1ASFA

The structural basis for the reduced activity of the y226f(y225f) active site mutant of e. coli aspartate aminotransferase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
396
structure length
396
Chain Sequence
b'MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAFQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title The Structural Basis for the Reduced Activity of the Y226F(Y225F) Active Site Mutant of E. Coli Aspartate Aminotransferase
rcsb
source organism Escherichia coli
molecule tags Aminotransferase
total genus 116
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1asfA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1asfA01
4A6UA 2CANA 2VMZA 2YRRA 1TOJA 3JWBA 1DGEA 1IBJA 5I92A 3NX3A 1I29A 3P1TA 1B9IA 1MDZA 1TOGA 1KMJA 2C81A 4JEVA 3FZ8A 1W23A 2EZ2A 5TF5A 3NNKA 3OP7A 2EGYA 2HP1A 1O69A 2PO3A 3MKJA 1SFFA 4GEBA 3B8XA 2GSAA 5JAYA 4CXQA 1O4SA 3E77A 3WX9A 2AY9A 4ZAHA 3GSBA 2W8JA 2E7JA 3DR7A 3FDDA 1FG7A 2FNIA 3ELPA 4B9BA 4RAEA 1CZCA 2EPJA 5EIGB 4LC3A 2VIAA 1BT4A 5DB5A 2W7EA 3ACZA 4P7YA 4FL0A 4ZSWA 4IYOA 3JW9A 4OBUA 2D64A 1WKGA 3DU4A 1ASNA 3WGCA 4EU1A 1PMOA 1ASLA 1FC4A 3BWOA 2C44A 5G4IA 1M32A 3FVUA 5AX8A 1LC8A 3QI6A 3HBXA 1ECXA 1I48A 1AMSA 5HDMA 3HVYA 2F8JA 4DGTA 7AATA 3MAFB 2YHKA 2HOZA 4E3RA 1ARGA 2HOXA 2R0TA 4EB5A 3T32A 3DR4A 4ADDA 3EI8A 4K2BA 3D6KA 1J04A 4MKJA 1AJRA 1GD9A 1O61A 1O62A 3WY7A 4XJLA 2ZUKA 3E2FA 2WK7A 3NU8A 4DQ6A 3QBOA 1BJNA 2CH2A 3WGBA 3AEJC 3FSLA 1SZKA 2W8WA 3OKSA 5EAAA 5FT6A 2W7GA 3H14A 1V72A 5BJ4A 3HMUA 2OQXA 3R4TA 1LC5A 4LNLA 3UWCA 3FVXA 5IWQA 4RKDA 1AHXA 2VLHA 4AOAA 5M4BA 4WYAA 4WYFA 5HHYA 4BA4A 4I8AA 2BIGA 2W8TA 3BCAA 2R5CB 1YIYA 3B46A 5G09A 2VGUA 3HDOA 2Z9WA 4WB0B 3KGWA 3E6GA 3N75A 4CXRA 3TFTA 3NTJA 1VEFA 4W91A 1H0CA 2HP2A 3M5UA 4J8LA 2E7IA 4JF0A 2VGWA 3R9AA 3BCBA 2D66A 1TPLA 2CINA 2V1PA 3QPGA 1I41A 3RCHB 2JJFA 1SVVA 2X5DA 1WKHA 1ASFA 1QJ5A 1S06A 2D65A 4RJ0A 4WB0A 4F5FA 1XI9A 4WXBA 2DGKA 2ZY4A 1WYVA 2EZ1A 2D5YA 3CAIA 4GSAA 1AICA 4RJYA 1N8PA 5FT8A 2YKUA 1AKCA 3WKRA 3DC1A 3EI6A 4QGRA 3K40A 4K2MA 2VI8A 3PA9A 3RCHA 2DOUA 1DKAA 2O0RA 3ZRPA 2O1BA 2QB2A 3GETA 4E77A 4IXZA 4WYEA 4E3QA 1BQDA 3GR9A 1ORDA 4TV7A 1D7SA 1TASA 3BV0A 1S07A 3EI5A 3EI7A 2JGTA 4MQQA 1OATA 1W7MA 3G0TA 3TATA 1N31A 2BIEA 1B5OA 3LVMA 2PB2A 3QM2A 4GE9A 4Q31A 1Z7DA 3ASBA 1C0NA 3QGUA 1ZODA 4EFFA 3DODA 2HOYA 1V2DA 1ARIA 3AELA 5EFSA 3RBLA 5LHAA 2VIBA 2YKXA 1ASDA 4WXFA 3JZLA 3G7QA 2WK8A 1AY8A 1W3UA 2V0YA 3FTBA 3RQ1A 1CS1A 1AHGA 2QA3A 3AEMA 2TPLA 4KXKA 4WYGA 3ZZKA 1TOKA 2Z1ZA 3L44A 1S08A 3ELEA 1IX8A 4GRXA 4B98A 1UU2A 2VMUA 4BA5A 1CQ7A 4W8IA 3WZFA 1IAXA 3TCMA 2QBTA 3ECDA 3FFHA 4U2HA 1OHVA 2AY7A 1AAMA 3H7FA 2BKWA 2VMQA 5G2PA 4ZDOA 2W8VA 2XH1A 1YNUA 2VMRA 3MC6C 2Z9XA 4N0WA 4LNMA 2ZSLA 1DJUA 3KKIA 4L0OA 3NYUA 1AMRA 3P6KA 4LNJA 1JS6A 1UU0A 2Z9UA 1AKBA 4XQ2A 3EUCA 4ZASA 1LC7A 1UU1A 1X0MA 2ZY5A 2YOBA 2ZYJA 2G6WA 1V2FA 4PFFA 2C7TA 3GJUA 1WYTB 4MKKA 4ATQA 3K7YA 3GZDC 2FNUA 3QN6A 3PAAA 1BS0A 3WLXA 1BJOB 2DKJA 3NYSA 1PG8A 2FM1A 3WCOA 1QIRA 4LW2A 1UKJA 2WKAA 4AZJA 3FD0A 2YKVA 1PMMA 3NU7A 1WYTA 1ASCA 2W7LA 4OC9A 1EG5A 5G0AA 2CH1A 5C6UA 1AX4A 1M0NA 1AY5A 1BQAA 1BW0A 2YRIA 3FQ8A 2D63A 4Q75A 4AO9A 4O6ZA 3BWNC 2W7HA 4Q6RA 2RFVA 5EIGA 1W7LA 2CB1A 4MQPA 3W1IA 4R2NA 2BHXA 4IW7A 1GC3A 1AAWA 1J32A 1V2EA 4ATPA 3PJ0A 4A6RA 4A0HA 1Y4IA 4OBVA 4JEXA 1D7RA 2W8UA 1ELQA 4PIWA 2AY8A 3LY1A 4Y0DA 1CL2A 5EAVA 1C7NA 3MAFA 1TOEA 3KE3A 3F9TA 2JJHA 4CVQA 2ZSMA 4F4EA 2VMTA 2WK9A 3N5MA 4PVFA 4F5MA 1RVUA 2EH6A 1JG8A 3AEJA 4RM1A 1AHYA 5LH9A 1GC4A 4K2IA 3DYDA 1PFFA 2DGLA 4ITGA 2FYFA 4ZSYA 1FG3A 2GB3A 1B9HA 3JTXA 3PGYA 5M49A 1ASBA 1LW5A 1BJWA 3NUIA 3AOWA 3K28A 3EIAA 4HF8A 3JWAA 4OT8A 4XK1A 1TATA 4ZDLA 4DBCA 1VJOA 1XEYA 4JE5A 4W1VA 1ZC9A 1X2AA 4JE5D 4UHNA 1M6SA 2CJDA 5EUDA 3LWSA 4ADEA 3DRDA 1G7XA 1WSTA 3G8MA 2VMXA 3A9YA 1S0AA 1M4NA 4MY5A 4A0RA 4HVKA 3L8AA 4MGRA 2OATA 2OKJA 3N0LA 5EQCA 2AATA 2R5CA 1ASEA 4FFCA 1YJSA 2NMPA 1D2FA 1ZOBA 3CQ5A 3I5TA 3IHJA 4IY7A 4LW4A 4U1TA 1MDOA 2AEVA 3RI6A 1EQBA 2AY4A 1CL1A 1ARSA 3DXVA 2CFBA 3FKDA 2DKBA 3GZCA 4BQ0A 3FVSA 5G4JA 4EB7A 2BI9A 4ZDPA 1S09A 3B1DA 1Z3ZA 2HUFA 2BYJA 4GE4A 2BI2A 5DX5A 1KL2A 2D7YA 2AY5A 3Q8NA 1MDXA 3CBFA 2ZY3A 4Q76A 1YOOA 4JEYA 5FT4A 1OHYA 4WXGA 1E5FA 3FZ6A 3A9XA 1CQ6A 3PD6B 2DGMA 4WLJA 4MSOA 1CJ0A 5E3KA 4KAMA 4EMYA 1AJSB 3ATHA 1IX6A 3AEOA 1CZEA 3ISLA 2VI9A 5DJ9A 3NRAA 3DZZA 1AHEA 3PIUA 4ZWMA 2Z67A 3PPLA 3I4JA 3QHXA 2CSTA 2Z20A 4OTLA 4OMAA 1X28A 1YJZA 1GEWA 3MAUA 4JF1A 4RKCA 4AZKA 5EUEA 1T3IA 1AHFA 1AY4A 4WYDA 1AJSA 1M0QA 4E1OA 4IX8A 1GBNA 2AEUA 2BYLA 4ZWVA 4M2KA 4A6TA 3NDNA 4M2MA 1CQ8A 1B4XA 1D7VA 3RUYA 1IVRA 2YCPA 4PFNA 1DJ9A 1LKCA 5F8VA 1I43A 3E9KA 1QJ3A 1C7OA 5FT5A 1MGVA 1ASMA 2X3LA 9AATA 1KL1A 2DR1A 1G4VA 3E2ZB 1BKGA 2ZC0A 2YCNA 2XBNA 3II0A 2VMNA 3BC8A 3GWPA 1C9CA 2FQ6A 5EUNA 3AEPA 3USFA 3F0HA 2CJHA 4AO4A 2Z61A 4XJPA 4UOYA 2X5FA 4P3MA 4UHOA 2VMPA 1AIAA 1QISA 2E7UA 2GMUA 2VGZA 2D7ZA 2O7CA 4UHMA 3W1HA 2HORA 3EZ1A 5J8QA 1MAPA 4R5ZA 4UQVA 3VP6A 2AY1A 3UE8A 3EZSA 1M0PA 3GZDA 2W7MA 2R5EA 3ZRRA 3F6TA 1B8GA 2EO5A 2YKYA 3NYTA 1IUGA 4ADCA 2QLRA 1SZUA 1OXPA 2VMVA 3ASAA 1BJOA 1SPAA 1SF2A 4IYOB 1C4KA 4RLGA 2QB3A 1C7GA 2BI3A 4A72A 4A0FA 5D95A 3VOMA 3BWNA 3WCNA 1KKJA 2VYCA 2W7KA 3A8UX 4J5UA 5M4DA 5M46A 3JU7A 4NOGA 2BWNA 5K8BA 1TARA 1RVYA 3VAXA 4Y0HA 1W7NA 1U08A 2VGVA 2ZJGA 1OXOA 4A00A 1SZSA 4CBSA 4A0GA 2ZY2A 3B1EA 2E54A 3A2BA 3PDBB 4W5KA 1LW4A 3MBBA 3ZZJA 2GQNA 4F5IA 3VK2A 3B1CA 3IF2A 3FZ7A 4JEZA 4ADBA 2ORDA 3AENB 1ASGA 2AY6A 1ELUA 2BI1A 2D61A 3KGXA 1GDEA 4ZM4A 4CBRA 3BB8A 1IJIA 4AH3A 1GC0A 1LS3A 2QMAA 1M7YA 2PB0A 4BMKA 1YIZA 1GEXA 2OKKA 3PDBA 2VMYA 4Y0IA 2BWPA 5E5IA 4WYCA 4F5JA 3FDBA 1JS3A 4XJOA 3VK4A 3CQ4A 3FQAA 4IXSA 3AENA 1MLYA 4XJMA 1KMKA 1DFOA 2Z1YA 1P3WA 5BJ3A 1ARTA 2FN6A 2HUUA 2JG2A 3LVLB 1IX7A 2YCTA 4W1XA 2X8UA 1QZ9A 1BJ4A 1JF9A 3MADA 3WKSA 1QITA 2AY3A 3BCXA 3PDXA 3RBFA 2W7FA 4W1WA 1RV3A 4WBTA 3HL2A 