ZSWA 3MC6A 2FYFA 1SF2A 3FFRA 4F5FA 3UAKA 1IX8A 1VP4A 1ASCA 2BWOA 1AKCA 3LG0A 1I43A 1G7WA 2VLFA 3AEJA 3KKIA 3N7NA 4F5HA 4WBTA 3HLMA 2RFVA 4DGTA 1MDOA 4KXKA 3BWOA 1YJYA 1MGVA 1C0NA 1EJIA 3CQ5A 3LWSA 5EUEA 4O6ZA 4E77A 3H9XA 5DX5A 4Q75A 3RI6A 2BKWA 3WKSA 1ECXA 4IX8A 2BWNA 1B4XA 2W8VA 4Q31A 2GMSA 2AEVA 5JAYA 1SZKA 2BI5A 3BCXA 4IXZA 1ARGA 3AATA 4ZSYA 2YCNA 1GD9A 1D2FA 3NTJA 2D7ZA 5EQCA 4OBUA 1P3WA 3AEMA 3BC8A 1TARA 3EI5A 7AATA 1BT4A 4WB0B 1H0CA 3L44A 1CQ7A 2JJFA 1QGNA 3MBBA 2Z20A 1TPLA 2BYLA 3E2YA 3ECDA 3LY1A 1KKPA 3QGUA 3UWCA 2ZSMA 1M32A 3BS8A 2W7FA 2JGTA 1KMKA 2AY4A 3P6KA 2CINA 2VMZA 3ZRQA 5F9SA 2BYJA 2R5EA 1C7NA 1AICA 4UHMA 1LK9A 1AMSA 5BJ3A 4MQRA 1TOIA 1ARIA 4XJMA 4AZKA 1FC4A 1W7LA 3DR4A 3EI7A 1W7MA 2EPJA 4LC3A 2XH1A 3ZRRA 2QSRA 1AY8A 4KAMA 2G6WA 1H1CA 1ASMA 2KFPA 3K40A 5EAAA 4E3RA 1AJRA 5DB5A 4JEVA 1SZUA 2AY5A 3FQAA 3FQ8A 1LW4A 4OC9A 5M46A 3W1HA 4R2NA 2VIBA 3QN6A 4RJYA 4W8IA 3CQ4A 2VMRA 9AATA 1M6SA 4OTLA 5HXXA 1B9IA 1BJOA 1OHYA 4CXQA 4WYGA 1CS1A 3F0HA 2V1PA 3LVMA 1BS0A 2QB2A 1WYUA 4EB5A 1V2FA 3RQ1A 4AO4A 2HP1A 4Y0IA 3VK3A 4JEZA 4E3QA 1G4VA 1W23A 4Q76A 4A0FA 1BQAA 2HOXA 4AH3A 3QI6A 4F5MA 1OXPA 2EH6A 3A9ZA 1OXOA 3DYDA 3FDBA 3RBLA 4B9BA 4ZM3A 1ZOBA 2AEUA 2BIEA 3F9TA 3FZ8A 1BW0A 2X5DA 2ZJGA 4U1TA 2QA3A 5G2QA 2ZYJA 3CQ6A 2WK9A 1AJSA 5EUNA 1O62A 2DGKA 2VMPA 2HZPA 3B8XA 3LVKA 3MAUA 4LW2A 4F5KA 1O4SA 3IHJA 4TMRA 5G2PA 4F5LA 4ZDOA 2YRRA 2VMUA 1D7VA 4EB7A 4MY5A 2EO5A 4Y0DA 4ADBA 1YJSA 3PPLA 2YKUA 3FZ6A 1OHWA 4RITA 3RCHB 4OMAA 4F5IA 1ASGA 1AMQA 1ASBA 2GMUA 3VP6A 1AHXA 3II0A 3HMUA 4DQ6A 4XJOA 1LC5A 3I5TA 1D7RA 1IVRA 3HL2A 2ZY3A 3VAXA 3FTBA 2Z9VA 1UU2A 3PIUA 2WK8A 4BA5A 1X29A 4K2BA 4IXOA 3EZ1A 2CSTA 4OCAA 4RLGA 5FT8A 1X2AA 3PDBB 1XI9A 4LW4A 3AEOA 4M2MA 3ELEA 3JWAA 2BIAA 4K2MA 4A6RA 3N4SA 1X28A 1MDZA 3PGYA 2DOUA 4N0BA 1W3UA 1I48A 2BI9A 4WD2A 3AEJC 3EI8A 1M0OA 3WZFA 1CL2A 3ELPA 1TOJA 1AJSB 3N5MA 2D63A 4Q6RA 2R5CA 1CQ8A 1ASLA 1UU0A 4A6TA 4XJPA 3FFHA 1MLYA 2CY8A 1AKBA 5I92A 5F8VA 2O0RA 3RUYA 1W7NA 3E77A 4WYDA 1SFFA 3WKRA 5M49A 1YIZA 1CQ6A 4WXGA 1AMAA 3VOMA 3PAAA 2VYCA 3FVXA 4K05A 3DXVA 3DU4A 3HQTA 3N4XA 4GEBA 1WYUB 1MAPA 1YJZA 2JG2A 2CH2A 3AELA 3EI9A 1O69A 2AY9A 3UE8A 1S09A 3I16A 3TATA 2FKIA 2YKXA 2F8JA 4BA4A 2AATA 2WB6A 2HUUA 3WCOA 1CZCA 3NYUA 4ZASA 1M7YA 2E7UA 3B1EA 2C0RA 2W8JA 1YOOA 2ZC0A 2WKAA 1GC4A 2JJGA 2OQXA 3E2ZA 3IF2A 3NDNA 4L0OA 1LC7A 2VGTA 4EMYA 2FNIA 3WGCA 1QJ3A 2ZUKA 4ADDA 4XK1A 3BWNC 1AAMA 4A0HA 1M0PA 1GC2A 2QMAA 4UHOA 3TCMA 1M0NA 3PJ0A 4CBRA 5G4JA 2VGZA 4ZWMA 4W1VA 1WYTB 4QGRA 2CANA 2PB2A 2BI2A 2FM1A 2VGVA 1D7UA 4ITXA 3HBXA 4OT8A 4JF0A 3QM2A 4EU1A 1GC0A 4JE5A 1BJWA 3B46A 2D5YA 2OKKA 1BJ4A 1QIRA 2W7LA 1IBJA 3JW9A 1ZODA 1MLZA 4FL0A 2FN6A 3M5UA 4J8LA 1WYVA 2VMWA 3ZRPA 3QPGA 4WB0A 1SVVA 3DRDA 2YCPA 4H51A 3ATHA 1D7SA 3FZ7A 3KE3A 1S07A 3NUBA 1AX4A 1V2DA 1WYTA 3GETA 3P1TA 4R8DA 5M4BA 3TFTA 4ISYA 1N8PA 4JEWA 4J5UA 1M4NA 2EZ2A 4BHDA 2CJHA 1DGDA 1AIBA 3MAFA 3DC1A 4BMKA 1PMMA 1X0MA 4NOGA 3FCRA 5E3KA 5EUDA 3A9XA 3VK2A 1ASEA 5HDMA 2Z9WA 1AKAA 3BV0A 3NX3A 4CXRA 3G0TA 1BJNA 3JWBA 5LH9A 3R9AA 2VMYA 1PG8A 3E2ZB 3JZLA 5D95A 4ZDPA 4MGRA 2VMVA 1BQDA 2W7JA 2VI9A 2BI3A 1DFOA 1IAXA 4XEWA 5EIGA 4WLJA 4PVFA 4DBCA 1GEYA 1TOGA 3KGWA 3W1IA 3WX9A 2DR1A 1Z7DA 5J8QA 1KL2A 1U08A 1GCKA 2AY1A 4WYEA 1YIYA 1JS6A 1PFFA 2W8WA 3EUCA 2HUIA 2OATA 3OP7A 4ZLVA 4F4EA 3PDXA 2D7YA 1QITA 1VJOA 2XBNA 3JU7A 3LVJA 2C44A 2W8UA 1G7XA 4TN4A 4W91A 1O61A 4WXBA 1CZEA 2ZP7A 2W7EA 5LHAA 4GSAA 4WYFA 4ADEA 4PFNA 1AIAA 1E5EA 4RKCA 2E54A 2DGLA 3Q8NA 1YNUA 5EFSA 2PO3A 2HOZA 5HHYA 1QISA 3E6GA 4AO9A 4CBSA 1EQBA 1ASNA 4IYOB 1KAFA 4IW7A 5E5IA 2OGAA 2JJEA 3BCAA 4MKJA 4RKDA 3PD6B 3ISLA 1IJIA 1N2TA 4R5FA 3MKJA 5E4ZA 3W1JA 2EGYA 1M0QA 2JJHA 4KYOA 4E1OA 3QBOA 2C7TA 2AY7A 1TASA 2BWPA 3AENB 4JEYA 4MQPA 3ASAA 1AAWA 4F5JA 4Y0HA 1N31A 4PFFA 1DJ9A 4MKKA 2DKJA 1TOKA 1S0AA 3BWNA 3PDBA 2Z61A 2C81A 3HT4A 2AY2A 1IUGA 3EI6A 1S06A 1FG3A 2OKJA 3G7QA 3A2BA 3LVLB 2R0TA 3QHXA 4K2IA 2W7MA 3RBFA 1LW5A 5AX8A 2VMSA 1SZSA 4XJLA 1GEWA 3T32A 3WY7A 2TPLA 3BB8A 3NU8A 2CH1A 3RCHA 1VEFA 3DODA 1RV3A 4FFCA 2CJDA 3LV2A 1LS3A 1GEXA 2VGSA 2VMNA 4F5GA 4PIWA 1RV4A 2GSAA 1S08A 4XQ2A 3FSLA 1B5PA 1WSTA 2VMOA 3GZDA 3VK4A 3FVSA 3DXWA 3AENA 4JE5D 4W5KA 3ACZA 4HVKA 4IY7A 4M2KA 4GE9A 1J04A 1CL1A 3GJUA 1WYVB 3G8MA 4UHNA 4IXSA 2VIAA 1GC3A 2BI1A 2HP2A 1ASAA 1UU1A 2OGEA 2X8UA 3CAIA 1AY5A 4RIZA 2Z9XA 3R4TA 4RAEA 5DJ1A 2O7CA 3ASBA 4GE7A 1KKJA 1C9CA 4U2HA 1TATA 2ZY4A 5G09A 4R5ZA 4A00A 2EYQA 3CBFA 3USFA 4A0RA 2WK7A 5D5SA 2V0YA 3MC6C 4RM1A 3KGXA 2VMXA 3GSBA 4RJ0A 4LNJA 1IAYA 2AY3A 4A0GA 5C6UA 1LKCA 1ORDA 4ZDLA 3NYTA 3N0LA 1DJUA 1WKGA 3GBXA 1WKHA 3AEPA 4AOAA 1AHYA 3K7YA 1GBNA 2GB3A 4EFFA 5FT6A 4ITGA 1MAQA 8AATA 2YOBA 1AMRA 4XAUA 5EIGB 2GQNA 1ELUA 1QZ9A 3GZCA 2YRIA 3GR9A 2BHXA 1XEYA 3BN1A 4N0WA 2AY8A 4OBVA 2EZ1A 1ELQA
chains in the Genus database with same CATH topology
