1ASFA

The structural basis for the reduced activity of the y226f(y225f) active site mutant of e. coli aspartate aminotransferase
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
396
structure length
396
Chain Sequence
MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAFQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structural Basis for the Reduced Activity of the Y226F(Y225F) Active Site Mutant of E. Coli Aspartate Aminotransferase
rcsb
source organism Escherichia coli
molecule tags Aminotransferase
molecule keywords ASPARTATE AMINOTRANSFERASE
total genus 116
structure length 396
sequence length 396
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1993-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1asfA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1asfA01
1PFFA 3FDDA 2AATA 1GEXA 4BQ0A 2FYFA 4W1XA 1KL1A 2CJHA 1ASLA 1SPAA 3KE3A 3NUIA 2AY5A 4ZWVA 2DOUA 4MKKA 1S08A 3VP6A 5G4IA 1M6SA 2FM1A 1U08A 3W1HA 2AY4A 3BN1A 3GZDC 3DODA 5F9SA 9AATA 4XJOA 2ZY2A 1VJOA 5DB5A 4CBSA 3NUBA 1CZEA 1S0AA 2Z1YA 3R9AA 3VK3A 4WXBA 3HBXA 4EU1A 1WSTA 1D7SA 3BS8A 2VMOA 3FVSA 3ISLA 5EAAA 3RBFA 3VAXA 1DJ9A 5EIGA 2CJGA 4A6RA 1ASGA 1TOKA 3DRDA 1X2AA 4MY5A 5I92A 3FSLA 3T32A 2VGWA 2Z9XA 4WYEA 1MDZA 2HUUA 2W8VA 3F6TA 2W7KA 1S06A 3RCHA 3TQXA 1X0MA 1ASAA 1KMJA 3E2YA 3TATA 1MDOA 4MQRA 4WYDA 4WYFA 1SZUA 1EQBA 2BI9A 3MBBA 1TATA 4NOGA 4JEWA 5EFSA 1SVVA 1BJNA 3BC8A 2HUIA 3N75A 4MQQA 1IX7A 2HP2A 2W8WA 4WYAA 1W7LA 2D66A 3CQ6A 4W91A 4RITA 4JEZA 5HDMA 3LVLB 2CH2A 3QHXA 1N2TA 2GB3A 2YKUA 1CL2A 2Z67A 4M2JA 5G2QA 1KMKA 4RIZA 2YCPA 5DX5A 4OMAA 1G7XA 2ZSLA 3DXWA 3BCXA 4UHOA 4XJMA 2CY8A 1EJIA 3G8MA 4K2MA 3WKRA 1BT4A 4ITXA 3EIAA 1I29A 2BI2A 3FTBA 1AMSA 1QISA 2FQ6A 3HT4A 3DU4A 3GR9A 1J04A 4R8DA 3JU7A 4LC3A 4XJLA 3PA9A 1BJ4A 2HP1A 3BV0A 4AOAA 2FNIA 4JE5A 4A0HA 1O4SA 2Z9UA 3LV2A 2Z9VA 2O0RA 3ZRPA 2BWNA 4WYCA 2O7CA 