3AATA 1VP4A 1RV4A 3LV2A 4TN4A 1ASAA 3HLMA 1GC2A 4BHDA 3LG0A 1WYUB 1AKAA 8AATA 2VMOA 3BS8A 3FFRA 2R2NA 3MEBA 4M2JA 1GEYA 1WYVB 2HUIA 3ZRQA 2JJGA 4MQRA 3BN1A 4JEWA 5DJ1A 4WD2A 2BIAA 1YJYA 3LVJA 2OGEA 4N0BA 3FRKA 3UAKA 2JISA 3COGA 1LK9A 3A9ZA 4R5FA 3EIBA 3VK3A 1G7WA 1WYUA 4OYTA 5E4ZA 4WP0A 1AMAA 2VGTA 4XAUA 4H51A 4F5LA 4XEWA 4RITA 2C0RA 5HXXA 1IAYA 1ARHA 4OCAA 2VGSA 4KYOA 3PD6A 2JJEA 4IXOA 2GMSA 4ZLVA 2W7JA 4GE7A 3NUBA 1G4XA 1TOIA 1EJIA 3FCRA 4TMRA 3HQTA 4GDYA 1H1CA 3TQXA 3GBXA 3HT4A 2CTZA 1QGNA 2CJGA 2Q7WA 3LVKA 2VMSA 4F5KA 3EI9A 5G2QA 1M0OA 1OHWA 1GCKA 4F5HA 1MAQA 2CY8A 1N2TA 1MLZA 2BWOA 1AMQA 5D5SA 3E2YA 2OGAA 1YAAA 3AV7A 2VLFA 1DTYA 1X29A 4ISYA 2VMWA 1DJEA 2BI5A 2HZPA 2Z9VA 4ITXA 1E5EA 3MC6A 1B5PA 1AIBA 2AY2A 4RIZA 3AEMC 1KKPA 4WLHA 2W7DA 4R8DA 3W1JA 2ZP7A 4F5GA 3E2ZA 4ZM3A 2W7IA 1DGDA 3DXWA 3TFUA 5F9SA 3AOVA 3I16A 1D7UA 3CQ6A 3FQ7A
chains in the Genus database with same CATH superfamily
4A6UA 2CANA 2VMZA 2YRRA 1TOJA 3JWBA 1DGEA 1IBJA 5I92A 3NX3A 1I29A 3P1TA 1B9IA 1MDZA 1TOGA 1KMJA 2C81A 4JEVA 3FZ8A 1W23A 2EZ2A 5TF5A 3NNKA 3OP7A 2EGYA 2HP1A 1O69A 2PO3A 3MKJA 1SFFA 4GEBA 3B8XA 2GSAA 5JAYA 4CXQA 1O4SA 3E77A 3WX9A 2AY9A 4ZAHA 3GSBA 2W8JA 2E7JA 3DR7A 3FDDA 1FG7A 2FNIA 3ELPA 4B9BA 4RAEA 1CZCA 2EPJA 5EIGB 4LC3A 2VIAA 1BT4A 5DB5A 2W7EA 3ACZA 1KAFA 4P7YA 4FL0A 4ZSWA 4IYOA 3JW9A 4OBUA 2D64A 1WKGA 3DU4A 1ASNA 3WGCA 4EU1A 1PMOA 1ASLA 1FC4A 3BWOA 2C44A 5G4IA 1M32A 3FVUA 5AX8A 1LC8A 3QI6A 3HBXA 1ECXA 1I48A 1AMSA 5HDMA 3HVYA 2F8JA 4DGTA 7AATA 3MAFB 2YHKA 2HOZA 4E3RA 1ARGA 2HOXA 2R0TA 4EB5A 3T32A 3DR4A 4ADDA 3EI8A 4K2BA 3D6KA 1J04A 4MKJA 1AJRA 1GD9A 1O61A 1O62A 3WY7A 4XJLA 2ZUKA 3E2FA 2WK7A 3NU8A 4DQ6A 3QBOA 1BJNA 2CH2A 3WGBA 3AEJC 3FSLA 1SZKA 2W8WA 3OKSA 5EAAA 5FT6A 2W7GA 3H14A 1V72A 5BJ4A 3HMUA 2OQXA 3R4TA 1LC5A 4LNLA 3UWCA 3FVXA 5IWQA 4RKDA 1AHXA 2VLHA 4AOAA 5M4BA 4WYAA 4WYFA 5HHYA 4BA4A 4I8AA 2BIGA 2W8TA 3BCAA 2R5CB 1YIYA 3B46A 5G09A 2VGUA 3HDOA 2Z9WA 4WB0B 3KGWA 3E6GA 3N75A 4CXRA 3TFTA 3NTJA 1VEFA 4W91A 1H0CA 2HP2A 3M5UA 4J8LA 2E7IA 4JF0A 2VGWA 3R9AA 3BCBA 2D66A 1TPLA 2CINA 2V1PA 3QPGA 1I41A 3RCHB 2JJFA 1SVVA 2X5DA 1WKHA 1ASFA 1QJ5A 1S06A 2D65A 4RJ0A 4WB0A 4F5FA 1XI9A 4WXBA 2DGKA 2ZY4A 1WYVA 2EZ1A 2D5YA 3CAIA 4GSAA 1AICA 4RJYA 1N8PA 5FT8A 2YKUA 1AKCA 3WKRA 3DC1A 3EI6A 4QGRA 3K40A 4K2MA 2VI8A 3PA9A 3RCHA 2DOUA 1DKAA 2O0RA 3ZRPA 2O1BA 2QB2A 3GETA 4E77A 4IXZA 4WYEA 4E3QA 1BQDA 3GR9A 2QSRA 1ORDA 4TV7A 1D7SA 1TASA 3BV0A 1S07A 3EI5A 3EI7A 2JGTA 4MQQA 1OATA 1W7MA 3G0TA 3TATA 1N31A 2BIEA 1B5OA 3LVMA 2PB2A 3QM2A 4GE9A 4Q31A 3N7NA 1Z7DA 3ASBA 1C0NA 3H9XA 3QGUA 1ZODA 4EFFA 3DODA 2HOYA 3N4RA 1V2DA 1ARIA 3AELA 5EFSA 3RBLA 5LHAA 2VIBA 2YKXA 1ASDA 4WXFA 3JZLA 3G7QA 2WK8A 1AY8A 1W3UA 2V0YA 3FTBA 3RQ1A 1CS1A 1AHGA 2QA3A 3AEMA 2TPLA 4KXKA 4WYGA 3ZZKA 1TOKA 2Z1ZA 3L44A 1S08A 3ELEA 1IX8A 4GRXA 4B98A 1UU2A 2VMUA 4BA5A 1CQ7A 4W8IA 3WZFA 1IAXA 3TCMA 2QBTA 3ECDA 3FFHA 4U2HA 1OHVA 2AY7A 1AAMA 3H7FA 2BKWA 2VMQA 5G2PA 4ZDOA 2W8VA 2XH1A 1YNUA 2VMRA 3MC6C 2Z9XA 4N0WA 4LNMA 2ZSLA 1DJUA 3KKIA 4L0OA 3NYUA 1AMRA 3P6KA 4LNJA 1JS6A 1UU0A 2Z9UA 1AKBA 4XQ2A 3EUCA 4ZASA 1LC7A 1UU1A 1X0MA 2ZY5A 2YOBA 2ZYJA 2G6WA 1V2FA 4PFFA 2WB6A 2C7TA 3GJUA 1WYTB 4MKKA 4ATQA 3K7YA 3GZDC 2FNUA 3QN6A 3PAAA 1BS0A 3WLXA 2FKIA 1BJOB 2DKJA 3NYSA 1PG8A 2FM1A 3WCOA 1QIRA 4LW2A 1UKJA 2WKAA 4AZJA 3FD0A 2YKVA 1PMMA 3NU7A 1WYTA 1ASCA 2W7LA 4OC9A 1EG5A 5G0AA 2CH1A 5C6UA 1AX4A 1M0NA 1AY5A 1BQAA 1BW0A 2YRIA 3FQ8A 2D63A 4Q75A 4AO9A 4O6ZA 3BWNC 2W7HA 4Q6RA 2RFVA 5EIGA 1W7LA 2CB1A 4MQPA 3W1IA 4R2NA 2BHXA 4IW7A 1GC3A 1AAWA 1J32A 1V2EA 4ATPA 3PJ0A 4A6RA 4A0HA 1Y4IA 4OBVA 4JEXA 1D7RA 2W8UA 1ELQA 4PIWA 2AY8A 3LY1A 4Y0DA 1CL2A 5EAVA 1C7NA 3MAFA 1TOEA 3KE3A 3F9TA 2JJHA 4CVQA 2ZSMA 4F4EA 2VMTA 2WK9A 3N5MA 4PVFA 4F5MA 1RVUA 2EH6A 1JG8A 3AEJA 4RM1A 1AHYA 5LH9A 1GC4A 4K2IA 3DYDA 1PFFA 2DGLA 4ITGA 2FYFA 4ZSYA 1FG3A 2GB3A 1B9HA 3JTXA 3PGYA 5M49A 1ASBA 1LW5A 1BJWA 3NUIA 3AOWA 3K28A 3EIAA 4HF8A 3JWAA 4OT8A 4XK1A 1TATA 4ZDLA 4DBCA 1VJOA 1XEYA 4JE5A 4W1VA 1ZC9A 1X2AA 4JE5D 4UHNA 1M6SA 2CJDA 5EUDA 3LWSA 4ADEA 3DRDA 1G7XA 1WSTA 3G8MA 2VMXA 3A9YA 1S0AA 1M4NA 4MY5A 4A0RA 4HVKA 3L8AA 4MGRA 2OATA 2OKJA 3N0LA 5EQCA 2AATA 2R5CA 1ASEA 4FFCA 1YJSA 2NMPA 1D2FA 1ZOBA 3CQ5A 3I5TA 3IHJA 4IY7A 4LW4A 4U1TA 1MDOA 2AEVA 3RI6A 1EQBA 2AY4A 1CL1A 1ARSA 3DXVA 2CFBA 3FKDA 2DKBA 3GZCA 4BQ0A 3FVSA 5G4JA 4EB7A 2BI9A 4ZDPA 1S09A 3B1DA 1Z3ZA 2HUFA 2BYJA 4GE4A 2BI2A 5DX5A 1KL2A 2D7YA 2AY5A 3Q8NA 3N4XA 1MDXA 3CBFA 2ZY3A 4Q76A 1YOOA 4JEYA 5FT4A 1OHYA 4WXGA 1E5FA 3FZ6A 3A9XA 1CQ6A 3PD6B 2DGMA 4WLJA 4MSOA 1CJ0A 5E3KA 4KAMA 4EMYA 1AJSB 3ATHA 1IX6A 3AEOA 1CZEA 3ISLA 2VI9A 5DJ9A 3NRAA 3DZZA 1AHEA 3PIUA 4ZWMA 2Z67A 3PPLA 3I4JA 3QHXA 2CSTA 2Z20A 4OTLA 4OMAA 1X28A 1YJZA 1GEWA 3MAUA 4JF1A 4RKCA 4AZKA 5EUEA 1T3IA 1AHFA 1AY4A 4WYDA 1AJSA 1M0QA 4E1OA 4IX8A 1GBNA 2AEUA 2BYLA 4ZWVA 4M2KA 4A6TA 3NDNA 4M2MA 1CQ8A 1B4XA 1D7VA 3RUYA 1IVRA 2YCPA 4PFNA 1DJ9A 1LKCA 5F8VA 1I43A 3E9KA 1QJ3A 1C7OA 5FT5A 1MGVA 1ASMA 2X3LA 9AATA 2G7JA 1KL1A 2DR1A 1G4VA 3E2ZB 1BKGA 2ZC0A 2YCNA 2XBNA 3II0A 2VMNA 3BC8A 3GWPA 1C9CA 2FQ6A 5EUNA 3AEPA 3USFA 3F0HA 2CJHA 4AO4A 2Z61A 4XJPA 4UOYA 2X5FA 4H63Q 4P3MA 4UHOA 2VMPA 1AIAA 1QISA 2E7UA 2GMUA 2KFPA 2VGZA 2D7ZA 2O7CA 4UHMA 3W1HA 2HORA 3EZ1A 4K05A 5J8QA 1MAPA 4R5ZA 4UQVA 3VP6A 2AY1A 3UE8A 3EZSA 1M0PA 3GZDA 2W7MA 2R5EA 3ZRRA 3F6TA 1B8GA 2EO5A 2YKYA 3NYTA 1IUGA 4ADCA 2QLRA 1SZUA 1OXPA 2VMVA 3ASAA 1BJOA 1SPAA 1SF2A 4IYOB 1C4KA 4RLGA 2QB3A 1C7GA 2BI3A 4A72A 4A0FA 5D95A 3VOMA 3BWNA 3WCNA 1KKJA 2VYCA 2W7KA 3A8UX 4J5UA 5M4DA 5M46A 3JU7A 4NOGA 2BWNA 5K8BA 1TARA 1RVYA 3VAXA 4Y0HA 1W7NA 1U08A 2VGVA 2ZJGA 1OXOA 4A00A 1SZSA 4CBSA 4A0GA 2ZY2A 3B1EA 2E54A 3A2BA 3PDBB 4W5KA 1LW4A 3MBBA 3ZZJA 2GQNA 4F5IA 3VK2A 3N4SA 3B1CA 3IF2A 3FZ7A 4JEZA 4ADBA 2ORDA 3AENB 1ASGA 2AY6A 1ELUA 2BI1A 2D61A 3KGXA 1GDEA 4ZM4A 4CBRA 3BB8A 2A1VA 1IJIA 4AH3A 1GC0A 