4UOYA 2HUFA 4M2JA 3EZSA 3D6KA 2NMPA 3NUIA 3AOVA 3MEBA 1G4XA 2W7KA 3NYSA 4BQ0A 1JG8A 2A1VA 3FDDA 3OKSA 3AEMC 5KTBA 2VLHA 3L8AA 2CFBA 2YHKA 1T3IA 1EG5A 2W7IA 2BIGA 3MAFB 4WYAA 4ZWVA 3FQ7A 2PB0A 4A6UA 3N4RA 4HF8A 1JS3A 1MDXA 1V72A 4CVQA 5G0AA 1FG7A 3E9KA 3JTXA 1I29A 2YCTA 1KMJA 1AHFA 4LNLA 1AHGA 3K28A 2X3LA 3I4JA 2VMTA 4W1WA 2R5CB 2DKBA 4W1XA 1B8GA 5FT5A 3EIBA 5EAVA 3AV7A 5G4IA 1RVUA 3WCNA 1Y4IA 1B9HA 1E5FA 3ZZKA 3AOWA 2O1BA 3BCBA 2CJGA 4MQQA 2Q7WA 1AY4A 1C7GA 4I8AA 3TFUA 1DTYA 2YKYA 1DGEA 1CJ0A 2VGWA 1DKAA 5DJ9A 4WXFA 4WYCA 3MADA 3WGBA 2FNUA 1IX6A 3FKDA 1J32A 4LNMA 1IX7A 3HVYA 2ZSLA 3F6TA 1AHEA 2D66A 1GDEA 2DGMA 3E2FA 4JF1A 1I41A 2VI8A 3DR7A 1LC8A 5IWQA 2HOYA 4A72A 2VGUA 2W8TA 3NRAA 4WLHA 1DJEA 2YKVA 4AZJA 2G7JA 2QB3A 2Z67A 5TF5A 1Z3ZA 1BKGA 3NNKA 3A9YA 2QLRA 4TV7A 5BJ4A 1PMOA 2Z1ZA 4MSOA 2ORDA 1ASDA 2D61A 3TQXA 2FQ6A 3FD0A 1OHVA 4ZM4A 1SPAA 4GE4A 3GWPA 1ASFA 2E7IA 1TOEA 4ATPA 3FRKA 3NU7A 2W7DA 2CTZA 2ZY5A 4UQVA 2HORA 3A8UX 3EIAA 3PD6A 2Z1YA 5FT4A 3WLXA 4IYOA 3H14A 2VMQA 4B98A 2QBTA 2ZY2A 1KL1A 1UKJA 3GZDC 1ZC9A 2E7JA 2W7GA 2Z9UA 4P7YA 3COGA 1B5OA 1RVYA 3ZZJA 5K8BA 5M4DA 4GRXA 1ARSA 1OATA 2R2NA 3H7FA 3DZZA 4ATQA 2D64A 4OYTA 2W7HA 1QJ5A 2JISA 4WP0A 2AY6A 1JF9A 2D65A 4GDYA 4ADCA 1ARHA 3N75A 1BJOB 1YAAA 3FVUA 1C4KA 1C7OA 2CB1A 3PA9A 4ZAHA 1ARTA 4H63Q 3B1DA 1V2EA 2X5FA 4JEXA 4P3MA 3HDOA 3B1CA 4ZSWA 3MC6A 2FYFA 1SF2A 3FFRA 4F5FA 3UAKA 1IX8A 1VP4A 1ASCA 2BWOA 1AKCA 3LG0A 1I43A 1G7WA 2VLFA 3AEJA 3KKIA 3N7NA 4F5HA 4WBTA 3HLMA 2RFVA 4DGTA 1MDOA 4KXKA 3BWOA 1YJYA 1MGVA 1C0NA 1EJIA 3CQ5A 3LWSA 5EUEA 4O6ZA 4E77A 3H9XA 5DX5A 4Q75A 3RI6A 2BKWA 3WKSA 1ECXA 4IX8A 2BWNA 1B4XA 2W8VA 4Q31A 2GMSA 2AEVA 5JAYA 1SZKA 2BI5A 3BCXA 4IXZA 1ARGA 3AATA 4ZSYA 2YCNA 1GD9A 1D2FA 3NTJA 2D7ZA 5EQCA 4OBUA 1P3WA 3AEMA 3BC8A 1TARA 3EI5A 7AATA 1BT4A 4WB0B 1H0CA 3L44A 1CQ7A 2JJFA 1QGNA 3MBBA 2Z20A 1TPLA 2BYLA 3E2YA 3ECDA 3LY1A 1KKPA 3QGUA 3UWCA 2ZSMA 1M32A 3BS8A 2W7FA 2JGTA 1KMKA 2AY4A 3P6KA 2CINA 2VMZA 3ZRQA 5F9SA 2BYJA 2R5EA 1C7NA 1AICA 4UHMA 1LK9A 1AMSA 5BJ3A 4MQRA 1TOIA 1ARIA 4XJMA 4AZKA 1FC4A 1W7LA 3DR4A 3EI7A 1W7MA 2EPJA 4LC3A 2XH1A 3ZRRA 2QSRA 1AY8A 4KAMA 2G6WA 1H1CA 1ASMA 2KFPA 3K40A 5EAAA 4E3RA 1AJRA 5DB5A 4JEVA 1SZUA 2AY5A 3FQAA 3FQ8A 1LW4A 4OC9A 5M46A 3W1HA 4R2NA 2VIBA 3QN6A 4RJYA 4W8IA 3CQ4A 2VMRA 9AATA 1M6SA 4OTLA 5HXXA 1B9IA 1BJOA 1OHYA 4CXQA 4WYGA 1CS1A 3F0HA 2V1PA 3LVMA 1BS0A 2QB2A 1WYUA 4EB5A 1V2FA 3RQ1A 4AO4A 2HP1A 4Y0IA 3VK3A 4JEZA 4E3QA 1G4VA 1W23A 4Q76A 4A0FA 1BQAA 2HOXA 4AH3A 3QI6A 4F5MA 1OXPA 2EH6A 3A9ZA 1OXOA 3DYDA 3FDBA 3RBLA 4B9BA 4ZM3A 1ZOBA 2AEUA 2BIEA 3F9TA 3FZ8A 1BW0A 2X5DA 2ZJGA 4U1TA 2QA3A 5G2QA 2ZYJA 3CQ6A 2WK9A 1AJSA 5EUNA 1O62A 2DGKA 2VMPA 2HZPA 3B8XA 3LVKA 3MAUA 4LW2A 4F5KA 1O4SA 3IHJA 4TMRA 5G2PA 4F5LA 4ZDOA 2YRRA 2VMUA 1D7VA 4EB7A 4MY5A 2EO5A 4Y0DA 4ADBA 1YJSA 3PPLA 2YKUA 3FZ6A 1OHWA 4RITA 3RCHB 4OMAA 4F5IA 1ASGA 1AMQA 1ASBA 2GMUA 3VP6A 1AHXA 3II0A 3HMUA 4DQ6A 4XJOA 1LC5A 3I5TA 1D7RA 1IVRA 3HL2A 2ZY3A 3VAXA 3FTBA 2Z9VA 1UU2A 3PIUA 2WK8A 4BA5A 1X29A 4K2BA 4IXOA 3EZ1A 2CSTA 4OCAA 4RLGA 5FT8A 1X2AA 3PDBB 1XI9A 4LW4A 3AEOA 4M2MA 3ELEA 3JWAA 2BIAA 4K2MA 4A6RA 3N4SA 1X28A 1MDZA 3PGYA 2DOUA 4N0BA 1W3UA 1I48A 2BI9A 4WD2A 3AEJC 3EI8A 1M0OA 3WZFA 1CL2A 3ELPA 1TOJA 1AJSB 3N5MA 2D63A 4Q6RA 2R5CA 1CQ8A 1ASLA 1UU0A 4A6TA 4XJPA 3FFHA 1MLYA 2CY8A 1AKBA 5I92A 5F8VA 2O0RA 3RUYA 1W7NA 3E77A 4WYDA 1SFFA 3WKRA 5M49A 1YIZA 1CQ6A 4WXGA 1AMAA 3VOMA 3PAAA 2VYCA 3FVXA 4K05A 3DXVA 3DU4A 3HQTA 3N4XA 4GEBA 1WYUB 1MAPA 1YJZA 2JG2A 2CH2A 3AELA 3EI9A 1O69A 2AY9A 3UE8A 1S09A 3I16A 3TATA 2FKIA 2YKXA 2F8JA 4BA4A 2AATA 2WB6A 2HUUA 3WCOA 1CZCA 3NYUA 4ZASA 1M7YA 2E7UA 3B1EA 2C0RA 2W8JA 1YOOA 2ZC0A 2WKAA 1GC4A 2JJGA 2OQXA 3E2ZA 3IF2A 3NDNA 4L0OA 1LC7A 2VGTA 4EMYA 2FNIA 3WGCA 1QJ3A 2ZUKA 4ADDA 4XK1A 3BWNC 1AAMA 4A0HA 1M0PA 1GC2A 2QMAA 4UHOA 3TCMA 1M0NA 3PJ0A 4CBRA 5G4JA 2VGZA 4ZWMA 4W1VA 1WYTB 4QGRA 2CANA 2PB2A 2BI2A 2FM1A 2VGVA 1D7UA 4ITXA 3HBXA 4OT8A 4JF0A 3QM2A 4EU1A 1GC0A 4JE5A 1BJWA 3B46A 2D5YA 2OKKA 1BJ4A 1QIRA 2W7LA 1IBJA 3JW9A 1ZODA 1MLZA 4FL0A 2FN6A 3M5UA 4J8LA 1WYVA 2VMWA 3ZRPA 3QPGA 4WB0A 1SVVA 3DRDA 2YCPA 4H51A 3ATHA 1D7SA 3FZ7A 3KE3A 1S07A 3NUBA 1AX4A 1V2DA 1WYTA 3GETA 3P1TA 4R8DA 5M4BA 3TFTA 4ISYA 1N8PA 4JEWA 4J5UA 1M4NA 2EZ2A 4BHDA 2CJHA 1DGDA 1AIBA 3MAFA 3DC1A 4BMKA 1PMMA 1X0MA 4NOGA 3FCRA 5E3KA 5EUDA 3A9XA 3VK2A 1ASEA 5HDMA 2Z9WA 1AKAA 3BV0A 3NX3A 4CXRA 3G0TA 1BJNA 3JWBA 5LH9A 3R9AA 2VMYA 1PG8A 3E2ZB 3JZLA 5D95A 4ZDPA 4MGRA 2VMVA 1BQDA 2W7JA 2VI9A 2BI3A 1DFOA 1IAXA 4XEWA 5EIGA 4WLJA 4PVFA 4DBCA 1GEYA 1TOGA 3KGWA 3W1IA 3WX9A 2DR1A 1Z7DA 5J8QA 1KL2A 1U08A 1GCKA 2AY1A 4WYEA 1YIYA 1JS6A 1PFFA 2W8WA 3EUCA 2HUIA 2OATA 3OP7A 4ZLVA 4F4EA 3PDXA 2D7YA 1QITA 1VJOA 2XBNA 3JU7A 3LVJA 2C44A 2W8UA 1G7XA 4TN4A 4W91A 1O61A 4WXBA 1CZEA 2ZP7A 2W7EA 5LHAA 4GSAA 4WYFA 4ADEA 4PFNA 1AIAA 1E5EA 