4WXGA 4W1VA 2YRIA 3PPLA 4EFFA 3NTJA 3FRKA 1AKCA 3FVUA 2QLRA 3GZCA 3PD6A 3MC6C 4Q75A 4GEBA 2W8JA 2AEUA 1CS1A 1JS6A 5EQCA 5E5IA 1D7VA 2C81A 2E54A 3WKSA 1B9IA 1VP4A 3FDBA 1IAXA 2BYLA 5M46A 1QIRA 3DR7A 1KL2A 3FZ8A 3RI6A 3NDNA 3B1DA 2ZP7A 1B4XA 4LNLA 1AHGA 3N0LA 1C7GA 1GBNA 5JAYA 1AY8A 4JEVA 2BWOA 3AOVA 3WGBA 2OQXA 1AHEA 3BWNC 4TV7A 3PIUA 4JE5D 1ZC9A 2XBNA 4IXOA 4MGRA 1OHYA 1ASEA 2D65A 2E7JA 1ASDA 2D7ZA 1WYUB 2W7IA 5EAVA 4KAMA 4ZLVA 2AY2A 4LW4A 4AH3A 2W7FA 5C6UA 3PD6B 2VGZA 3FQAA 1JF9A 4WB0A 4JEYA 3OKSA 2AEVA 3MAFB 2NMPA 4F5MA 3AEOA 3EUCA 1DGDA 5BJ4A 2VMQA 2R5CB 2VMTA 2VMYA 3TFUA 2VIAA 4PFNA 5FT6A 3RQ1A 4DQ6A 4ADEA 2Z1ZA 3EI5A 2OKKA 4J8LA 2VGVA 3P6KA 5M4DA 2JJFA 1AKBA 4LNJA 4ZASA 1PG8A 2DGKA 1X28A 1UU2A 2VGUA 1JS3A 2ZY3A 1D2FA 1BQDA 1ELQA 4W1WA 4RJYA 3N5MA 4FL0A 4WLJA 1BJWA 1LKCA 3BWOA 1H1CA 5TF5A 4F5IA 3KKIA 4OYTA 2XH1A 3CBFA 2VYCA 3B8XA 1ASFA 1ASCA 2EPJA 1Y4IA 1YAAA 4Q76A 3ATHA 1ARTA 4XQ2A 1CJ0A 1AIBA 1RVYA 2RFVA 3COGA 2BWPA 2FNUA 3EZSA 1XEYA 3G0TA 3AATA 1TOJA 4OT8A 4F5JA 2ORDA 1IVRA 3ASBA 3FKDA 3WLXA 4N0WA 4U1TA 3ZRQA 3FZ7A 2QB2A 2JISA 3PDBA 4XK1A 1QJ3A 2EH6A 1Z7DA 1YJSA 3AENA 2D7YA 3AENB 3JTXA 3Q8NA 1M0QA 3QM2A 4IW7A 4ZDOA 2HOZA 3ZZKA 3WZFA 3ZRRA 3H7FA 1YJZA 2PO3A 3AEJA 1AKAA 4B9BA 4BHDA 2BIAA 3NYUA 1KKJA 4L0OA 4RM1A 3UE8A 2QMAA 1FG3A 1GC2A 2DR1A 1ARGA 1W23A 1WYUA 3EZ1A 2X5FA 1AMAA 3GETA 1CQ6A 1AJRA 1I41A 3PDXA 3DC1A 3EI7A 1IAYA 3FVXA 3BB8A 3A2BA 1C9CA 1SFFA 4BA5A 1AY4A 3II0A 5FT5A 4IXSA 4IY7A 4E3RA 4F5KA 4M2MA 2R5CA 4A6TA 4WXFA 1YNUA 1MGVA 1ASNA 1MLZA 4QGRA 3F9TA 3HLMA 3OP7A 1MAPA 1VEFA 3NX3A 2YCTA 1OXPA 1D7RA 4R5ZA 3MEBA 1AY5A 3WY7A 4CBRA 3IF2A 2D64A 2VLFA 1YIYA 3EIBA 2D5YA 2HORA 1Z3ZA 2EGYA 3P1TA 4UHNA 4E1OA 4ISYA 1V2FA 4HF8A 4PVFA 1TPLA 4PFFA 3L8AA 1B8GA 1DTYA 1UKJA 4Y0HA 2QBTA 2W7HA 4MKJA 2GSAA 4WB0B 5HHYA 1GCKA 2W8UA 4BMKA 2X3LA 2HOXA 1I48A 1AX4A 1LC5A 4WLHA 4FFCA 2VMUA 3A9YA 2V0YA 3JZLA 