1LS3A 2QMAA 1M7YA 2PB0A 4BMKA 1YIZA 1GEXA 2OKKA 3PDBA 2VMYA 4Y0IA 2BWPA 5E5IA 4WYCA 4F5JA 3FDBA 1JS3A 4XJOA 3VK4A 3CQ4A 3FQAA 4IXSA 3AENA 1MLYA 4XJMA 1KMKA 1DFOA 2Z1YA 1P3WA 5BJ3A 1ARTA 2FN6A 2HUUA 2JG2A 3LVLB 1IX7A 2YCTA 4W1XA 2X8UA 1QZ9A 1BJ4A 1JF9A 3MADA 3WKSA 1QITA 2AY3A 3BCXA 3PDXA 3RBFA 2W7FA 4W1WA 1RV3A 4WBTA 3HL2A 3AATA 1VP4A 1RV4A 3LV2A 4TN4A 1ASAA 3HLMA 1GC2A 4BHDA 3LG0A 1WYUB 1AKAA 8AATA 2VMOA 3BS8A 3FFRA 2R2NA 3MEBA 4M2JA 1GEYA 1WYVB 2HUIA 3ZRQA 2JJGA 2EYQA 4MQRA 3BN1A 4JEWA 5DJ1A 4WD2A 2BIAA 1YJYA 3LVJA 2OGEA 4N0BA 3FRKA 3UAKA 2JISA 3COGA 1LK9A 3A9ZA 4R5FA 3EIBA 3VK3A 1G7WA 1WYUA 4OYTA 5E4ZA 4WP0A 1AMAA 2VGTA 4XAUA 4H51A 4F5LA 4XEWA 4RITA 5KTBA 2C0RA 5HXXA 1IAYA 1ARHA 4OCAA 2VGSA 4KYOA 3PD6A 2JJEA 4IXOA 2GMSA 4ZLVA 2W7JA 4GE7A 3NUBA 1G4XA 1TOIA 1EJIA 3FCRA 4TMRA 3HQTA 4GDYA 1H1CA 3TQXA 3GBXA 3HT4A 2CTZA 1QGNA 2CJGA 2Q7WA 3LVKA 2VMSA 4F5KA 3EI9A 5G2QA 1M0OA 1OHWA 1GCKA 4F5HA 1MAQA 2CY8A 1N2TA 1MLZA 2BWOA 1AMQA 5D5SA 3E2YA 2OGAA 1YAAA 3AV7A 2VLFA 1DTYA 1X29A 4ISYA 2VMWA 1DJEA 2BI5A 2HZPA 2Z9VA 4ITXA 1E5EA 3MC6A 1B5PA 1AIBA 2AY2A 4RIZA 3AEMC 1KKPA 4WLHA 2W7DA 4R8DA 3W1JA 2ZP7A 4F5GA 3E2ZA 4ZM3A 2W7IA 1DGDA 3DXWA 3TFUA 5F9SA 3AOVA 3I16A 1D7UA 3CQ6A 3FQ7A
chains in the Genus database with same CATH topology
4A6UA 2CANA 2VMZA 2YRRA 1TOJA 3JWBA 1DGEA 1IBJA 5I92A 3NX3A 1I29A 3P1TA 1B9IA 1MDZA 1TOGA 1KMJA 2C81A 4JEVA 3FZ8A 1W23A 2EZ2A 5TF5A 3NNKA 3OP7A 2EGYA 2HP1A 1O69A 2PO3A 3MKJA 1SFFA 4GEBA 3B8XA 2GSAA 5JAYA 4CXQA 1O4SA 3E77A 3WX9A 2AY9A 4ZAHA 3GSBA 2W8JA 2E7JA 3DR7A 3FDDA 1FG7A 2FNIA 3ELPA 4B9BA 4RAEA 1CZCA 2EPJA 5EIGB 4LC3A 2VIAA 1BT4A 5DB5A 2W7EA 3ACZA 4P7YA 4FL0A 4ZSWA 4IYOA 3JW9A 4OBUA 2D64A 1WKGA 3DU4A 1ASNA 3WGCA 4EU1A 1PMOA 1ASLA 1FC4A 3BWOA 2C44A 5G4IA 1M32A 3FVUA 5AX8A 1LC8A 3QI6A 3HBXA 1ECXA 1I48A 1AMSA 5HDMA 3HVYA 2F8JA 4DGTA 7AATA 3MAFB 2YHKA 2HOZA 4E3RA 1ARGA 2HOXA 2R0TA 4EB5A 3T32A 3DR4A 4ADDA 3EI8A 4K2BA 3D6KA 1J04A 4MKJA 1AJRA 1GD9A 1O61A 1O62A 3WY7A 4XJLA 2ZUKA 3E2FA 2WK7A 3NU8A 4DQ6A 3QBOA 1BJNA 2CH2A 3WGBA 3AEJC 3FSLA 1SZKA 2W8WA 3OKSA 5EAAA 5FT6A 2W7GA 3H14A 1V72A 5BJ4A 3HMUA 2OQXA 3R4TA 1LC5A 4LNLA 3UWCA 3FVXA 5IWQA 4RKDA 1AHXA 2VLHA 4AOAA 5M4BA 4WYAA 4WYFA 5HHYA 4BA4A 4I8AA 2BIGA 2W8TA 3BCAA 2R5CB 1YIYA 3B46A 5G09A 2VGUA 3HDOA 2Z9WA 4WB0B 3KGWA 3E6GA 3N75A 4CXRA 3TFTA 3NTJA 1VEFA 4W91A 1H0CA 2HP2A 3M5UA 4J8LA 2E7IA 4JF0A 2VGWA 3R9AA 3BCBA 2D66A 1TPLA 2CINA 2V1PA 3QPGA 1I41A 3RCHB 2JJFA 1SVVA 2X5DA 1WKHA 1ASFA 1QJ5A 1S06A 2D65A 4RJ0A 4WB0A 4F5FA 1XI9A 4WXBA 2DGKA 2ZY4A 1WYVA 2EZ1A 2D5YA 3CAIA 4GSAA 1AICA 4RJYA 1N8PA 5FT8A 2YKUA 1AKCA 3WKRA 3DC1A 3EI6A 4QGRA 3K40A 4K2MA 2VI8A 3PA9A 3RCHA 2DOUA 1DKAA 2O0RA 3ZRPA 2O1BA 2QB2A 3GETA 4E77A 4IXZA 4WYEA 4E3QA 1BQDA 3GR9A 2QSRA 1ORDA 4TV7A 1D7SA 1TASA 3BV0A 1S07A 3EI5A 3EI7A 2JGTA 4MQQA 1OATA 1W7MA 3G0TA 3TATA 1N31A 2BIEA 1B5OA 3LVMA 2PB2A 3QM2A 4GE9A 4Q31A 3N7NA 1Z7DA 3ASBA 1C0NA 3H9XA 3QGUA 1ZODA 4EFFA 3DODA 2HOYA 3N4RA 1V2DA 1ARIA 3AELA 5EFSA 3RBLA 5LHAA 2VIBA 2YKXA 1ASDA 4WXFA 3JZLA 3G7QA 2WK8A 1AY8A 1W3UA 2V0YA 3FTBA 3RQ1A 1CS1A 1AHGA 2QA3A 3AEMA 2TPLA 4KXKA 4WYGA 3ZZKA 1TOKA 2Z1ZA 3L44A 1S08A 3ELEA 1IX8A 4GRXA 4B98A 1UU2A 2VMUA 4BA5A 1CQ7A 4W8IA 3WZFA 1IAXA 3TCMA 2QBTA 3ECDA 3FFHA 4U2HA 1OHVA 2AY7A 1AAMA 3H7FA 2BKWA 2VMQA 5G2PA 4ZDOA 2W8VA 2XH1A 1YNUA 2VMRA 3MC6C 2Z9XA 4N0WA 4LNMA 2ZSLA 1DJUA 3KKIA 4L0OA 3NYUA 1AMRA 3P6KA 4LNJA 1JS6A 1UU0A 2Z9UA 1AKBA 4XQ2A 3EUCA 4ZASA 1LC7A 1UU1A 1X0MA 2ZY5A 2YOBA 2ZYJA 2G6WA 1V2FA 4PFFA 2WB6A 2C7TA 3GJUA 1WYTB 4MKKA 4ATQA 3K7YA 3GZDC 2FNUA 3QN6A 3PAAA 1BS0A 3WLXA 2FKIA 1BJOB 2DKJA 3NYSA 1PG8A 2FM1A 3WCOA 1QIRA 4LW2A 1UKJA 2WKAA 4AZJA 3FD0A 2YKVA 1PMMA 3NU7A 1WYTA 1ASCA 2W7LA 4OC9A 1EG5A 5G0AA 2CH1A 5C6UA 1AX4A 1M0NA 1AY5A 1BQAA 1BW0A 2YRIA 3FQ8A 2D63A 4Q75A 4AO9A 4O6ZA 3BWNC 2W7HA 4Q6RA 2RFVA 5EIGA 1W7LA 2CB1A 4MQPA 3W1IA 4R2NA 2BHXA 4IW7A 1GC3A 1AAWA 1J32A 1V2EA 4ATPA 3PJ0A 4A6RA 4A0HA 1Y4IA 4OBVA 4JEXA 1D7RA 2W8UA 1ELQA 4PIWA 2AY8A 3LY1A 4Y0DA 1CL2A 5EAVA 1C7NA 3MAFA 1TOEA 3KE3A 3F9TA 2JJHA 4CVQA 2ZSMA 4F4EA 2VMTA 2WK9A 3N5MA 4PVFA 4F5MA 1RVUA 2EH6A 1JG8A 3AEJA 4RM1A 1AHYA 5LH9A 1GC4A 4K2IA 3DYDA 1PFFA 2DGLA 4ITGA 2FYFA 4ZSYA 1FG3A 2GB3A 1B9HA 3JTXA 3PGYA 5M49A 1ASBA 1LW5A 1BJWA 3NUIA 3AOWA 3K28A 3EIAA 4HF8A 3JWAA 4OT8A 4XK1A 1TATA 4ZDLA 4DBCA 1VJOA 1XEYA 4JE5A 4W1VA 1ZC9A 1X2AA 4JE5D 4UHNA 1M6SA 2CJDA 5EUDA 3LWSA 4ADEA 3DRDA 1G7XA 1WSTA 3G8MA 2VMXA 3A9YA 1S0AA 1M4NA 4MY5A 4A0RA 4HVKA 3L8AA 4MGRA 2OATA 2OKJA 3N0LA 5EQCA 2AATA 2R5CA 1ASEA 4FFCA 1YJSA 2NMPA 1D2FA 1ZOBA 3CQ5A 3I5TA 3IHJA 4IY7A 4LW4A 4U1TA 1MDOA 2AEVA 3RI6A 1EQBA 2AY4A 1CL1A 1ARSA 3DXVA 2CFBA 3FKDA 2DKBA 3GZCA 4BQ0A 3FVSA 5G4JA 4EB7A 2BI9A 4ZDPA 1S09A 3B1DA 1Z3ZA 2HUFA 2BYJA 4GE4A 2BI2A 5DX5A 1KL2A 2D7YA 2AY5A 3Q8NA 3N4XA 1MDXA 3CBFA 2ZY3A 4Q76A 1YOOA 4JEYA 5FT4A 1OHYA 4WXGA 1E5FA 3FZ6A 3A9XA 1CQ6A 3PD6B 2DGMA 4WLJA 4MSOA 1CJ0A 5E3KA 4KAMA 4EMYA 1AJSB 3ATHA 1IX6A 3AEOA 1CZEA 3ISLA 2VI9A 5DJ9A 3NRAA 3DZZA 1AHEA 3PIUA 4ZWMA 2Z67A 3PPLA 3I4JA 3QHXA 2CSTA 2Z20A 4OTLA 4OMAA 1X28A 1YJZA 1GEWA 3MAUA 4JF1A 4RKCA 4AZKA 5EUEA 1T3IA 1AHFA 1AY4A 4WYDA 1AJSA 1M0QA 4E1OA 4IX8A 1GBNA 2AEUA 2BYLA 4ZWVA 4M2KA 4A6TA 3NDNA 4M2MA 1CQ8A 1B4XA 1D7VA 3RUYA 1IVRA 2YCPA 4PFNA 1DJ9A 1LKCA 5F8VA 1I43A 3E9KA 1QJ3A 1C7OA 5FT5A 1MGVA 1ASMA 2X3LA 9AATA 2G7JA 1KL1A 2DR1A 1G4VA 3E2ZB 1BKGA 2ZC0A 2YCNA 2XBNA 3II0A 2VMNA 3BC8A 3GWPA 1C9CA 2FQ6A 5EUNA 3AEPA 3USFA 3F0HA 2CJHA 4AO4A 2Z61A 4XJPA 4UOYA 2X5FA 4H63Q 4P3MA 4UHOA 2VMPA 1AIAA 1QISA 2E7UA 2GMUA 2KFPA 2VGZA 2D7ZA 2O7CA 4UHMA 3W1HA 2HORA 3EZ1A 4K05A 5J8QA 1MAPA 4R5ZA 4UQVA 3VP6A 2AY1A 3UE8A 3EZSA 1M0PA 3GZDA 2W7MA 2R5EA 3ZRRA 3F6TA 1B8GA 2EO5A 2YKYA 3NYTA 1IUGA 4ADCA 2QLRA 1SZUA 1OXPA 2VMVA 3ASAA 1BJOA 1SPAA 1SF2A 4IYOB 1C4KA 4RLGA 2QB3A 1C7GA 2BI3A 4A72A 4A0FA 5D95A 3VOMA 3BWNA 3WCNA 1KKJA 2VYCA 2W7KA 3A8UX 