4RKCA 2E54A 2DGLA 3Q8NA 1YNUA 5EFSA 2PO3A 2HOZA 5HHYA 1QISA 3E6GA 4AO9A 4CBSA 1EQBA 1ASNA 4IYOB 4IW7A 5E5IA 2OGAA 2JJEA 3BCAA 4MKJA 4RKDA 3PD6B 3ISLA 1IJIA 1N2TA 4R5FA 3MKJA 5E4ZA 3W1JA 2EGYA 1M0QA 2JJHA 4KYOA 4E1OA 3QBOA 2C7TA 2AY7A 1TASA 2BWPA 3AENB 4JEYA 4MQPA 3ASAA 1AAWA 4F5JA 4Y0HA 1N31A 4PFFA 1DJ9A 4MKKA 2DKJA 1TOKA 1S0AA 3BWNA 3PDBA 2Z61A 2C81A 3HT4A 2AY2A 1IUGA 3EI6A 1S06A 1FG3A 2OKJA 3G7QA 3A2BA 3LVLB 2R0TA 3QHXA 4K2IA 2W7MA 3RBFA 1LW5A 5AX8A 2VMSA 1SZSA 4XJLA 1GEWA 3T32A 3WY7A 2TPLA 3BB8A 3NU8A 2CH1A 3RCHA 1VEFA 3DODA 1RV3A 4FFCA 2CJDA 3LV2A 1LS3A 1GEXA 2VGSA 2VMNA 4F5GA 4PIWA 1RV4A 2GSAA 1S08A 4XQ2A 3FSLA 1B5PA 1WSTA 2VMOA 3GZDA 3VK4A 3FVSA 3DXWA 3AENA 4JE5D 4W5KA 3ACZA 4HVKA 4IY7A 4M2KA 4GE9A 1J04A 1CL1A 3GJUA 1WYVB 3G8MA 4UHNA 4IXSA 2VIAA 1GC3A 2BI1A 2HP2A 1ASAA 1UU1A 2OGEA 2X8UA 3CAIA 1AY5A 4RIZA 2Z9XA 3R4TA 4RAEA 5DJ1A 2O7CA 3ASBA 4GE7A 1KKJA 1C9CA 4U2HA 1TATA 2ZY4A 5G09A 4R5ZA 4A00A 2EYQA 3CBFA 3USFA 4A0RA 2WK7A 5D5SA 2V0YA 3MC6C 4RM1A 3KGXA 2VMXA 3GSBA 4RJ0A 4LNJA 1IAYA 2AY3A 4A0GA 5C6UA 1LKCA 1ORDA 4ZDLA 3NYTA 3N0LA 1DJUA 1WKGA 3GBXA 1WKHA 3AEPA 4AOAA 1AHYA 3K7YA 1GBNA 2GB3A 4EFFA 5FT6A 4ITGA 1MAQA 8AATA 2YOBA 1AMRA 4XAUA 5EIGB 2GQNA 1ELUA 1QZ9A 3GZCA 2YRIA 3GR9A 2BHXA 1XEYA 3BN1A 4N0WA 2AY8A 4OBVA 2EZ1A 1ELQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UOY A;  2HUF A;  4M2J A;  3EZS A;  3D6K A;  2NMP A;  3NUI A;  3AOV A;  3MEB A;  1G4X A;  2W7K A;  3NYS A;  4BQ0 A;  1JG8 A;  3FDD A;  3OKS A;  3AEM C;  2VLH A;  3L8A A;  2CFB A;  2YHK A;  1T3I A;  1EG5 A;  2W7I A;  2BIG A;  3MAF B;  4WYA A;  4ZWV A;  3FQ7 A;  2PB0 A;  4A6U A;  4HF8 A;  1JS3 A;  1MDX A;  1V72 A;  4CVQ A;  5G0A A;  1FG7 A;  3E9K A;  3JTX A;  1I29 A;  2YCT A;  1KMJ A;  1AHF A;  4LNL A;  1AHG A;  3K28 A;  2X3L A;  3I4J A;  2VMT A;  4W1W A;  2R5C B;  2DKB A;  4W1X A;  1B8G A;  5FT5 A;  3EIB A;  5EAV A;  3AV7 A;  5G4I A;  1RVU A;  3WCN A;  1Y4I A;  1B9H A;  1E5F A;  3ZZK A;  3AOW A;  2O1B A;  3BCB A;  2CJG A;  4MQQ A;  2Q7W A;  1AY4 A;  1C7G A;  4I8A A;  3TFU A;  1DTY A;  2YKY A;  1DGE A;  1CJ0 A;  2VGW A;  1DKA A;  5DJ9 A;  4WXF A;  4WYC A;  3MAD A;  3WGB A;  2FNU A;  1IX6 A;  3FKD A;  1J32 A;  4LNM A;  1IX7 A;  3HVY A;  2ZSL A;  3F6T A;  1AHE A;  2D66 A;  1GDE A;  2DGM A;  3E2F A;  4JF1 A;  1I41 A;  2VI8 A;  3DR7 A;  1LC8 A;  5IWQ A;  2HOY A;  4A72 A;  2VGU A;  2W8T A;  3NRA A;  4WLH A;  1DJE A;  2YKV A;  4AZJ A;  2QB3 A;  2Z67 A;  5TF5 A;  1Z3Z A;  1BKG A;  3NNK A;  3A9Y A;  2QLR A;  4TV7 A;  5BJ4 A;  1PMO A;  2Z1Z A;  4MSO A;  2ORD A;  1ASD A;  2D61 A;  3TQX A;  2FQ6 A;  3FD0 A;  1OHV A;  4ZM4 A;  1SPA A;  4GE4 A;  3GWP A;  1ASF A;  2E7I A;  1TOE A;  4ATP A;  3FRK A;  3NU7 A;  2W7D A;  2CTZ A;  2ZY5 A;  4UQV A;  2HOR A;  3A8U X;  3EIA A;  3PD6 A;  2Z1Y A;  5FT4 A;  3WLX A;  4IYO A;  3H14 A;  2VMQ A;  4B98 A;  2QBT A;  2ZY2 A;  1KL1 A;  1UKJ A;  3GZD C;  1ZC9 A;  2E7J A;  2W7G A;  2Z9U A;  4P7Y A;  3COG A;  1B5O A;  1RVY A;  3ZZJ A;  5K8B A;  5M4D A;  4GRX A;  1ARS A;  1OAT A;  2R2N A;  3H7F A;  3DZZ A;  4ATQ A;  2D64 A;  4OYT A;  2W7H A;  1QJ5 A;  2JIS A;  4WP0 A;  2AY6 A;  1JF9 A;  2D65 A;  4GDY A;  4ADC A;  1ARH A;  3N75 A;  1BJO B;  1YAA A;  3FVU A;  1C4K A;  1C7O A;  2CB1 A;  3PA9 A;  4ZAH A;  1ART A;  3B1D A;  1V2E A;  2X5F A;  4JEX A;  4P3M A;  3HDO A;  3B1C A;  4ZSW A;  3MC6 A;  2FYF A;  1SF2 A;  3FFR A;  4F5F A;  3UAK A;  1IX8 A;  1VP4 A;  1ASC A;  2BWO A;  1AKC A;  3LG0 A;  1I43 A;  1G7W A;  2VLF A;  3AEJ A;  3KKI A;  4F5H A;  4WBT A;  3HLM A;  2RFV A;  4DGT A;  1MDO A;  4KXK A;  3BWO A;  1YJY A;  1MGV A;  1C0N A;  1EJI A;  3CQ5 A;  3LWS A;  5EUE A;  4O6Z A;  4E77 A;  5DX5 A;  4Q75 A;  3RI6 A;  2BKW A;  3WKS A;  1ECX A;  4IX8 A;  2BWN A;  1B4X A;  2W8V A;  4Q31 A;  2GMS A;  2AEV A;  5JAY A;  1SZK A;  2BI5 A;  3BCX A;  4IXZ A;  1ARG A;  3AAT A;  4ZSY A;  2YCN A;  1GD9 A;  1D2F A;  3NTJ A;  2D7Z A;  5EQC A;  4OBU A;  1P3W A;  3AEM A;  3BC8 A;  1TAR A;  3EI5 A;  7AAT A;  1BT4 A;  4WB0 B;  1H0C A;  3L44 A;  1CQ7 A;  2JJF A;  1QGN A;  3MBB A;  2Z20 A;  1TPL A;  2BYL A;  3E2Y A;  3ECD A;  3LY1 A;  1KKP A;  3QGU A;  3UWC A;  2ZSM A;  1M32 A;  3BS8 A;  2W7F A;  2JGT A;  1KMK A;  2AY4 A;  3P6K A;  2CIN A;  2VMZ A;  3ZRQ A;  5F9S A;  2BYJ A;  2R5E A;  1C7N A;  1AIC A;  4UHM A;  1LK9 A;  1AMS A;  5BJ3 A;  4MQR A;  1TOI A;  1ARI A;  4XJM A;  4AZK A;  1FC4 A;  1W7L A;  3DR4 A;  3EI7 A;  1W7M A;  2EPJ A;  4LC3 A;  2XH1 A;  3ZRR A;  1AY8 A;  4KAM A;  2G6W A;  1H1C A;  1ASM A;  3K40 A;  5EAA A;  4E3R A;  1AJR A;  5DB5 A;  4JEV A;  1SZU A;  2AY5 A;  3FQA A;  3FQ8 A;  1LW4 A;  4OC9 A;  5M46 A;  3W1H A;  4R2N A;  2VIB A;  3QN6 A;  4RJY A;  4W8I A;  3CQ4 A;  2VMR A;  9AAT A;  1M6S A;  4OTL A;  5HXX A;  1B9I A;  1BJO A;  1OHY A;  4CXQ A;  4WYG A;  1CS1 A;  3F0H A;  2V1P