4J5UA 5M4DA 5M46A 3JU7A 4NOGA 2BWNA 5K8BA 1TARA 1RVYA 3VAXA 4Y0HA 1W7NA 1U08A 2VGVA 2ZJGA 1OXOA 4A00A 1SZSA 4CBSA 4A0GA 2ZY2A 3B1EA 2E54A 3A2BA 3PDBB 4W5KA 1LW4A 3MBBA 3ZZJA 2GQNA 4F5IA 3VK2A 3N4SA 3B1CA 3IF2A 3FZ7A 4JEZA 4ADBA 2ORDA 3AENB 1ASGA 2AY6A 1ELUA 2BI1A 2D61A 3KGXA 1GDEA 4ZM4A 4CBRA 3BB8A 2A1VA 1IJIA 4AH3A 1GC0A 1LS3A 2QMAA 1M7YA 2PB0A 4BMKA 1YIZA 1GEXA 2OKKA 3PDBA 2VMYA 4Y0IA 2BWPA 5E5IA 4WYCA 4F5JA 3FDBA 1JS3A 4XJOA 3VK4A 3CQ4A 3FQAA 4IXSA 3AENA 1MLYA 4XJMA 1KMKA 1DFOA 2Z1YA 1P3WA 5BJ3A 1ARTA 2FN6A 2HUUA 2JG2A 3LVLB 1IX7A 2YCTA 4W1XA 2X8UA 1QZ9A 1BJ4A 1JF9A 3MADA 3WKSA 1QITA 2AY3A 3BCXA 3PDXA 3RBFA 2W7FA 4W1WA 1RV3A 4WBTA 3HL2A 3AATA 1VP4A 1RV4A 3LV2A 4TN4A 1ASAA 3HLMA 1GC2A 4BHDA 3LG0A 1WYUB 1AKAA 8AATA 2VMOA 3BS8A 3FFRA 2R2NA 3MEBA 4M2JA 1GEYA 1WYVB 2HUIA 3ZRQA 2JJGA 2EYQA 4MQRA 3BN1A 4JEWA 5DJ1A 4WD2A 2BIAA 1YJYA 3LVJA 2OGEA 4N0BA 3FRKA 3UAKA 2JISA 3COGA 1LK9A 3A9ZA 4R5FA 3EIBA 3VK3A 1G7WA 1WYUA 4OYTA 5E4ZA 4WP0A 1AMAA 2VGTA 4XAUA 4H51A 4F5LA 4XEWA 4RITA 5KTBA 2C0RA 5HXXA 1IAYA 1ARHA 4OCAA 2VGSA 4KYOA 3PD6A 2JJEA 4IXOA 2GMSA 4ZLVA 2W7JA 4GE7A 3NUBA 1G4XA 1TOIA 1EJIA 3FCRA 4TMRA 3HQTA 4GDYA 1H1CA 3TQXA 3GBXA 3HT4A 2CTZA 1QGNA 2CJGA 2Q7WA 3LVKA 2VMSA 4F5KA 3EI9A 5G2QA 1M0OA 1OHWA 1GCKA 4F5HA 1MAQA 2CY8A 1N2TA 1MLZA 2BWOA 1AMQA 5D5SA 3E2YA 2OGAA 1YAAA 3AV7A 2VLFA 1DTYA 1X29A 4ISYA 2VMWA 1DJEA 2BI5A 2HZPA 2Z9VA 4ITXA 1E5EA 3MC6A 1B5PA 1AIBA 2AY2A 4RIZA 3AEMC 1KKPA 4WLHA 2W7DA 4R8DA 3W1JA 2ZP7A 4F5GA 3E2ZA 4ZM3A 2W7IA 1DGDA 3DXWA 3TFUA 5F9SA 3AOVA 3I16A 1D7UA 3CQ6A 3FQ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6U A;  2CAN A;  2VMZ A;  2YRR A;  1TOJ A;  3JWB A;  1DGE A;  1IBJ A;  5I92 A;  3NX3 A;  1I29 A;  3P1T A;  1B9I A;  1MDZ A;  1TOG A;  1KMJ A;  2C81 A;  4JEV A;  3FZ8 A;  1W23 A;  2EZ2 A;  5TF5 A;  3NNK A;  3OP7 A;  2EGY A;  2HP1 A;  1O69 A;  2PO3 A;  3MKJ A;  1SFF A;  4GEB A;  3B8X A;  2GSA A;  5JAY A;  4CXQ A;  1O4S A;  3E77 A;  3WX9 A;  2AY9 A;  4ZAH A;  3GSB A;  2W8J A;  2E7J A;  3DR7 A;  3FDD A;  1FG7 A;  2FNI A;  3ELP A;  4B9B A;  4RAE A;  1CZC A;  2EPJ A;  5EIG B;  4LC3 A;  2VIA A;  1BT4 A;  5DB5 A;  2W7E A;  3ACZ A;  4P7Y A;  4FL0 A;  4ZSW A;  4IYO A;  3JW9 A;  4OBU A;  2D64 A;  1WKG A;  3DU4 A;  1ASN A;  3WGC A;  4EU1 A;  1PMO A;  1ASL A;  1FC4 A;  3BWO A;  2C44 A;  5G4I A;  1M32 A;  3FVU A;  5AX8 A;  1LC8 A;  3QI6 A;  3HBX A;  1ECX A;  1I48 A;  1AMS A;  5HDM A;  3HVY A;  2F8J A;  4DGT A;  7AAT A;  3MAF B;  2YHK A;  2HOZ A;  4E3R A;  1ARG A;  2HOX A;  2R0T A;  4EB5 A;  3T32 A;  3DR4 A;  4ADD A;  3EI8 A;  4K2B A;  3D6K A;  1J04 A;  4MKJ A;  1AJR A;  1GD9 A;  1O61 A;  1O62 A;  3WY7 A;  4XJL A;  2ZUK A;  3E2F A;  2WK7 A;  3NU8 A;  4DQ6 A;  3QBO A;  1BJN A;  2CH2 A;  3WGB A;  3AEJ C;  3FSL A;  1SZK A;  2W8W A;  3OKS A;  5EAA A;  5FT6 A;  2W7G A;  3H14 A;  1V72 A;  5BJ4 A;  3HMU A;  2OQX A;  3R4T A;  1LC5 A;  4LNL A;  3UWC A;  3FVX A;  5IWQ A;  4RKD A;  1AHX A;  2VLH A;  4AOA A;  5M4B A;  4WYA A;  4WYF A;  5HHY A;  4BA4 A;  4I8A A;  2BIG A;  2W8T A;  3BCA A;  2R5C B;  1YIY A;  3B46 A;  5G09 A;  2VGU A;  3HDO A;  2Z9W A;  4WB0 B;  3KGW A;  3E6G A;  3N75 A;  4CXR A;  3TFT A;  3NTJ A;  1VEF A;  4W91 A;  1H0C A;  2HP2 A;  3M5U A;  4J8L A;  2E7I A;  4JF0 A;  2VGW A;  3R9A A;  3BCB A;  2D66 A;  1TPL A;  2CIN A;  2V1P A;  3QPG A;  1I41 A;  3RCH B;  2JJF A;  1SVV A;  2X5D A;  1WKH A;  1ASF A;  1QJ5 A;  1S06 A;  2D65 A;  4RJ0 A;  4WB0 A;  4F5F A;  1XI9 A;  4WXB A;  2DGK A;  2ZY4 A;  1WYV A;  2EZ1 A;  2D5Y A;  3CAI A;  4GSA A;  1AIC A;  4RJY A;  1N8P A;  5FT8 A;  2YKU A;  1AKC A;  3WKR A;  3DC1 A;  3EI6 A;  4QGR A;  3K40 A;  4K2M A;  2VI8 A;  3PA9 A;  3RCH A;  2DOU A;  1DKA A;  2O0R A;  3ZRP A;  2O1B A;  2QB2 A;  3GET A;  4E77 A;  4IXZ A;  4WYE A;  4E3Q A;  1BQD A;  3GR9 A;  1ORD A;  4TV7 A;  1D7S A;  1TAS A;  3BV0 A;  1S07 A;  3EI5 A;  3EI7 A;  2JGT A;  4MQQ A;  1OAT A;  1W7M A;  3G0T A;  3TAT A;  1N31 A;  2BIE A;  1B5O A;  3LVM A;  2PB2 A;  3QM2 A;  4GE9 A;  4Q31 A;  1Z7D A;  3ASB A;  1C0N A;  3QGU A;  1ZOD A;  4EFF A;  3DOD A;  2HOY A;  1V2D A;  1ARI A;  3AEL A;  5EFS A;  3RBL A;  5LHA A;  2VIB A;  2YKX A;  1ASD A;  4WXF A;  3JZL A;  3G7Q A;  2WK8 A;  1AY8 A;  1W3U A;  2V0Y A;  3FTB A;  3RQ1 A;  1CS1 A;  1AHG A;  2QA3 A;  3AEM A;  2TPL A;  4KXK A;  4WYG A;  3ZZK A;  1TOK A;  2Z1Z A;  3L44 A;  1S08 A;  3ELE A;  1IX8 A;  4GRX A;  4B98 A;  1UU2 A;  2VMU A;  4BA5 A;  1CQ7 A;  4W8I A;  3WZF A;  1IAX A;  3TCM A;  2QBT A;  3ECD A;  3FFH A;  4U2H A;  1OHV A;  2AY7 A;  1AAM A;  3H7F A;  2BKW A;  2VMQ A;  5G2P A;  4ZDO A;  2W8V A;  2XH1 A;  1YNU A;  2VMR A;  3MC6 C;  2Z9X A;  4N0W A;  4LNM A;  2ZSL A;  1DJU A;  3KKI A;  4L0O A;  3NYU A;  1AMR A;  3P6K A;  4LNJ A;  1JS6 A;  1UU0 A;  2Z9U A;  1AKB A;  4XQ2 A;  3EUC A;  4ZAS A;  1LC7 A;  1UU1 A;  1X0M A;  2ZY5 A;  2YOB A;  2ZYJ A;  2G6W A;  1V2F A;  4PFF A;  2C7T A;  3GJU A;  1WYT B;  4MKK A;  4ATQ A;  3K7Y A;  3GZD C;  2FNU A;  3QN6 A;  3PAA A;  1BS0 A;  3WLX A;  1BJO B;  2DKJ A;  3NYS A;  1PG8 A;  2FM1 A;  3WCO A;  1QIR A;  4LW2 A;  1UKJ A;  2WKA A;  4AZJ A;  3FD0 A;  2YKV A;  1PMM A;  3NU7 A;  1WYT A;  1ASC A;  2W7L A;  4OC9 A;  1EG5 A;  5G0A A;  2CH1 A;  5C6U A;  1AX4 A;  1M0N A;  1AY5 A;  1BQA A;  1BW0 A;  2YRI A;  3FQ8 A;  2D63 A;  4Q75 A;  4AO9 A;  4O6Z A;  3BWN C;  2W7H A;  4Q6R A;  2RFV A;  5EIG A;  1W7L A;  2CB1 A;  4MQP A;  3W1I A;  4R2N A;  2BHX A;  4IW7 A;  1GC3 A;  1AAW A;  1J32 A;  1V2E A;  4ATP A;  3PJ0 A;  4A6R A;  4A0H A;  1Y4I A;  4OBV A;  4JEX A;  1D7R A;  2W8U A;  1ELQ A;  4PIW A;  2AY8 A;  3LY1 A;  4Y0D A;  1CL2 A;  5EAV A;  1C7N A;  3MAF A;  1TOE A;  3KE3 A;  3F9T A;  2JJH A;  4CVQ A;  2ZSM A;  4F4E A;  2VMT A;  2WK9 A;  3N5M A;  4PVF A;  4F5M A;  1RVU A;  2EH6 A;  1JG8 A;  3AEJ A;  4RM1 A;  1AHY A;  5LH9 A;  1GC4 A;  4K2I