A;  3LVM A;  1BS0 A;  2QB2 A;  1WYU A;  4EB5 A;  1V2F A;  3RQ1 A;  4AO4 A;  2HP1 A;  4Y0I A;  3VK3 A;  4JEZ A;  4E3Q A;  1G4V A;  1W23 A;  4Q76 A;  4A0F A;  1BQA A;  2HOX A;  4AH3 A;  3QI6 A;  4F5M A;  1OXP A;  2EH6 A;  3A9Z A;  1OXO A;  3DYD A;  3FDB A;  3RBL A;  4B9B A;  4ZM3 A;  1ZOB A;  2AEU A;  2BIE A;  3F9T A;  3FZ8 A;  1BW0 A;  2X5D A;  2ZJG A;  4U1T A;  2QA3 A;  5G2Q A;  2ZYJ A;  3CQ6 A;  2WK9 A;  1AJS A;  5EUN A;  1O62 A;  2DGK A;  2VMP A;  2HZP A;  3B8X A;  3LVK A;  3MAU A;  4LW2 A;  4F5K A;  1O4S A;  3IHJ A;  4TMR A;  5G2P A;  4F5L A;  4ZDO A;  2YRR A;  2VMU A;  1D7V A;  4EB7 A;  4MY5 A;  2EO5 A;  4Y0D A;  4ADB A;  1YJS A;  3PPL A;  2YKU A;  3FZ6 A;  1OHW A;  4RIT A;  3RCH B;  4OMA A;  4F5I A;  1ASG A;  1AMQ A;  1ASB A;  2GMU A;  3VP6 A;  1AHX A;  3II0 A;  3HMU A;  4DQ6 A;  4XJO A;  1LC5 A;  3I5T A;  1D7R A;  1IVR A;  3HL2 A;  2ZY3 A;  3VAX A;  3FTB A;  2Z9V A;  1UU2 A;  3PIU A;  2WK8 A;  4BA5 A;  1X29 A;  4K2B A;  4IXO A;  3EZ1 A;  2CST A;  4OCA A;  4RLG A;  5FT8 A;  1X2A A;  3PDB B;  1XI9 A;  4LW4 A;  3AEO A;  4M2M A;  3ELE A;  3JWA A;  2BIA A;  4K2M A;  4A6R A;  1X28 A;  1MDZ A;  3PGY A;  2DOU A;  4N0B A;  1W3U A;  1I48 A;  2BI9 A;  4WD2 A;  3AEJ C;  3EI8 A;  1M0O A;  3WZF A;  1CL2 A;  3ELP A;  1TOJ A;  1AJS B;  3N5M A;  2D63 A;  4Q6R A;  2R5C A;  1CQ8 A;  1ASL A;  1UU0 A;  4A6T A;  4XJP A;  3FFH A;  1MLY A;  2CY8 A;  1AKB A;  5I92 A;  5F8V A;  2O0R A;  3RUY A;  1W7N A;  3E77 A;  4WYD A;  1SFF A;  3WKR A;  5M49 A;  1YIZ A;  1CQ6 A;  4WXG A;  1AMA A;  3VOM A;  3PAA A;  2VYC A;  3FVX A;  3DXV A;  3DU4 A;  3HQT A;  4GEB A;  1WYU B;  1MAP A;  1YJZ A;  2JG2 A;  2CH2 A;  3AEL A;  3EI9 A;  1O69 A;  2AY9 A;  3UE8 A;  1S09 A;  3I16 A;  3TAT A;  2YKX A;  2F8J A;  4BA4 A;  2AAT A;  2HUU A;  3WCO A;  1CZC A;  3NYU A;  4ZAS A;  1M7Y A;  2E7U A;  3B1E A;  2C0R A;  2W8J A;  1YOO A;  2ZC0 A;  2WKA A;  1GC4 A;  2JJG A;  2OQX A;  3E2Z A;  3IF2 A;  3NDN A;  4L0O A;  1LC7 A;  2VGT A;  4EMY A;  2FNI A;  3WGC A;  1QJ3 A;  2ZUK A;  4ADD A;  4XK1 A;  3BWN C;  1AAM A;  4A0H A;  1M0P A;  1GC2 A;  2QMA A;  4UHO A;  3TCM A;  1M0N A;  3PJ0 A;  4CBR A;  5G4J A;  2VGZ A;  4ZWM A;  4W1V A;  1WYT B;  4QGR A;  2CAN A;  2PB2 A;  2BI2 A;  2FM1 A;  2VGV A;  1D7U A;  4ITX A;  3HBX A;  4OT8 A;  4JF0 A;  3QM2 A;  4EU1 A;  1GC0 A;  4JE5 A;  1BJW A;  3B46 A;  2D5Y A;  2OKK A;  1BJ4 A;  1QIR A;  2W7L A;  1IBJ A;  3JW9 A;  1ZOD A;  1MLZ A;  4FL0 A;  2FN6 A;  3M5U A;  4J8L A;  1WYV A;  2VMW A;  3ZRP A;  3QPG A;  4WB0 A;  1SVV A;  3DRD A;  2YCP A;  4H51 A;  3ATH A;  1D7S A;  3FZ7 A;  3KE3 A;  1S07 A;  3NUB A;  1AX4 A;  1V2D A;  1WYT A;  3GET A;  3P1T A;  4R8D A;  5M4B A;  3TFT A;  4ISY A;  1N8P A;  4JEW A;  4J5U A;  1M4N A;  2EZ2 A;  4BHD A;  2CJH A;  1DGD A;  1AIB A;  3MAF A;  3DC1 A;  4BMK A;  1PMM A;  1X0M A;  4NOG A;  3FCR A;  5E3K A;  5EUD A;  3A9X A;  3VK2 A;  1ASE A;  5HDM A;  2Z9W A;  1AKA A;  3BV0 A;  3NX3 A;  4CXR A;  3G0T A;  1BJN A;  3JWB A;  5LH9 A;  3R9A A;  2VMY A;  1PG8 A;  3E2Z B;  3JZL A;  5D95 A;  4ZDP A;  4MGR A;  2VMV A;  1BQD A;  2W7J A;  2VI9 A;  2BI3 A;  1DFO A;  1IAX A;  4XEW A;  5EIG A;  4WLJ A;  4PVF A;  4DBC A;  1GEY A;  1TOG A;  3KGW A;  3W1I A;  3WX9 A;  2DR1 A;  1Z7D A;  5J8Q A;  1KL2 A;  1U08 A;  1GCK A;  2AY1 A;  4WYE A;  1YIY A;  1JS6 A;  1PFF A;  2W8W A;  3EUC A;  2HUI A;  2OAT A;  3OP7 A;  4ZLV A;  4F4E A;  3PDX A;  2D7Y A;  1QIT A;  1VJO A;  2XBN A;  3JU7 A;  3LVJ A;  2C44 A;  2W8U A;  1G7X A;  4TN4 A;  4W91 A;  1O61 A;  4WXB A;  1CZE A;  2ZP7 A;  2W7E A;  5LHA A;  4GSA A;  4WYF A;  4ADE A;  4PFN A;  1AIA A;  1E5E A;  4RKC A;  2E54 A;  2DGL A;  3Q8N A;  1YNU A;  5EFS A;  2PO3 A;  2HOZ A;  5HHY A;  1QIS A;  3E6G A;  4AO9 A;  4CBS A;  1EQB A;  1ASN A;  4IYO B;  4IW7 A;  5E5I A;  2OGA A;  2JJE A;  3BCA A;  4MKJ A;  4RKD A;  3PD6 B;  3ISL A;  1IJI A;  1N2T A;  4R5F A;  3MKJ A;  5E4Z A;  3W1J A;  2EGY A;  1M0Q A;  2JJH A;  4KYO A;  4E1O A;  3QBO A;  2C7T A;  2AY7 A;  1TAS A;  2BWP A;  3AEN B;  4JEY A;  4MQP A;  3ASA A;  1AAW A;  4F5J A;  4Y0H A;  1N31 A;  4PFF A;  1DJ9 A;  4MKK A;  2DKJ A;  1TOK A;  1S0A A;  3BWN A;  3PDB A;  2Z61 A;  2C81 A;  3HT4 A;  2AY2 A;  1IUG A;  3EI6 A;  1S06 A;  1FG3 A;  2OKJ A;  3G7Q A;  3A2B A;  3LVL B;  2R0T A;  3QHX A;  4K2I A;  2W7M A;  3RBF A;  1LW5 A;  5AX8 A;  2VMS A;  1SZS A;  4XJL A;  1GEW A;  3T32 A;  3WY7 A;  2TPL A;  3BB8 A;  3NU8 A;  2CH1 A;  3RCH A;  1VEF A;  3DOD A;  1RV3 A;  4FFC A;  2CJD A;  3LV2 A;  1LS3 A;  1GEX A;  2VGS A;  2VMN A;  4F5G A;  4PIW A;  1RV4 A;  2GSA A;  1S08 A;  4XQ2 A;  3FSL A;  1B5P A;  1WST A;  2VMO A;  3GZD A;  3VK4 A;  3FVS A;  3DXW A;  3AEN A;  4JE5 D;  4W5K A;  3ACZ A;  4HVK A;  4IY7 A;  4M2K A;  4GE9 A;  1J04 A;  1CL1 A;  3GJU A;  1WYV B;  3G8M A;  4UHN A;  4IXS A;  2VIA A;  