A;  3DYD A;  1PFF A;  2DGL A;  4ITG A;  2FYF A;  4ZSY A;  1FG3 A;  2GB3 A;  1B9H A;  3JTX A;  3PGY A;  5M49 A;  1ASB A;  1LW5 A;  1BJW A;  3NUI A;  3AOW A;  3K28 A;  3EIA A;  4HF8 A;  3JWA A;  4OT8 A;  4XK1 A;  1TAT A;  4ZDL A;  4DBC A;  1VJO A;  1XEY A;  4JE5 A;  4W1V A;  1ZC9 A;  1X2A A;  4JE5 D;  4UHN A;  1M6S A;  2CJD A;  5EUD A;  3LWS A;  4ADE A;  3DRD A;  1G7X A;  1WST A;  3G8M A;  2VMX A;  3A9Y A;  1S0A A;  1M4N A;  4MY5 A;  4A0R A;  4HVK A;  3L8A A;  4MGR A;  2OAT A;  2OKJ A;  3N0L A;  5EQC A;  2AAT A;  2R5C A;  1ASE A;  4FFC A;  1YJS A;  2NMP A;  1D2F A;  1ZOB A;  3CQ5 A;  3I5T A;  3IHJ A;  4IY7 A;  4LW4 A;  4U1T A;  1MDO A;  2AEV A;  3RI6 A;  1EQB A;  2AY4 A;  1CL1 A;  1ARS A;  3DXV A;  2CFB A;  3FKD A;  2DKB A;  3GZC A;  4BQ0 A;  3FVS A;  5G4J A;  4EB7 A;  2BI9 A;  4ZDP A;  1S09 A;  3B1D A;  1Z3Z A;  2HUF A;  2BYJ A;  4GE4 A;  2BI2 A;  5DX5 A;  1KL2 A;  2D7Y A;  2AY5 A;  3Q8N A;  1MDX A;  3CBF A;  2ZY3 A;  4Q76 A;  1YOO A;  4JEY A;  5FT4 A;  1OHY A;  4WXG A;  1E5F A;  3FZ6 A;  3A9X A;  1CQ6 A;  3PD6 B;  2DGM A;  4WLJ A;  4MSO A;  1CJ0 A;  5E3K A;  4KAM A;  4EMY A;  1AJS B;  3ATH A;  1IX6 A;  3AEO A;  1CZE A;  3ISL A;  2VI9 A;  5DJ9 A;  3NRA A;  3DZZ A;  1AHE A;  3PIU A;  4ZWM A;  2Z67 A;  3PPL A;  3I4J A;  3QHX A;  2CST A;  2Z20 A;  4OTL A;  4OMA A;  1X28 A;  1YJZ A;  1GEW A;  3MAU A;  4JF1 A;  4RKC A;  4AZK A;  5EUE A;  1T3I A;  1AHF A;  1AY4 A;  4WYD A;  1AJS A;  1M0Q A;  4E1O A;  4IX8 A;  1GBN A;  2AEU A;  2BYL A;  4ZWV A;  4M2K A;  4A6T A;  3NDN A;  4M2M A;  1CQ8 A;  1B4X A;  1D7V A;  3RUY A;  1IVR A;  2YCP A;  4PFN A;  1DJ9 A;  1LKC A;  5F8V A;  1I43 A;  3E9K A;  1QJ3 A;  1C7O A;  5FT5 A;  1MGV A;  1ASM A;  2X3L A;  9AAT A;  1KL1 A;  2DR1 A;  1G4V A;  3E2Z B;  1BKG A;  2ZC0 A;  2YCN A;  2XBN A;  3II0 A;  2VMN A;  3BC8 A;  3GWP A;  1C9C A;  2FQ6 A;  5EUN A;  3AEP A;  3USF A;  3F0H A;  2CJH A;  4AO4 A;  2Z61 A;  4XJP A;  4UOY A;  2X5F A;  4P3M A;  4UHO A;  2VMP A;  1AIA A;  1QIS A;  2E7U A;  2GMU A;  2VGZ A;  2D7Z A;  2O7C A;  4UHM A;  3W1H A;  2HOR A;  3EZ1 A;  5J8Q A;  1MAP A;  4R5Z A;  4UQV A;  3VP6 A;  2AY1 A;  3UE8 A;  3EZS A;  1M0P A;  3GZD A;  2W7M A;  2R5E A;  3ZRR A;  3F6T A;  1B8G A;  2EO5 A;  2YKY A;  3NYT A;  1IUG A;  4ADC A;  2QLR A;  1SZU A;  1OXP A;  2VMV A;  3ASA A;  1BJO A;  1SPA A;  1SF2 A;  4IYO B;  1C4K A;  4RLG A;  2QB3 A;  1C7G A;  2BI3 A;  4A72 A;  4A0F A;  5D95 A;  3VOM A;  3BWN A;  3WCN A;  1KKJ A;  2VYC A;  2W7K A;  3A8U X;  4J5U A;  5M4D A;  5M46 A;  3JU7 A;  4NOG A;  2BWN A;  5K8B A;  1TAR A;  1RVY A;  3VAX A;  4Y0H A;  1W7N A;  1U08 A;  2VGV A;  2ZJG A;  1OXO A;  4A00 A;  1SZS A;  4CBS A;  4A0G A;  2ZY2 A;  3B1E A;  2E54 A;  3A2B A;  3PDB B;  4W5K A;  1LW4 A;  3MBB A;  3ZZJ A;  2GQN A;  4F5I A;  3VK2 A;  3B1C A;  3IF2 A;  3FZ7 A;  4JEZ A;  4ADB A;  2ORD A;  3AEN B;  1ASG A;  2AY6 A;  1ELU A;  2BI1 A;  2D61 A;  3KGX A;  1GDE A;  4ZM4 A;  4CBR A;  3BB8 A;  1IJI A;  4AH3 A;  1GC0 A;  1LS3 A;  2QMA A;  1M7Y A;  2PB0 A;  4BMK A;  1YIZ A;  1GEX A;  2OKK A;  3PDB A;  2VMY A;  4Y0I A;  2BWP A;  5E5I A;  4WYC A;  4F5J A;  3FDB A;  1JS3 A;  4XJO A;  3VK4 A;  3CQ4 A;  3FQA A;  4IXS A;  3AEN A;  1MLY A;  4XJM A;  1KMK A;  1DFO A;  2Z1Y A;  1P3W A;  5BJ3 A;  1ART A;  2FN6 A;  2HUU A;  2JG2 A;  3LVL B;  1IX7 A;  2YCT A;  4W1X A;  2X8U A;  1QZ9 A;  1BJ4 A;  1JF9 A;  3MAD A;  3WKS A;  1QIT A;  2AY3 A;  3BCX A;  3PDX A;  3RBF A;  2W7F A;  4W1W A;  1RV3 A;  4WBT A;  3HL2 A;  3AAT A;  1VP4 A;  1RV4 A;  3LV2 A;  4TN4 A;  1ASA A;  3HLM A;  1GC2 A;  4BHD A;  3LG0 A;  1WYU B;  1AKA A;  8AAT A;  2VMO A;  3BS8 A;  3FFR A;  2R2N A;  3MEB A;  4M2J A;  1GEY A;  1WYV B;  2HUI A;  3ZRQ A;  2JJG A;  4MQR A;  3BN1 A;  4JEW A;  5DJ1 A;  4WD2 A;  2BIA A;  1YJY A;  3LVJ A;  2OGE A;  4N0B A;  3FRK A;  3UAK A;  2JIS A;  3COG A;  1LK9 A;  3A9Z A;  4R5F A;  3EIB A;  3VK3 A;  1G7W A;  1WYU A;  4OYT A;  5E4Z A;  4WP0 A;  1AMA A;  2VGT A;  4XAU A;  4H51 A;  4F5L A;  4XEW A;  4RIT A;  2C0R A;  5HXX A;  1IAY A;  1ARH A;  4OCA A;  2VGS A;  4KYO A;  3PD6 A;  2JJE A;  4IXO A;  2GMS A;  4ZLV A;  2W7J A;  4GE7 A;  3NUB A;  1G4X A;  1TOI A;  1EJI A;  3FCR A;  4TMR A;  3HQT A;  4GDY A;  1H1C A;  3TQX A;  3GBX A;  3HT4 A;  2CTZ A;  1QGN A;  2CJG A;  2Q7W A;  3LVK A;  2VMS A;  4F5K A;  3EI9 A;  5G2Q A;  1M0O A;  1OHW A;  1GCK A;  4F5H A;  1MAQ A;  2CY8 A;  1N2T A;  1MLZ A;  2BWO A;  1AMQ A;  5D5S A;  3E2Y A;  2OGA A;  1YAA A;  3AV7 A;  2VLF A;  1DTY A;  1X29 A;  4ISY A;  2VMW A;  1DJE A;  2BI5 A;  2HZP A;  2Z9V A;  4ITX A;  1E5E A;  3MC6 A;  1B5P A;  1AIB A;  2AY2 A;  4RIZ A;  3AEM C;  1KKP A;  4WLH A;  2W7D A;  4R8D A;  3W1J A;  2ZP7 A;  4F5G A;  3E2Z A;  4ZM3 A;  2W7I A;  1DGD A;  3DXW A;  3TFU A;  5F9S A;  3AOV A;  3I16 A;  1D7U A;  3CQ6 A;  3FQ7 A; 
#chains in the Genus database with same CATH topology
 4A6U A;  2CAN A;  2VMZ A;  2YRR A;  1TOJ A;  3JWB A;  1DGE A;  1IBJ A;  5I92 A;  3NX3 A;  1I29 A;  3P1T A;  1B9I A;  1MDZ A;  1TOG A;  1KMJ A;  2C81 A;  4JEV A;  3FZ8 A;  1W23 A;  2EZ2 A;  5TF5 A;  3NNK A;  3OP7 A;  2EGY A;  2HP1 A;  1O69 A;  2PO3 A;  3MKJ A;  1SFF A;  4GEB A;  3B8X A;  2GSA A;  5JAY A;  4CXQ A;  1O4S A;  3E77 A;  3WX9 A;  2AY9 A;  4ZAH A;  3GSB A;  2W8J A;  2E7J A;  3DR7 A;  3FDD A;  1FG7 A;  2FNI A;  3ELP A;  4B9B A;  4RAE A;  1CZC A;  2EPJ A;  5EIG B;  4LC3 A;  2VIA A;  1BT4 A;  5DB5 A;  2W7E A;  3ACZ A;  1KAF A;  4P7Y A;  4FL0 A;  4ZSW A;  4IYO A;  3JW9 A;  4OBU A;  2D64 A;  1WKG A;  3DU4 A;  1ASN A;  3WGC A;  4EU1 A;  1PMO A;  1ASL A;  1FC4 A;  3BWO A;  2C44 A;  5G4I A;  1M32 A;  3FVU A;  5AX8 A;  1LC8 A;  3QI6 A;  3HBX A;  1ECX A;  1I48 A;  1AMS A;  5HDM A;  3HVY A;  2F8J A;  4DGT A;  7AAT A;  3MAF B;  2YHK A;  2HOZ A;  4E3R A;  1ARG A;  2HOX A;  2R0T A;  4EB5 A;  3T32 A;  3DR4 A;  4ADD A;  