1GC3 A;  2BI1 A;  2HP2 A;  1ASA A;  1UU1 A;  2OGE A;  2X8U A;  3CAI A;  1AY5 A;  4RIZ A;  2Z9X A;  3R4T A;  4RAE A;  5DJ1 A;  2O7C A;  3ASB A;  4GE7 A;  1KKJ A;  1C9C A;  4U2H A;  1TAT A;  2ZY4 A;  5G09 A;  4R5Z A;  4A00 A;  3CBF A;  3USF A;  4A0R A;  2WK7 A;  5D5S A;  2V0Y A;  3MC6 C;  4RM1 A;  3KGX A;  2VMX A;  3GSB A;  4RJ0 A;  4LNJ A;  1IAY A;  2AY3 A;  4A0G A;  5C6U A;  1LKC A;  1ORD A;  4ZDL A;  3NYT A;  3N0L A;  1DJU A;  1WKG A;  3GBX A;  1WKH A;  3AEP A;  4AOA A;  1AHY A;  3K7Y A;  1GBN A;  2GB3 A;  4EFF A;  5FT6 A;  4ITG A;  1MAQ A;  8AAT A;  2YOB A;  1AMR A;  4XAU A;  5EIG B;  2GQN A;  1ELU A;  1QZ9 A;  3GZC A;  2YRI A;  3GR9 A;  2BHX A;  1XEY A;  3BN1 A;  4N0W A;  2AY8 A;  4OBV A;  2EZ1 A;  1ELQ A; 
#chains in the Genus database with same CATH topology
 4UOY A;  2HUF A;  4M2J A;  3EZS A;  3D6K A;  2NMP A;  3NUI A;  3AOV A;  3MEB A;  1G4X A;  2W7K A;  3NYS A;  4BQ0 A;  1JG8 A;  2A1V A;  3FDD A;  3OKS A;  3AEM C;  5KTB A;  2VLH A;  3L8A A;  2CFB A;  2YHK A;  1T3I A;  1EG5 A;  2W7I A;  2BIG A;  3MAF B;  4WYA A;  4ZWV A;  3FQ7 A;  2PB0 A;  4A6U A;  3N4R A;  4HF8 A;  1JS3 A;  1MDX A;  1V72 A;  4CVQ A;  5G0A A;  1FG7 A;  3E9K A;  3JTX A;  1I29 A;  2YCT A;  1KMJ A;  1AHF A;  4LNL A;  1AHG A;  3K28 A;  2X3L A;  3I4J A;  2VMT A;  4W1W A;  2R5C B;  2DKB A;  4W1X A;  1B8G A;  5FT5 A;  3EIB A;  5EAV A;  3AV7 A;  5G4I A;  1RVU A;  3WCN A;  1Y4I A;  1B9H A;  1E5F A;  3ZZK A;  3AOW A;  2O1B A;  3BCB A;  2CJG A;  4MQQ A;  2Q7W A;  1AY4 A;  1C7G A;  4I8A A;  3TFU A;  1DTY A;  2YKY A;  1DGE A;  1CJ0 A;  2VGW A;  1DKA A;  5DJ9 A;  4WXF A;  4WYC A;  3MAD A;  3WGB A;  2FNU A;  1IX6 A;  3FKD A;  1J32 A;  4LNM A;  1IX7 A;  3HVY A;  2ZSL A;  3F6T A;  1AHE A;  2D66 A;  1GDE A;  2DGM A;  3E2F A;  4JF1 A;  1I41 A;  2VI8 A;  3DR7 A;  1LC8 A;  5IWQ A;  2HOY A;  4A72 A;  2VGU A;  2W8T A;  3NRA A;  4WLH A;  1DJE A;  2YKV A;  4AZJ A;  2G7J A;  2QB3 A;  2Z67 A;  5TF5 A;  1Z3Z A;  1BKG A;  3NNK A;  3A9Y A;  2QLR A;  4TV7 A;  5BJ4 A;  1PMO A;  2Z1Z A;  4MSO A;  2ORD A;  1ASD A;  2D61 A;  3TQX A;  2FQ6 A;  3FD0 A;  1OHV A;  4ZM4 A;  1SPA A;  4GE4 A;  3GWP A;  1ASF A;  2E7I A;  1TOE A;  4ATP A;  3FRK A;  3NU7 A;  2W7D A;  2CTZ A;  2ZY5 A;  4UQV A;  2HOR A;  3A8U X;  3EIA A;  3PD6 A;  2Z1Y A;  5FT4 A;  3WLX A;  4IYO A;  3H14 A;  2VMQ A;  4B98 A;  2QBT A;  2ZY2 A;  1KL1 A;  1UKJ A;  3GZD C;  1ZC9 A;  2E7J A;  2W7G A;  2Z9U A;  4P7Y A;  3COG A;  1B5O A;  1RVY A;  3ZZJ A;  5K8B A;  5M4D A;  4GRX A;  1ARS A;  1OAT A;  2R2N A;  3H7F A;  3DZZ A;  4ATQ A;  2D64 A;  4OYT A;  2W7H A;  1QJ5 A;  2JIS A;  4WP0 A;  2AY6 A;  1JF9 A;  2D65 A;  4GDY A;  4ADC A;  1ARH A;  3N75 A;  1BJO B;  1YAA A;  3FVU A;  1C4K A;  1C7O A;  2CB1 A;  3PA9 A;  4ZAH A;  1ART A;  4H63 Q;  3B1D A;  1V2E A;  2X5F A;  4JEX A;  4P3M A;  3HDO A;  3B1C A;  4ZSW A;  3MC6 A;  2FYF A;  1SF2 A;  3FFR A;  4F5F A;  3UAK A;  1IX8 A;  1VP4 A;  1ASC A;  2BWO A;  1AKC A;  3LG0 A;  1I43 A;  1G7W A;  2VLF A;  3AEJ A;  3KKI A;  3N7N A;  4F5H A;  4WBT A;  3HLM A;  2RFV A;  4DGT A;  1MDO A;  4KXK A;  3BWO A;  1YJY A;  1MGV A;  1C0N A;  1EJI A;  3CQ5 A;  3LWS A;  5EUE A;  4O6Z A;  4E77 A;  3H9X A;  5DX5 A;  4Q75 A;  3RI6 A;  2BKW A;  3WKS A;  1ECX A;  4IX8 A;  2BWN A;  1B4X A;  2W8V A;  4Q31 A;  2GMS A;  2AEV A;  5JAY A;  1SZK A;  2BI5 A;  3BCX A;  4IXZ A;  1ARG A;  3AAT A;  4ZSY A;  2YCN A;  1GD9 A;  1D2F A;  3NTJ A;  2D7Z A;  5EQC A;  4OBU A;  1P3W A;  3AEM A;  3BC8 A;  1TAR A;  3EI5 A;  7AAT A;  1BT4 A;  4WB0 B;  1H0C A;  3L44 A;  1CQ7 A;  2JJF A;  1QGN A;  3MBB A;  2Z20 A;  1TPL A;  2BYL A;  3E2Y A;  3ECD A;  3LY1 A;  1KKP A;  3QGU A;  3UWC A;  2ZSM A;  1M32 A;  3BS8 A;  2W7F A;  2JGT A;  1KMK A;  2AY4 A;  3P6K A;  2CIN A;  2VMZ A;  3ZRQ A;  5F9S A;  2BYJ A;  2R5E A;  1C7N A;  1AIC A;  4UHM A;  1LK9 A;  1AMS A;  5BJ3 A;  4MQR A;  1TOI A;  1ARI A;  4XJM A;  4AZK A;  1FC4 A;  1W7L A;  3DR4 A;  3EI7 A;  1W7M A;  2EPJ A;  4LC3 A;  2XH1 A;  3ZRR A;  2QSR A;  1AY8 A;  4KAM A;  2G6W A;  1H1C A;  1ASM A;  2KFP A;  3K40 A;  5EAA A;  4E3R A;  1AJR A;  5DB5 A;  4JEV A;  1SZU A;  2AY5 A;  3FQA A;  3FQ8 A;  1LW4 A;  4OC9 A;  5M46 A;  3W1H A;  4R2N A;  2VIB A;  3QN6 A;  4RJY A;  4W8I A;  3CQ4 A;  2VMR A;  9AAT A;  1M6S A;  4OTL A;  5HXX A;  1B9I A;  1BJO A;  1OHY A;  4CXQ A;  4WYG A;  1CS1 A;  3F0H A;  2V1P A;  3LVM A;  1BS0 A;  2QB2 A;  1WYU A;  4EB5 A;  1V2F A;  3RQ1 A;  4AO4 A;  2HP1 A;  4Y0I A;  3VK3 A;  4JEZ A;  4E3Q A;  1G4V A;  1W23 A;  4Q76 A;  4A0F A;  1BQA A;  2HOX A;  4AH3 A;  3QI6 A;  4F5M A;  1OXP A;  2EH6 A;  3A9Z A;  1OXO A;  3DYD A;  3FDB A;  3RBL A;  4B9B A;  4ZM3 A;  1ZOB A;  2AEU A;  2BIE A;  3F9T A;  3FZ8 A;  1BW0 A;  2X5D A;  2ZJG A;  4U1T A;  2QA3 A;  5G2Q A;  2ZYJ A;  3CQ6 A;  2WK9 A;  1AJS A;  5EUN A;  1O62 A;  2DGK A;  2VMP A;  2HZP A;  3B8X A;  3LVK A;  3MAU A;  4LW2 A;  4F5K A;  1O4S A;  3IHJ A;  4TMR A;  5G2P A;  4F5L A;  4ZDO A;  2YRR A;  2VMU A;  1D7V A;  4EB7 A;  4MY5 A;  2EO5 A;  4Y0D A;  4ADB A;  1YJS A;  3PPL A;  2YKU A;  3FZ6 A;  1OHW A;  4RIT A;  3RCH B;  4OMA A;  4F5I A;  1ASG A;  1AMQ A;  1ASB A;  2GMU A;  3VP6 A;  1AHX A;  3II0 A;  3HMU A;  4DQ6 A;  4XJO A;  1LC5 A;  3I5T A;  1D7R A;  1IVR A;  3HL2 A;  2ZY3 A;  3VAX A;  3FTB A;  2Z9V A;  1UU2 A;  3PIU A;  2WK8 A;  4BA5 A;  1X29 A;  4K2B A;  4IXO A;  3EZ1 A;  2CST A;  4OCA A;  4RLG A;  5FT8 A;  1X2A A;  3PDB B;  1XI9 A;  4LW4 A;  3AEO A;  4M2M A;  3ELE A;  3JWA A;  2BIA A;  4K2M A;  4A6R A;  3N4S A;  1X28 A;  1MDZ A;  3PGY A;  2DOU A;  4N0B A;  1W3U A;  1I48 A;  2BI9 A;  4WD2 A;  3AEJ C;  3EI8 A;  1M0O A;  3WZF A;  1CL2 A;  3ELP A;  1TOJ A;  1AJS B;  3N5M A;  2D63 A;  4Q6R A;  2R5C A;  1CQ8 A;  1ASL A;  1UU0 A;  4A6T A;  4XJP A;  3FFH A;  1MLY A;  2CY8 A;  1AKB A;  5I92 A;  5F8V A;  2O0R A;  3RUY A;  1W7N A;  3E77 A;  4WYD A;  1SFF A;  3WKR A;  5M49 A;  1YIZ A;  1CQ6 A;  4WXG A;  1AMA A;  3VOM A;  3PAA A;  2VYC A;  3FVX A;  4K05 A;  3DXV A;  3DU4 A;  3HQT A;  3N4X A;  4GEB A;  1WYU B;  1MAP A;  1YJZ A;  2JG2 A;  2CH2 A;  3AEL A;  3EI9 A;  1O69 A;  2AY9 A;  3UE8 A;  1S09 A;  3I16 A;  3TAT A;  2FKI A;  2YKX A;  2F8J A;  4BA4 A;  2AAT A;  2WB6 A;  2HUU A;  3WCO A;  1CZC A;  3NYU A;  4ZAS A;  1M7Y A;  2E7U A;  3B1E A;  2C0R A;  2W8J A;  1YOO A;  2ZC0 A;  2WKA A;  1GC4 A;  2JJG A;  2OQX A;  3E2Z A;  3IF2 A;  3NDN A;  4L0O A;  1LC7 A;  2VGT A;  4EMY A;  2FNI A;  3WGC A;  1QJ3 A;  2ZUK A;  4ADD A;  4XK1 A;  3BWN C;  1AAM A;  4A0H A;  1M0P A;  1GC2 A;  2QMA A;  4UHO A;  3TCM A;  1M0N A;  3PJ0 A;  4CBR A;  5G4J A;  2VGZ A;  4ZWM A;  4W1V A;  1WYT B;  4QGR A;  2CAN A;  2PB2 A;  2BI2 A;  2FM1 A;  2VGV A;  1D7U A;  4ITX A;  3HBX A;  4OT8 A;  4JF0 A;  3QM2 A;  4EU1 A;  1GC0 A;  4JE5 A;  1BJW A;  3B46 A;  2D5Y A;  2OKK A;  1BJ4 A;  1QIR A;  2W7L A;  1IBJ A;  3JW9 A;  1ZOD A;  1MLZ A;  4FL0 A;  2FN6 A;  3M5U A;  4J8L A;  1WYV A;  2VMW A;  3ZRP A;  3QPG A;  4WB0 A;  1SVV A;  3DRD A;  2YCP A;  4H51 A;  3ATH A;  1D7S A;  3FZ7 A;  3KE3 A;  1S07 A;  3NUB A;  1AX4 A;  1V2D A;  1WYT A;  3GET A;  3P1T A;  4R8D A;  5M4B A;  3TFT A;  4ISY A;  1N8P A;  4JEW A;  4J5U A;  1M4N A;  2EZ2 A;  4BHD A;  2CJH A;  1DGD A;  1AIB A;  3MAF A;  3DC1 A;  4BMK A;  1PMM A;  1X0M A;  4NOG A;  3FCR A;  5E3K A;  5EUD A;  3A9X A;  3VK2 A;  1ASE A;  5HDM A;  2Z9W A;  1AKA A;  3BV0 A;  3NX3 A;  4CXR A;  3G0T A;  1BJN A;  3JWB A;  5LH9 A;  3R9A A;  2VMY A;  1PG8 A;  3E2Z B;  3JZL A;  5D95 A;  4ZDP A;  4MGR A;  2VMV A;  1BQD A;  2W7J A;  2VI9 A;  2BI3 A;  1DFO A;  1IAX A;  4XEW A;  5EIG A;  4WLJ A;  4PVF A;  4DBC A;  1GEY A;  1TOG A;  3KGW A;  3W1I A;  3WX9 A;  2DR1 A;  1Z7D A;  5J8Q A;  1KL2 A;  1U08 A;  1GCK A;  2AY1 A;  4WYE A;  1YIY A;  1JS6 A;  1PFF A;  2W8W A;  3EUC A;  2HUI A;  2OAT A;  3OP7 A;  4ZLV A;  4F4E A;  3PDX A;  2D7Y A;  1QIT A;  1VJO A;  2XBN A;  3JU7 A;  3LVJ A;  2C44 A;  2W8U A;  1G7X A;  4TN4 A;  4W91 A;  1O61 A;  4WXB A;  1CZE A;  2ZP7 A;  2W7E A;  5LHA A;  4GSA A;  4WYF A;  4ADE A;  4PFN A;  1AIA A;  1E5E A;  4RKC A;  2E54 A;  2DGL A;  3Q8N A;  1YNU A;  5EFS A;  2PO3 A;  2HOZ A;  5HHY A;  1QIS A;  3E6G A;  4AO9 A;  4CBS A;  1EQB A;  1ASN A;  4IYO B;  1KAF A;  4IW7 A;  5E5I A;  2OGA A;  2JJE A;  3BCA A;  4MKJ A;  4RKD A;  3PD6 B;  3ISL A;  1IJI A;  1N2T A;  4R5F A;  3MKJ A;  5E4Z A;  3W1J A;  2EGY A;  1M0Q A;  2JJH A;  4KYO A;  4E1O A;  3QBO A;  2C7T A;  2AY7 A;  1TAS A;  2BWP A;  3AEN B;  4JEY A;  4MQP A;  3ASA A;  1AAW A;  4F5J A;  4Y0H A;  1N31 A;  4PFF A;  1DJ9 A;  4MKK A;  2DKJ A;  1TOK A;  1S0A A;  3BWN A;  3PDB A;  2Z61 A;  2C81 A;  3HT4 A;  2AY2 A;  1IUG A;  3EI6 A;  1S06 A;  1FG3 A;  2OKJ A;  3G7Q A;  3A2B A;  3LVL B;  2R0T A;  3QHX A;  4K2I A;  2W7M A;  3RBF A;  1LW5 A;  5AX8 A;  2VMS A;  1SZS A;  4XJL A;  1GEW A;  3T32 A;  3WY7 A;  2TPL A;  3BB8 A;  3NU8 A;  2CH1 A;  3RCH A;  1VEF A;  3DOD A;  1RV3 A;  4FFC A;  2CJD A;  3LV2 A;  1LS3 A;  1GEX A;  2VGS A;  2VMN A;  4F5G A;  4PIW A;  1RV4 A;  2GSA A;  1S08 A;  4XQ2 A;  3FSL A;  1B5P A;  1WST A;  2VMO A;  3GZD A;  3VK4 A;  3FVS A;  3DXW A;  3AEN A;  4JE5 D;  4W5K A;  3ACZ A;  4HVK A;  4IY7 A;  4M2K A;  4GE9 A;  1J04 A;  1CL1 A;  3GJU A;  1WYV B;  3G8M A;  4UHN A;  4IXS A;  2VIA A;  1GC3 A;  2BI1 A;  2HP2 A;  1ASA A;  1UU1 A;  2OGE A;  2X8U A;  3CAI A;  1AY5 A;  4RIZ A;  2Z9X A;  3R4T A;  4RAE A;  5DJ1 A;  2O7C A;  3ASB A;  4GE7 A;  1KKJ A;  1C9C A;  4U2H A;  1TAT A;  2ZY4 A;  5G09 A;  4R5Z A;  4A00 A;  2EYQ A;  3CBF A;  3USF A;  4A0R A;  2WK7 A;  5D5S A;  2V0Y A;  3MC6 C;  4RM1 A;  3KGX A;  2VMX A;  3GSB A;  4RJ0 A;  4LNJ A;  1IAY A;  2AY3 A;  4A0G A;  5C6U A;  1LKC A;  1ORD A;  4ZDL A;  3NYT A;  3N0L A;  1DJU A;  1WKG A;  3GBX A;  1WKH A;  3AEP A;  4AOA A;  1AHY A;  3K7Y A;  1GBN A;  2GB3 A;  4EFF A;  5FT6 A;  4ITG A;  1MAQ A;  8AAT A;  2YOB A;  1AMR A;  4XAU A;  5EIG B;  2GQN A;  1ELU A;  1QZ9 A;  3GZC A;  2YRI A;  3GR9 A;  2BHX A;  1XEY A;  3BN1 A;  4N0W A;  2AY8 A;  4OBV A;  2EZ1 A;  1ELQ A; 