3EI8 A;  4K2B A;  3D6K A;  1J04 A;  4MKJ A;  1AJR A;  1GD9 A;  1O61 A;  1O62 A;  3WY7 A;  4XJL A;  2ZUK A;  3E2F A;  2WK7 A;  3NU8 A;  4DQ6 A;  3QBO A;  1BJN A;  2CH2 A;  3WGB A;  3AEJ C;  3FSL A;  1SZK A;  2W8W A;  3OKS A;  5EAA A;  5FT6 A;  2W7G A;  3H14 A;  1V72 A;  5BJ4 A;  3HMU A;  2OQX A;  3R4T A;  1LC5 A;  4LNL A;  3UWC A;  3FVX A;  5IWQ A;  4RKD A;  1AHX A;  2VLH A;  4AOA A;  5M4B A;  4WYA A;  4WYF A;  5HHY A;  4BA4 A;  4I8A A;  2BIG A;  2W8T A;  3BCA A;  2R5C B;  1YIY A;  3B46 A;  5G09 A;  2VGU A;  3HDO A;  2Z9W A;  4WB0 B;  3KGW A;  3E6G A;  3N75 A;  4CXR A;  3TFT A;  3NTJ A;  1VEF A;  4W91 A;  1H0C A;  2HP2 A;  3M5U A;  4J8L A;  2E7I A;  4JF0 A;  2VGW A;  3R9A A;  3BCB A;  2D66 A;  1TPL A;  2CIN A;  2V1P A;  3QPG A;  1I41 A;  3RCH B;  2JJF A;  1SVV A;  2X5D A;  1WKH A;  1ASF A;  1QJ5 A;  1S06 A;  2D65 A;  4RJ0 A;  4WB0 A;  4F5F A;  1XI9 A;  4WXB A;  2DGK A;  2ZY4 A;  1WYV A;  2EZ1 A;  2D5Y A;  3CAI A;  4GSA A;  1AIC A;  4RJY A;  1N8P A;  5FT8 A;  2YKU A;  1AKC A;  3WKR A;  3DC1 A;  3EI6 A;  4QGR A;  3K40 A;  4K2M A;  2VI8 A;  3PA9 A;  3RCH A;  2DOU A;  1DKA A;  2O0R A;  3ZRP A;  2O1B A;  2QB2 A;  3GET A;  4E77 A;  4IXZ A;  4WYE A;  4E3Q A;  1BQD A;  3GR9 A;  2QSR A;  1ORD A;  4TV7 A;  1D7S A;  1TAS A;  3BV0 A;  1S07 A;  3EI5 A;  3EI7 A;  2JGT A;  4MQQ A;  1OAT A;  1W7M A;  3G0T A;  3TAT A;  1N31 A;  2BIE A;  1B5O A;  3LVM A;  2PB2 A;  3QM2 A;  4GE9 A;  4Q31 A;  3N7N A;  1Z7D A;  3ASB A;  1C0N A;  3H9X A;  3QGU A;  1ZOD A;  4EFF A;  3DOD A;  2HOY A;  3N4R A;  1V2D A;  1ARI A;  3AEL A;  5EFS A;  3RBL A;  5LHA A;  2VIB A;  2YKX A;  1ASD A;  4WXF A;  3JZL A;  3G7Q A;  2WK8 A;  1AY8 A;  1W3U A;  2V0Y A;  3FTB A;  3RQ1 A;  1CS1 A;  1AHG A;  2QA3 A;  3AEM A;  2TPL A;  4KXK A;  4WYG A;  3ZZK A;  1TOK A;  2Z1Z A;  3L44 A;  1S08 A;  3ELE A;  1IX8 A;  4GRX A;  4B98 A;  1UU2 A;  2VMU A;  4BA5 A;  1CQ7 A;  4W8I A;  3WZF A;  1IAX A;  3TCM A;  2QBT A;  3ECD A;  3FFH A;  4U2H A;  1OHV A;  2AY7 A;  1AAM A;  3H7F A;  2BKW A;  2VMQ A;  5G2P A;  4ZDO A;  2W8V A;  2XH1 A;  1YNU A;  2VMR A;  3MC6 C;  2Z9X A;  4N0W A;  4LNM A;  2ZSL A;  1DJU A;  3KKI A;  4L0O A;  3NYU A;  1AMR A;  3P6K A;  4LNJ A;  1JS6 A;  1UU0 A;  2Z9U A;  1AKB A;  4XQ2 A;  3EUC A;  4ZAS A;  1LC7 A;  1UU1 A;  1X0M A;  2ZY5 A;  2YOB A;  2ZYJ A;  2G6W A;  1V2F A;  4PFF A;  2WB6 A;  2C7T A;  3GJU A;  1WYT B;  4MKK A;  4ATQ A;  3K7Y A;  3GZD C;  2FNU A;  3QN6 A;  3PAA A;  1BS0 A;  3WLX A;  2FKI A;  1BJO B;  2DKJ A;  3NYS A;  1PG8 A;  2FM1 A;  3WCO A;  1QIR A;  4LW2 A;  1UKJ A;  2WKA A;  4AZJ A;  3FD0 A;  2YKV A;  1PMM A;  3NU7 A;  1WYT A;  1ASC A;  2W7L A;  4OC9 A;  1EG5 A;  5G0A A;  2CH1 A;  5C6U A;  1AX4 A;  1M0N A;  1AY5 A;  1BQA A;  1BW0 A;  2YRI A;  3FQ8 A;  2D63 A;  4Q75 A;  4AO9 A;  4O6Z A;  3BWN C;  2W7H A;  4Q6R A;  2RFV A;  5EIG A;  1W7L A;  2CB1 A;  4MQP A;  3W1I A;  4R2N A;  2BHX A;  4IW7 A;  1GC3 A;  1AAW A;  1J32 A;  1V2E A;  4ATP A;  3PJ0 A;  4A6R A;  4A0H A;  1Y4I A;  4OBV A;  4JEX A;  1D7R A;  2W8U A;  1ELQ A;  4PIW A;  2AY8 A;  3LY1 A;  4Y0D A;  1CL2 A;  5EAV A;  1C7N A;  3MAF A;  1TOE A;  3KE3 A;  3F9T A;  2JJH A;  4CVQ A;  2ZSM A;  4F4E A;  2VMT A;  2WK9 A;  3N5M A;  4PVF A;  4F5M A;  1RVU A;  2EH6 A;  1JG8 A;  3AEJ A;  4RM1 A;  1AHY A;  5LH9 A;  1GC4 A;  4K2I A;  3DYD A;  1PFF A;  2DGL A;  4ITG A;  2FYF A;  4ZSY A;  1FG3 A;  2GB3 A;  1B9H A;  3JTX A;  3PGY A;  5M49 A;  1ASB A;  1LW5 A;  1BJW A;  3NUI A;  3AOW A;  3K28 A;  3EIA A;  4HF8 A;  3JWA A;  4OT8 A;  4XK1 A;  1TAT A;  4ZDL A;  4DBC A;  1VJO A;  1XEY A;  4JE5 A;  4W1V A;  1ZC9 A;  1X2A A;  4JE5 D;  4UHN A;  1M6S A;  2CJD A;  5EUD A;  3LWS A;  4ADE A;  3DRD A;  1G7X A;  1WST A;  3G8M A;  2VMX A;  3A9Y A;  1S0A A;  1M4N A;  4MY5 A;  4A0R A;  4HVK A;  3L8A A;  4MGR A;  2OAT A;  2OKJ A;  3N0L A;  5EQC A;  2AAT A;  2R5C A;  1ASE A;  4FFC A;  1YJS A;  2NMP A;  1D2F A;  1ZOB A;  3CQ5 A;  3I5T A;  3IHJ A;  4IY7 A;  4LW4 A;  4U1T A;  1MDO A;  2AEV A;  3RI6 A;  1EQB A;  2AY4 A;  1CL1 A;  1ARS A;  3DXV A;  2CFB A;  3FKD A;  2DKB A;  3GZC A;  4BQ0 A;  3FVS A;  5G4J A;  4EB7 A;  2BI9 A;  4ZDP A;  1S09 A;  3B1D A;  1Z3Z A;  2HUF A;  2BYJ A;  4GE4 A;  2BI2 A;  5DX5 A;  1KL2 A;  2D7Y A;  2AY5 A;  3Q8N A;  3N4X A;  1MDX A;  3CBF A;  2ZY3 A;  4Q76 A;  1YOO A;  4JEY A;  5FT4 A;  1OHY A;  4WXG A;  1E5F A;  3FZ6 A;  3A9X A;  1CQ6 A;  3PD6 B;  2DGM A;  4WLJ A;  4MSO A;  1CJ0 A;  5E3K A;  4KAM A;  4EMY A;  1AJS B;  3ATH A;  1IX6 A;  3AEO A;  1CZE A;  3ISL A;  2VI9 A;  5DJ9 A;  3NRA A;  3DZZ A;  1AHE A;  3PIU A;  4ZWM A;  2Z67 A;  3PPL A;  3I4J A;  3QHX A;  2CST A;  2Z20 A;  4OTL A;  4OMA A;  1X28 A;  1YJZ A;  1GEW A;  3MAU A;  4JF1 A;  4RKC A;  4AZK A;  5EUE A;  1T3I A;  1AHF A;  1AY4 A;  4WYD A;  1AJS A;  1M0Q A;  4E1O A;  4IX8 A;  1GBN A;  2AEU A;  2BYL A;  4ZWV A;  4M2K A;  4A6T A;  3NDN A;  4M2M A;  1CQ8 A;  1B4X A;  1D7V A;  3RUY A;  1IVR A;  2YCP A;  4PFN A;  1DJ9 A;  1LKC A;  5F8V A;  1I43 A;  3E9K A;  1QJ3 A;  1C7O A;  5FT5 A;  1MGV A;  1ASM A;  2X3L A;  9AAT A;  2G7J A;  1KL1 A;  2DR1 A;  1G4V A;  3E2Z B;  1BKG A;  2ZC0 A;  2YCN A;  2XBN A;  3II0 A;  2VMN A;  3BC8 A;  3GWP A;  1C9C A;  2FQ6 A;  5EUN A;  3AEP A;  3USF A;  3F0H A;  2CJH A;  4AO4 A;  2Z61 A;  4XJP A;  4UOY A;  2X5F A;  4H63 Q;  4P3M A;  4UHO A;  2VMP A;  1AIA A;  1QIS A;  2E7U A;  2GMU A;  2KFP A;  2VGZ A;  2D7Z A;  2O7C A;  4UHM A;  3W1H A;  2HOR A;  3EZ1 A;  4K05 A;  5J8Q A;  1MAP A;  4R5Z A;  4UQV A;  3VP6 A;  2AY1 A;  3UE8 A;  3EZS A;  1M0P A;  3GZD A;  2W7M A;  2R5E A;  3ZRR A;  3F6T A;  1B8G A;  2EO5 A;  2YKY A;  3NYT A;  1IUG A;  4ADC A;  2QLR A;  1SZU A;  1OXP A;  2VMV A;  3ASA A;  1BJO A;  1SPA A;  1SF2 A;  4IYO B;  1C4K A;  4RLG A;  2QB3 A;  1C7G A;  2BI3 A;  4A72 A;  4A0F A;  5D95 A;  3VOM A;  3BWN A;  3WCN A;  