#chains in the Genus database with same CATH homology
 4UOY A;  2HUF A;  4M2J A;  3EZS A;  3D6K A;  2NMP A;  3NUI A;  3AOV A;  3MEB A;  1G4X A;  2W7K A;  3NYS A;  4BQ0 A;  1JG8 A;  2A1V A;  3FDD A;  3OKS A;  3AEM C;  5KTB A;  2VLH A;  3L8A A;  2CFB A;  2YHK A;  1T3I A;  1EG5 A;  2W7I A;  2BIG A;  3MAF B;  4WYA A;  4ZWV A;  3FQ7 A;  2PB0 A;  4A6U A;  3N4R A;  4HF8 A;  1JS3 A;  1MDX A;  1V72 A;  4CVQ A;  5G0A A;  1FG7 A;  3E9K A;  3JTX A;  1I29 A;  2YCT A;  1KMJ A;  1AHF A;  4LNL A;  1AHG A;  3K28 A;  2X3L A;  3I4J A;  2VMT A;  4W1W A;  2R5C B;  2DKB A;  4W1X A;  1B8G A;  5FT5 A;  3EIB A;  5EAV A;  3AV7 A;  5G4I A;  1RVU A;  3WCN A;  1Y4I A;  1B9H A;  1E5F A;  3ZZK A;  3AOW A;  2O1B A;  3BCB A;  2CJG A;  4MQQ A;  2Q7W A;  1AY4 A;  1C7G A;  4I8A A;  3TFU A;  1DTY A;  2YKY A;  1DGE A;  1CJ0 A;  2VGW A;  1DKA A;  5DJ9 A;  4WXF A;  4WYC A;  3MAD A;  3WGB A;  2FNU A;  1IX6 A;  3FKD A;  1J32 A;  4LNM A;  1IX7 A;  3HVY A;  2ZSL A;  3F6T A;  1AHE A;  2D66 A;  1GDE A;  2DGM A;  3E2F A;  4JF1 A;  1I41 A;  2VI8 A;  3DR7 A;  1LC8 A;  5IWQ A;  2HOY A;  4A72 A;  2VGU A;  2W8T A;  3NRA A;  4WLH A;  1DJE A;  2YKV A;  4AZJ A;  2G7J A;  2QB3 A;  2Z67 A;  5TF5 A;  1Z3Z A;  1BKG A;  3NNK A;  3A9Y A;  2QLR A;  4TV7 A;  5BJ4 A;  1PMO A;  2Z1Z A;  4MSO A;  2ORD A;  1ASD A;  2D61 A;  3TQX A;  2FQ6 A;  3FD0 A;  1OHV A;  4ZM4 A;  1SPA A;  4GE4 A;  3GWP A;  1ASF A;  2E7I A;  1TOE A;  4ATP A;  3FRK A;  3NU7 A;  2W7D A;  2CTZ A;  2ZY5 A;  4UQV A;  2HOR A;  3A8U X;  3EIA A;  3PD6 A;  2Z1Y A;  5FT4 A;  3WLX A;  4IYO A;  3H14 A;  2VMQ A;  4B98 A;  2QBT A;  2ZY2 A;  1KL1 A;  1UKJ A;  3GZD C;  1ZC9 A;  2E7J A;  2W7G A;  2Z9U A;  4P7Y A;  3COG A;  1B5O A;  1RVY A;  3ZZJ A;  5K8B A;  5M4D A;  4GRX A;  1ARS A;  1OAT A;  2R2N A;  3H7F A;  3DZZ A;  4ATQ A;  2D64 A;  4OYT A;  2W7H A;  1QJ5 A;  2JIS A;  4WP0 A;  2AY6 A;  1JF9 A;  2D65 A;  4GDY A;  4ADC A;  1ARH A;  3N75 A;  1BJO B;  1YAA A;  3FVU A;  1C4K A;  1C7O A;  2CB1 A;  3PA9 A;  4ZAH A;  1ART A;  4H63 Q;  3B1D A;  1V2E A;  2X5F A;  4JEX A;  4P3M A;  3HDO A;  3B1C A;  4ZSW A;  3MC6 A;  2FYF A;  1SF2 A;  3FFR A;  4F5F A;  3UAK A;  1IX8 A;  1VP4 A;  1ASC A;  2BWO A;  1AKC A;  3LG0 A;  1I43 A;  1G7W A;  2VLF A;  3AEJ A;  3KKI A;  3N7N A;  4F5H A;  4WBT A;  3HLM A;  2RFV A;  4DGT A;  1MDO A;  4KXK A;  3BWO A;  1YJY A;  1MGV A;  1C0N A;  1EJI A;  3CQ5 A;  3LWS A;  5EUE A;  4O6Z A;  4E77 A;  3H9X A;  5DX5 A;  4Q75 A;  3RI6 A;  2BKW A;  3WKS A;  1ECX A;  4IX8 A;  2BWN A;  1B4X A;  2W8V A;  4Q31 A;  2GMS A;  2AEV A;  5JAY A;  1SZK A;  2BI5 A;  3BCX A;  4IXZ A;  1ARG A;  3AAT A;  4ZSY A;  2YCN A;  1GD9 A;  1D2F A;  3NTJ A;  2D7Z A;  5EQC A;  4OBU A;  1P3W A;  3AEM A;  3BC8 A;  1TAR A;  3EI5 A;  7AAT A;  1BT4 A;  4WB0 B;  1H0C A;  3L44 A;  1CQ7 A;  2JJF A;  1QGN A;  3MBB A;  2Z20 A;  1TPL A;  2BYL A;  3E2Y A;  3ECD A;  3LY1 A;  1KKP A;  3QGU A;  3UWC A;  2ZSM A;  1M32 A;  3BS8 A;  2W7F A;  2JGT A;  1KMK A;  2AY4 A;  3P6K A;  2CIN A;  2VMZ A;  3ZRQ A;  5F9S A;  2BYJ A;  2R5E A;  1C7N A;  1AIC A;  4UHM A;  1LK9 A;  1AMS A;  5BJ3 A;  4MQR A;  1TOI A;  1ARI A;  4XJM A;  4AZK A;  1FC4 A;  1W7L A;  3DR4 A;  3EI7 A;  1W7M A;  2EPJ A;  4LC3 A;  2XH1 A;  3ZRR A;  2QSR A;  1AY8 A;  4KAM A;  2G6W A;  1H1C A;  1ASM A;  2KFP A;  3K40 A;  5EAA A;  4E3R A;  1AJR A;  5DB5 A;  4JEV A;  1SZU A;  2AY5 A;  3FQA A;  3FQ8 A;  1LW4 A;  4OC9 A;  5M46 A;  3W1H A;  4R2N A;  2VIB A;  3QN6 A;  4RJY A;  4W8I A;  3CQ4 A;  2VMR A;  9AAT A;  1M6S A;  4OTL A;  5HXX A;  1B9I A;  1BJO A;  1OHY A;  4CXQ A;  4WYG A;  1CS1 A;  3F0H A;  2V1P A;  3LVM A;  1BS0 A;  2QB2 A;  1WYU A;  4EB5 A;  1V2F A;  3RQ1 A;  4AO4 A;  2HP1 A;  4Y0I A;  3VK3 A;  4JEZ A;  4E3Q A;  1G4V A;  1W23 A;  4Q76 A;  4A0F A;  1BQA A;  2HOX A;  4AH3 A;  3QI6 A;  4F5M A;  1OXP A;  2EH6 A;  3A9Z A;  1OXO A;  3DYD A;  3FDB A;  3RBL A;  4B9B A;  4ZM3 A;  1ZOB A;  2AEU A;  2BIE A;  3F9T A;  3FZ8 A;  1BW0 A;  2X5D A;  2ZJG A;  4U1T A;  2QA3 A;  5G2Q A;  2ZYJ A;  3CQ6 A;  2WK9 A;  1AJS A;  5EUN A;  1O62 A;  2DGK A;  2VMP A;  2HZP A;  3B8X A;  3LVK A;  3MAU A;  4LW2 A;  4F5K A;  1O4S A;  3IHJ A;  4TMR A;  5G2P A;  4F5L A;  4ZDO A;  2YRR A;  2VMU A;  1D7V A;  4EB7 A;  4MY5 A;  2EO5 A;  4Y0D A;  4ADB A;  1YJS A;  3PPL A;  2YKU A;  3FZ6 A;  1OHW A;  4RIT A;  3RCH B;  4OMA A;  4F5I A;  1ASG A;  1AMQ A;  1ASB A;  2GMU A;  3VP6 A;  1AHX A;  3II0 A;  3HMU A;  4DQ6 A;  4XJO A;  1LC5 A;  3I5T A;  