1KKJ A;  2VYC A;  2W7K A;  3A8U X;  4J5U A;  5M4D A;  5M46 A;  3JU7 A;  4NOG A;  2BWN A;  5K8B A;  1TAR A;  1RVY A;  3VAX A;  4Y0H A;  1W7N A;  1U08 A;  2VGV A;  2ZJG A;  1OXO A;  4A00 A;  1SZS A;  4CBS A;  4A0G A;  2ZY2 A;  3B1E A;  2E54 A;  3A2B A;  3PDB B;  4W5K A;  1LW4 A;  3MBB A;  3ZZJ A;  2GQN A;  4F5I A;  3VK2 A;  3N4S A;  3B1C A;  3IF2 A;  3FZ7 A;  4JEZ A;  4ADB A;  2ORD A;  3AEN B;  1ASG A;  2AY6 A;  1ELU A;  2BI1 A;  2D61 A;  3KGX A;  1GDE A;  4ZM4 A;  4CBR A;  3BB8 A;  2A1V A;  1IJI A;  4AH3 A;  1GC0 A;  1LS3 A;  2QMA A;  1M7Y A;  2PB0 A;  4BMK A;  1YIZ A;  1GEX A;  2OKK A;  3PDB A;  2VMY A;  4Y0I A;  2BWP A;  5E5I A;  4WYC A;  4F5J A;  3FDB A;  1JS3 A;  4XJO A;  3VK4 A;  3CQ4 A;  3FQA A;  4IXS A;  3AEN A;  1MLY A;  4XJM A;  1KMK A;  1DFO A;  2Z1Y A;  1P3W A;  5BJ3 A;  1ART A;  2FN6 A;  2HUU A;  2JG2 A;  3LVL B;  1IX7 A;  2YCT A;  4W1X A;  2X8U A;  1QZ9 A;  1BJ4 A;  1JF9 A;  3MAD A;  3WKS A;  1QIT A;  2AY3 A;  3BCX A;  3PDX A;  3RBF A;  2W7F A;  4W1W A;  1RV3 A;  4WBT A;  3HL2 A;  3AAT A;  1VP4 A;  1RV4 A;  3LV2 A;  4TN4 A;  1ASA A;  3HLM A;  1GC2 A;  4BHD A;  3LG0 A;  1WYU B;  1AKA A;  8AAT A;  2VMO A;  3BS8 A;  3FFR A;  2R2N A;  3MEB A;  4M2J A;  1GEY A;  1WYV B;  2HUI A;  3ZRQ A;  2JJG A;  2EYQ A;  4MQR A;  3BN1 A;  4JEW A;  5DJ1 A;  4WD2 A;  2BIA A;  1YJY A;  3LVJ A;  2OGE A;  4N0B A;  3FRK A;  3UAK A;  2JIS A;  3COG A;  1LK9 A;  3A9Z A;  4R5F A;  3EIB A;  3VK3 A;  1G7W A;  1WYU A;  4OYT A;  5E4Z A;  4WP0 A;  1AMA A;  2VGT A;  4XAU A;  4H51 A;  4F5L A;  4XEW A;  4RIT A;  5KTB A;  2C0R A;  5HXX A;  1IAY A;  1ARH A;  4OCA A;  2VGS A;  4KYO A;  3PD6 A;  2JJE A;  4IXO A;  2GMS A;  4ZLV A;  2W7J A;  4GE7 A;  3NUB A;  1G4X A;  1TOI A;  1EJI A;  3FCR A;  4TMR A;  3HQT A;  4GDY A;  1H1C A;  3TQX A;  3GBX A;  3HT4 A;  2CTZ A;  1QGN A;  2CJG A;  2Q7W A;  3LVK A;  2VMS A;  4F5K A;  3EI9 A;  5G2Q A;  1M0O A;  1OHW A;  1GCK A;  4F5H A;  1MAQ A;  2CY8 A;  1N2T A;  1MLZ A;  2BWO A;  1AMQ A;  5D5S A;  3E2Y A;  2OGA A;  1YAA A;  3AV7 A;  2VLF A;  1DTY A;  1X29 A;  4ISY A;  2VMW A;  1DJE A;  2BI5 A;  2HZP A;  2Z9V A;  4ITX A;  1E5E A;  3MC6 A;  1B5P A;  1AIB A;  2AY2 A;  4RIZ A;  3AEM C;  1KKP A;  4WLH A;  2W7D A;  4R8D A;  3W1J A;  2ZP7 A;  4F5G A;  3E2Z A;  4ZM3 A;  2W7I A;  1DGD A;  3DXW A;  3TFU A;  5F9S A;  3AOV A;  3I16 A;  1D7U A;  3CQ6 A;  3FQ7 A; 
#chains in the Genus database with same CATH homology
 4A6U A;  2CAN A;  2VMZ A;  2YRR A;  1TOJ A;  3JWB A;  1DGE A;  1IBJ A;  5I92 A;  3NX3 A;  1I29 A;  3P1T A;  1B9I A;  1MDZ A;  1TOG A;  1KMJ A;  2C81 A;  4JEV A;  3FZ8 A;  1W23 A;  2EZ2 A;  5TF5 A;  3NNK A;  3OP7 A;  2EGY A;  2HP1 A;  1O69 A;  2PO3 A;  3MKJ A;  1SFF A;  4GEB A;  3B8X A;  2GSA A;  5JAY A;  4CXQ A;  1O4S A;  3E77 A;  3WX9 A;  2AY9 A;  4ZAH A;  3GSB A;  2W8J A;  2E7J A;  3DR7 A;  3FDD A;  1FG7 A;  2FNI A;  3ELP A;  4B9B A;  4RAE A;  1CZC A;  2EPJ A;  5EIG B;  4LC3 A;  2VIA A;  1BT4 A;  5DB5 A;  2W7E A;  3ACZ A;  4P7Y A;  4FL0 A;  4ZSW A;  4IYO A;  3JW9 A;  4OBU A;  2D64 A;  1WKG A;  3DU4 A;  1ASN A;  3WGC A;  4EU1 A;  1PMO A;  1ASL A;  1FC4 A;  3BWO A;  2C44 A;  5G4I A;  1M32 A;  3FVU A;  5AX8 A;  1LC8 A;  3QI6 A;  3HBX A;  1ECX A;  1I48 A;  1AMS A;  5HDM A;  3HVY A;  2F8J A;  4DGT A;  7AAT A;  3MAF B;  2YHK A;  2HOZ A;  4E3R A;  1ARG A;  2HOX A;  2R0T A;  4EB5 A;  3T32 A;  3DR4 A;  4ADD A;  3EI8 A;  4K2B A;  3D6K A;  1J04 A;  4MKJ A;  1AJR A;  1GD9 A;  1O61 A;  1O62 A;  3WY7 A;  4XJL A;  2ZUK A;  3E2F A;  2WK7 A;  3NU8 A;  4DQ6 A;  3QBO A;  1BJN A;  2CH2 A;  3WGB A;  3AEJ C;  3FSL A;  1SZK A;  2W8W A;  3OKS A;  5EAA A;  5FT6 A;  2W7G A;  3H14 A;  1V72 A;  5BJ4 A;  3HMU A;  2OQX A;  3R4T A;  1LC5 A;  4LNL A;  3UWC A;  3FVX A;  5IWQ A;  4RKD A;  1AHX A;  2VLH A;  4AOA A;  5M4B A;  4WYA A;  4WYF A;  5HHY A;  4BA4 A;  4I8A A;  2BIG A;  2W8T A;  3BCA A;  2R5C B;  1YIY A;  3B46 A;  5G09 A;  2VGU A;  3HDO A;  2Z9W A;  4WB0 B;  3KGW A;  3E6G A;  3N75 A;  4CXR A;  3TFT A;  3NTJ A;  1VEF A;  4W91 A;  1H0C A;  2HP2 A;  3M5U A;  4J8L A;  2E7I A;  4JF0 A;  2VGW A;  3R9A A;  3BCB A;  2D66 A;  1TPL A;  2CIN A;  2V1P A;  3QPG A;  1I41 A;  3RCH B;  2JJF A;  1SVV A;  2X5D A;  1WKH A;  1ASF A;  1QJ5 A;  1S06 A;  2D65 A;  4RJ0 A;  4WB0 A;  4F5F A;  1XI9 A;  4WXB A;  2DGK A;  2ZY4 A;  1WYV A;  2EZ1 A;  2D5Y A;  3CAI A;  4GSA A;  1AIC A;  4RJY A;  1N8P A;  5FT8 A;  2YKU A;  1AKC A;  3WKR A;  3DC1 A;  3EI6 A;  4QGR A;  3K40 A;  4K2M A;  2VI8 A;  3PA9 A;  3RCH A;  2DOU A;  1DKA A;  2O0R A;  3ZRP A;  2O1B A;  2QB2 A;  3GET A;  4E77 A;  4IXZ A;  4WYE A;  4E3Q A;  1BQD A;  3GR9 A;  2QSR A;  1ORD A;  4TV7 A;  1D7S A;  1TAS A;  3BV0 A;  1S07 A;  3EI5 A;  3EI7 A;  2JGT A;  4MQQ A;  1OAT A;  1W7M A;  3G0T A;  3TAT A;  1N31 A;  2BIE A;  1B5O A;  3LVM A;  2PB2 A;  3QM2 A;  4GE9 A;  4Q31 A;  3N7N A;  1Z7D A;  3ASB A;  1C0N A;  3H9X A;  3QGU A;  1ZOD A;  4EFF A;  3DOD A;  2HOY A;  3N4R A;  1V2D A;  1ARI A;  3AEL A;  5EFS A;  3RBL A;  5LHA A;  2VIB A;  2YKX A;  1ASD A;  4WXF A;  3JZL A;  3G7Q A;  2WK8 A;  1AY8 A;  1W3U A;  2V0Y A;  3FTB A;  3RQ1 A;  1CS1 A;  1AHG A;  2QA3 A;  3AEM A;  2TPL A;  4KXK A;  4WYG A;  3ZZK A;  1TOK A;  2Z1Z A;  3L44 A;  1S08 A;  3ELE A;  1IX8 A;  4GRX A;  4B98 A;  1UU2 A;  2VMU A;  4BA5 A;  1CQ7 A;  4W8I A;  3WZF A;  1IAX A;  3TCM A;  2QBT A;  3ECD A;  3FFH A;  4U2H A;  1OHV A;  2AY7 A;  1AAM A;  3H7F A;  2BKW A;  2VMQ A;  5G2P A;  4ZDO A;  2W8V A;  2XH1 A;  1YNU A;  2VMR A;  3MC6 C;  2Z9X A;  4N0W A;  4LNM A;  2ZSL A;  1DJU A;  3KKI A;  4L0O A;  3NYU A;  1AMR A;  3P6K A;  4LNJ A;  1JS6 A;  1UU0 A;  2Z9U A;  1AKB A;  4XQ2 A;  3EUC A;  4ZAS A;  1LC7 A;  1UU1 A;  1X0M A;  2ZY5 A;  2YOB A;  2ZYJ A;  2G6W A;  1V2F A;  4PFF A;  2WB6 A;  2C7T A;  3GJU A;  1WYT B;  4MKK A;  4ATQ A;  3K7Y A;  3GZD C;  2FNU A;  3QN6 A;  3PAA A;  1BS0 A;  3WLX A;  2FKI A;  1BJO B;  2DKJ A;  3NYS A;  1PG8 A;  2FM1 A;  3WCO A;  1QIR A;  4LW2 A;  1UKJ A;  2WKA A;  4AZJ A;  3FD0 A;  2YKV A;  1PMM A;  3NU7 A;  1WYT A;  1ASC A;  2W7L A;  4OC9 A;  1EG5 A;  5G0A A;  2CH1 A;  5C6U A;  1AX4 A;  1M0N A;  1AY5 A;  1BQA A;  1BW0 A;  2YRI A;  3FQ8 A;  2D63 A;  4Q75 A;  4AO9 A;  4O6Z A;  3BWN C;  2W7H A;  4Q6R A;  2RFV A;  5EIG A;  1W7L A;  2CB1 A;  4MQP A;  3W1I A;  4R2N A;  2BHX A;  4IW7 A;  1GC3 A;  1AAW A;  1J32 A;  1V2E A;  4ATP A;  3PJ0 A;  4A6R A;  4A0H A;  1Y4I A;  4OBV A;  4JEX A;  1D7R A;  2W8U A;  1ELQ A;  4PIW A;  2AY8 A;  3LY1 A;  4Y0D A;  1CL2 A;  5EAV A;  1C7N A;  3MAF A;  1TOE A;  3KE3 A;  3F9T A;  2JJH A;  4CVQ A;  2ZSM A;  4F4E A;  2VMT A;  2WK9 A;  3N5M A;  4PVF A;  4F5M A;  1RVU A;  2EH6 A;  1JG8 A;  3AEJ A;  4RM1 A;  1AHY A;  5LH9 A;  1GC4 A;  4K2I A;  3DYD A;  1PFF A;  2DGL A;  4ITG A;  2FYF A;  4ZSY A;  1FG3 A;  2GB3 A;  1B9H A;  3JTX A;  3PGY A;  5M49 A;  1ASB A;  1LW5 A;  1BJW A;  3NUI A;  3AOW A;  3K28 A;  3EIA A;  4HF8 A;  3JWA A;  4OT8 A;  4XK1 A;  1TAT A;  4ZDL A;  4DBC A;  1VJO A;  1XEY A;  4JE5 A;  4W1V A;  1ZC9 A;  1X2A A;  4JE5 D;  4UHN A;  1M6S A;  2CJD A;  5EUD A;  3LWS A;  4ADE A;  3DRD A;  1G7X A;  1WST A;  3G8M A;  2VMX A;  3A9Y A;  1S0A A;  1M4N A;  4MY5 A;  4A0R A;  4HVK A;  3L8A A;  4MGR A;  2OAT A;  2OKJ A;  3N0L A;  5EQC A;  2AAT A;  2R5C A;  1ASE A;  4FFC A;  1YJS A;  2NMP A;  1D2F A;  1ZOB A;  3CQ5 A;  3I5T A;  3IHJ A;  4IY7 A;  4LW4 A;  4U1T A;  1MDO A;  2AEV A;  3RI6 A;  1EQB A;  2AY4 A;  1CL1 A;  1ARS A;  3DXV A;  2CFB A;  3FKD A;  2DKB A;  3GZC A;  4BQ0 A;  3FVS A;  5G4J A;  4EB7 A;  2BI9 A;  4ZDP A;  1S09 A;  3B1D A;  1Z3Z A;  2HUF A;  2BYJ A;  4GE4 A;  2BI2 A;  5DX5 A;  1KL2 A;  2D7Y A;  2AY5 A;  3Q8N A;  3N4X A;  1MDX A;  3CBF A;  2ZY3 A;  4Q76 A;  1YOO A;  4JEY A;  5FT4 A;  1OHY A;  4WXG A;  1E5F A;  3FZ6 A;  3A9X A;  1CQ6 A;  3PD6 B;  2DGM A;  4WLJ A;  4MSO A;  1CJ0 A;  5E3K A;  4KAM A;  4EMY A;  1AJS B;  3ATH A;  1IX6 A;  3AEO A;  1CZE A;  3ISL A;  2VI9 A;  5DJ9 A;  3NRA A;  3DZZ A;  1AHE A;  3PIU A;  4ZWM A;  2Z67 A;  3PPL A;  3I4J A;  3QHX A;  2CST A;  2Z20 A;  4OTL A;  4OMA A;  1X28 A;  1YJZ A;  1GEW A;  3MAU A;  4JF1 A;  4RKC A;  4AZK A;  5EUE A;  1T3I A;  1AHF A;  1AY4 A;  4WYD A;  1AJS A;  1M0Q A;  4E1O A;  4IX8 A;  1GBN A;  2AEU A;  2BYL A;  4ZWV A;  4M2K A;  4A6T A;  3NDN A;  4M2M A;  1CQ8 A;  1B4X A;  1D7V A;  3RUY A;  1IVR A;  2YCP A;  4PFN A;  1DJ9 A;  1LKC A;  5F8V A;  1I43 A;  3E9K A;  1QJ3 A;  1C7O A;  5FT5 A;  1MGV A;  1ASM A;  2X3L A;  9AAT A;  2G7J A;  1KL1 A;  2DR1 A;  1G4V A;  3E2Z B;  1BKG A;  2ZC0 A;  2YCN A;  2XBN A;  3II0 A;  2VMN A;  3BC8 A;  3GWP A;  1C9C A;  2FQ6 A;  5EUN A;  3AEP A;  3USF A;  3F0H A;  2CJH A;  4AO4 A;  2Z61 A;  4XJP A;  4UOY A;  2X5F A;  4H63 Q;  4P3M A;  4UHO A;  2VMP A;  1AIA A;  1QIS A;  2E7U A;  2GMU A;  2KFP A;  2VGZ A;  2D7Z A;  2O7C A;  4UHM A;  3W1H A;  2HOR A;  3EZ1 A;  4K05 A;  5J8Q A;  1MAP A;  4R5Z A;  4UQV A;  3VP6 A;  2AY1 A;  3UE8 A;  3EZS A;  1M0P A;  3GZD A;  2W7M A;  2R5E A;  3ZRR A;  3F6T A;  1B8G A;  2EO5 A;  2YKY A;  3NYT A;  1IUG A;  4ADC A;  2QLR A;  1SZU A;  1OXP A;  2VMV A;  3ASA A;  1BJO A;  1SPA A;  1SF2 A;  4IYO B;  1C4K A;  4RLG A;  2QB3 A;  1C7G A;  2BI3 A;  4A72 A;  4A0F A;  5D95 A;  3VOM A;  3BWN A;  3WCN A;  1KKJ A;  2VYC A;  2W7K A;  3A8U X;  4J5U A;  5M4D A;  5M46 A;  3JU7 A;  4NOG A;  2BWN A;  5K8B A;  1TAR A;  1RVY A;  3VAX A;  4Y0H A;  1W7N A;  1U08 A;  2VGV A;  2ZJG A;  1OXO A;  4A00 A;  1SZS A;  4CBS A;  4A0G A;  2ZY2 A;  3B1E A;  2E54 A;  3A2B A;  3PDB B;  4W5K A;  1LW4 A;  3MBB A;  3ZZJ A;  2GQN A;  4F5I A;  3VK2 A;  3N4S A;  3B1C A;  3IF2 A;  3FZ7 A;  4JEZ A;  4ADB A;  2ORD A;  3AEN B;  1ASG A;  2AY6 A;  1ELU A;  2BI1 A;  2D61 A;  3KGX A;  1GDE A;  4ZM4 A;  4CBR A;  3BB8 A;  2A1V A;  1IJI A;  4AH3 A;  1GC0 A;  1LS3 A;  2QMA A;  1M7Y A;  2PB0 A;  4BMK A;  1YIZ A;  1GEX A;  2OKK A;  3PDB A;  2VMY A;  4Y0I A;  2BWP A;  5E5I A;  4WYC A;  4F5J A;  3FDB A;  1JS3 A;  4XJO A;  3VK4 A;  3CQ4 A;  3FQA A;  4IXS A;  3AEN A;  1MLY A;  4XJM A;  1KMK A;  1DFO A;  2Z1Y A;  1P3W A;  5BJ3 A;  1ART A;  2FN6 A;  2HUU A;  2JG2 A;  3LVL B;  1IX7 A;  2YCT A;  4W1X A;  2X8U A;  1QZ9 A;  1BJ4 A;  1JF9 A;  3MAD A;  3WKS A;  1QIT A;  2AY3 A;  3BCX A;  3PDX A;  3RBF A;  2W7F A;  4W1W A;  1RV3 A;  4WBT A;  3HL2 A;  3AAT A;  1VP4 A;  1RV4 A;  3LV2 A;  4TN4 A;  1ASA A;  3HLM A;  1GC2 A;  4BHD A;  3LG0 A;  1WYU B;  1AKA A;  8AAT A;  2VMO A;  3BS8 A;  3FFR A;  2R2N A;  3MEB A;  4M2J A;  1GEY A;  1WYV B;  2HUI A;  3ZRQ A;  2JJG A;  2EYQ A;  4MQR A;  3BN1 A;  4JEW A;  5DJ1 A;  4WD2 A;  2BIA A;  1YJY A;  3LVJ A;  2OGE A;  4N0B A;  3FRK A;  3UAK A;  2JIS A;  3COG A;  1LK9 A;  3A9Z A;  4R5F A;  3EIB A;  3VK3 A;  1G7W A;  1WYU A;  4OYT A;  5E4Z A;  4WP0 A;  1AMA A;  2VGT A;  4XAU A;  4H51 A;  4F5L A;  4XEW A;  4RIT A;  5KTB A;  2C0R A;  5HXX A;  1IAY A;  1ARH A;  4OCA A;  2VGS A;  4KYO A;  3PD6 A;  2JJE A;  4IXO A;  2GMS A;  4ZLV A;  2W7J A;  4GE7 A;  3NUB A;  1G4X A;  1TOI A;  1EJI A;  3FCR A;  4TMR A;  3HQT A;  4GDY A;  1H1C A;  3TQX A;  3GBX A;  3HT4 A;  2CTZ A;  1QGN A;  2CJG A;  2Q7W A;  3LVK A;  2VMS A;  4F5K A;  3EI9 A;  5G2Q A;  1M0O A;  1OHW A;  1GCK A;  4F5H A;  1MAQ A;  2CY8 A;  1N2T A;  1MLZ A;  2BWO A;  1AMQ A;  5D5S A;  3E2Y A;  2OGA A;  1YAA A;  3AV7 A;  2VLF A;  1DTY A;  1X29 A;  4ISY A;  2VMW A;  1DJE A;  2BI5 A;  2HZP A;  2Z9V A;  4ITX A;  1E5E A;  3MC6 A;  1B5P A;  1AIB A;  2AY2 A;  4RIZ A;  3AEM C;  1KKP A;  4WLH A;  2W7D A;  4R8D A;  3W1J A;  2ZP7 A;  4F5G A;  3E2Z A;  4ZM3 A;  2W7I A;  1DGD A;  3DXW A;  3TFU A;  5F9S A;  3AOV A;  3I16 A;  1D7U A;  3CQ6 A;  3FQ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...