1D7R A;  1IVR A;  3HL2 A;  2ZY3 A;  3VAX A;  3FTB A;  2Z9V A;  1UU2 A;  3PIU A;  2WK8 A;  4BA5 A;  1X29 A;  4K2B A;  4IXO A;  3EZ1 A;  2CST A;  4OCA A;  4RLG A;  5FT8 A;  1X2A A;  3PDB B;  1XI9 A;  4LW4 A;  3AEO A;  4M2M A;  3ELE A;  3JWA A;  2BIA A;  4K2M A;  4A6R A;  3N4S A;  1X28 A;  1MDZ A;  3PGY A;  2DOU A;  4N0B A;  1W3U A;  1I48 A;  2BI9 A;  4WD2 A;  3AEJ C;  3EI8 A;  1M0O A;  3WZF A;  1CL2 A;  3ELP A;  1TOJ A;  1AJS B;  3N5M A;  2D63 A;  4Q6R A;  2R5C A;  1CQ8 A;  1ASL A;  1UU0 A;  4A6T A;  4XJP A;  3FFH A;  1MLY A;  2CY8 A;  1AKB A;  5I92 A;  5F8V A;  2O0R A;  3RUY A;  1W7N A;  3E77 A;  4WYD A;  1SFF A;  3WKR A;  5M49 A;  1YIZ A;  1CQ6 A;  4WXG A;  1AMA A;  3VOM A;  3PAA A;  2VYC A;  3FVX A;  4K05 A;  3DXV A;  3DU4 A;  3HQT A;  3N4X A;  4GEB A;  1WYU B;  1MAP A;  1YJZ A;  2JG2 A;  2CH2 A;  3AEL A;  3EI9 A;  1O69 A;  2AY9 A;  3UE8 A;  1S09 A;  3I16 A;  3TAT A;  2FKI A;  2YKX A;  2F8J A;  4BA4 A;  2AAT A;  2WB6 A;  2HUU A;  3WCO A;  1CZC A;  3NYU A;  4ZAS A;  1M7Y A;  2E7U A;  3B1E A;  2C0R A;  2W8J A;  1YOO A;  2ZC0 A;  2WKA A;  1GC4 A;  2JJG A;  2OQX A;  3E2Z A;  3IF2 A;  3NDN A;  4L0O A;  1LC7 A;  2VGT A;  4EMY A;  2FNI A;  3WGC A;  1QJ3 A;  2ZUK A;  4ADD A;  4XK1 A;  3BWN C;  1AAM A;  4A0H A;  1M0P A;  1GC2 A;  2QMA A;  4UHO A;  3TCM A;  1M0N A;  3PJ0 A;  4CBR A;  5G4J A;  2VGZ A;  4ZWM A;  4W1V A;  1WYT B;  4QGR A;  2CAN A;  2PB2 A;  2BI2 A;  2FM1 A;  2VGV A;  1D7U A;  4ITX A;  3HBX A;  4OT8 A;  4JF0 A;  3QM2 A;  4EU1 A;  1GC0 A;  4JE5 A;  1BJW A;  3B46 A;  2D5Y A;  2OKK A;  1BJ4 A;  1QIR A;  2W7L A;  1IBJ A;  3JW9 A;  1ZOD A;  1MLZ A;  4FL0 A;  2FN6 A;  3M5U A;  4J8L A;  1WYV A;  2VMW A;  3ZRP A;  3QPG A;  4WB0 A;  1SVV A;  3DRD A;  2YCP A;  4H51 A;  3ATH A;  1D7S A;  3FZ7 A;  3KE3 A;  1S07 A;  3NUB A;  1AX4 A;  1V2D A;  1WYT A;  3GET A;  3P1T A;  4R8D A;  5M4B A;  3TFT A;  4ISY A;  1N8P A;  4JEW A;  4J5U A;  1M4N A;  2EZ2 A;  4BHD A;  2CJH A;  1DGD A;  1AIB A;  3MAF A;  3DC1 A;  4BMK A;  1PMM A;  1X0M A;  4NOG A;  3FCR A;  5E3K A;  5EUD A;  3A9X A;  3VK2 A;  1ASE A;  5HDM A;  2Z9W A;  1AKA A;  3BV0 A;  3NX3 A;  4CXR A;  3G0T A;  1BJN A;  3JWB A;  5LH9 A;  3R9A A;  2VMY A;  1PG8 A;  3E2Z B;  3JZL A;  5D95 A;  4ZDP A;  4MGR A;  2VMV A;  1BQD A;  2W7J A;  2VI9 A;  2BI3 A;  1DFO A;  1IAX A;  4XEW A;  5EIG A;  4WLJ A;  4PVF A;  4DBC A;  1GEY A;  1TOG A;  3KGW A;  3W1I A;  3WX9 A;  2DR1 A;  1Z7D A;  5J8Q A;  1KL2 A;  1U08 A;  1GCK A;  2AY1 A;  4WYE A;  1YIY A;  1JS6 A;  1PFF A;  2W8W A;  3EUC A;  2HUI A;  2OAT A;  3OP7 A;  4ZLV A;  4F4E A;  3PDX A;  2D7Y A;  1QIT A;  1VJO A;  2XBN A;  3JU7 A;  3LVJ A;  2C44 A;  2W8U A;  1G7X A;  4TN4 A;  4W91 A;  1O61 A;  4WXB A;  1CZE A;  2ZP7 A;  2W7E A;  5LHA A;  4GSA A;  4WYF A;  4ADE A;  4PFN A;  1AIA A;  1E5E A;  4RKC A;  2E54 A;  2DGL A;  3Q8N A;  1YNU A;  5EFS A;  2PO3 A;  2HOZ A;  5HHY A;  1QIS A;  3E6G A;  4AO9 A;  4CBS A;  1EQB A;  1ASN A;  4IYO B;  4IW7 A;  5E5I A;  2OGA A;  2JJE A;  3BCA A;  4MKJ A;  4RKD A;  3PD6 B;  3ISL A;  1IJI A;  1N2T A;  4R5F A;  3MKJ A;  5E4Z A;  3W1J A;  2EGY A;  1M0Q A;  2JJH A;  4KYO A;  4E1O A;  3QBO A;  2C7T A;  2AY7 A;  1TAS A;  2BWP A;  3AEN B;  4JEY A;  4MQP A;  3ASA A;  1AAW A;  4F5J A;  4Y0H A;  1N31 A;  4PFF A;  1DJ9 A;  4MKK A;  2DKJ A;  1TOK A;  1S0A A;  3BWN A;  3PDB A;  2Z61 A;  2C81 A;  3HT4 A;  2AY2 A;  1IUG A;  3EI6 A;  1S06 A;  1FG3 A;  2OKJ A;  3G7Q A;  3A2B A;  3LVL B;  2R0T A;  3QHX A;  4K2I A;  2W7M A;  3RBF A;  1LW5 A;  5AX8 A;  2VMS A;  1SZS A;  4XJL A;  1GEW A;  3T32 A;  3WY7 A;  2TPL A;  3BB8 A;  3NU8 A;  2CH1 A;  3RCH A;  1VEF A;  3DOD A;  1RV3 A;  4FFC A;  2CJD A;  3LV2 A;  1LS3 A;  1GEX A;  2VGS A;  2VMN A;  4F5G A;  4PIW A;  1RV4 A;  2GSA A;  1S08 A;  4XQ2 A;  3FSL A;  1B5P A;  1WST A;  2VMO A;  3GZD A;  3VK4 A;  3FVS A;  3DXW A;  3AEN A;  4JE5 D;  4W5K A;  3ACZ A;  4HVK A;  4IY7 A;  4M2K A;  4GE9 A;  1J04 A;  1CL1 A;  3GJU A;  1WYV B;  3G8M A;  4UHN A;  4IXS A;  2VIA A;  1GC3 A;  2BI1 A;  2HP2 A;  1ASA A;  1UU1 A;  2OGE A;  2X8U A;  3CAI A;  1AY5 A;  4RIZ A;  2Z9X A;  3R4T A;  4RAE A;  5DJ1 A;  2O7C A;  3ASB A;  4GE7 A;  1KKJ A;  1C9C A;  4U2H A;  1TAT A;  2ZY4 A;  5G09 A;  4R5Z A;  4A00 A;  2EYQ A;  3CBF A;  3USF A;  4A0R A;  2WK7 A;  5D5S A;  2V0Y A;  3MC6 C;  4RM1 A;  3KGX A;  2VMX A;  3GSB A;  4RJ0 A;  4LNJ A;  1IAY A;  2AY3 A;  4A0G A;  5C6U A;  1LKC A;  1ORD A;  4ZDL A;  3NYT A;  3N0L A;  1DJU A;  1WKG A;  3GBX A;  1WKH A;  3AEP A;  4AOA A;  1AHY A;  3K7Y A;  1GBN A;  2GB3 A;  4EFF A;  5FT6 A;  4ITG A;  1MAQ A;  8AAT A;  2YOB A;  1AMR A;  4XAU A;  5EIG B;  2GQN A;  1ELU A;  1QZ9 A;  3GZC A;  2YRI A;  3GR9 A;  2BHX A;  1XEY A;  3BN1 A;  4N0W A;  2AY8 A;  4OBV A;  2EZ1 A;  1ELQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...