4E77A 3HQTA 3TCMA 3GJUA 1N31A 1FG7A 2JJGA 4JF0A 3FZ6A 1MAQA 2E7IA 1SZSA 3B1CA 2AY1A 4IXZA 3NU8A 1DJEA 1AHXA 4Y0DA 1BW0A 4OBUA 2D63A 2ZSMA 3ACZA 1WYVB 1N8PA 1TARA 1G7WA 1GC3A 2ZC0A 3EI8A 3JW9A 3L44A 1ARSA 1UU1A 3PJ0A 4HVKA 1GC4A 3LVJA 1DGEA 1LW5A 3BCAA 1AAWA 5E4ZA 8AATA 2GMSA 2WK7A 1M4NA 2W8TA 2QB3A 2X8UA 3MC6A 4AO9A 4DGTA 3DYDA 3HDOA 3NNKA 5BJ3A 1TASA 2YKVA 3H14A 4JEXA 1QGNA 5G2PA 2JGTA 1DKAA 2V1PA 1E5EA 1MDXA 3NYSA 2VGSA 4RAEA 4F5LA 1IUGA 3CQ4A 5DJ9A 4F4EA 3CQ5A 2W7DA 2ZYJA 3PGYA 4OCAA 3RUYA 2W7EA 3A9ZA 3E77A 1E5FA 1CL1A 1LS3A 4LW2A 1GC0A 4ATPA 5M49A 3G7QA 1CQ8A 2VMXA 1LC7A 3E6GA 2DGMA 2BHXA 2FN6A 3E9KA 2VMPA 3B46A 5J8QA 2AY8A 2W7LA 2C7TA 4ZWMA 5AX8A 2D61A 1C4KA 1M0PA 3IHJA 4CXQA 1MLYA 3RCHB 4F5HA 4RKCA 1ZOBA 4ZDLA 4AZKA 1DJUA 1O69A 4EMYA 3NU7A 1C7NA 3M5UA 3W1IA 2WK8A 4AZJA 2JJHA 1AICA 3GZDA 3UWCA 4CXRA 3JWBA 4ZAHA 1AMQA 3NYTA 1ECXA 4KYOA 4ATQA 2VMVA 2E7UA 1IBJA 1RV3A 4ITGA 2BKWA 4P7YA 2OKJA 2YCNA 3FCRA 4N0BA 1X29A 3EI6A 4U2HA 4O6ZA 2W7MA 2CINA 2HUFA 3JWAA 1RVUA 3I5TA 3AEJC 5IWQA 2AY3A 2AY6A 2AY7A 2DKJA 1C0NA 3HMUA 5EUDA 4WP0A 4GE7A 1WKHA 1ASBA 4TMRA 2WK9A 1BQAA 1OXOA 2JG2A 1AHYA 4ZSYA 2VIBA 1IX6A 1CZCA 4XAUA 3ELEA 3A9XA 2OATA 1W7NA 3B1EA 2Z9WA 1ZODA 1LW4A 4IX8A 4ZM3A 4M2KA 3TFTA 3AEPA 1M7YA 3AEMC 2OGEA 2BI1A 4OBVA 4WBTA 4A6UA 4XEWA 1GD9A 3FFHA 5LH9A 1B5PA 3F0HA 3CAIA 3FQ7A 1AAMA 1GDEA 2VI9A 3K7YA 5G4JA 1SZKA 1XI9A 4IYOB 4ZSWA 1O61A 4IYOA 2BIEA 4KXKA 5G0AA 2VI8A 3KGXA 1EG5A 3LVMA 1IX8A 3WCOA 2ZUKA 1O62A 3UAKA 1DFOA 1ORDA 3NRAA 3QPGA 2R2NA 1PMOA 3LY1A 4A0GA 2PB0A 2VMRA 3ZZJA 1TOEA 1G4XA 3EI9A 2TPLA 4GE4A 4I8AA 1LC8A 3W1JA 2QA3A 2X5DA 3QN6A 2CB1A 2Z20A 3E2ZA 3FQ8A 4J5UA 4TN4A 4UHMA 2W7JA 3E2ZB 1M0OA 3I4JA 4B98A 1QJ5A 2EZ1A 5FT4A 5G09A 4A72A 1C7OA 3I16A 4E3QA 3FFRA 2DKBA 2CJDA 4GRXA 2Z61A 3PAAA 1TOIA 4RJ0A 1V2EA 2DGLA 2CH1A 3MAFA 3K28A 2Q7WA 5D5SA 4RKDA 5E3KA 1W7MA 4ADDA 1S07A 5EUNA 1GEYA 2ZY5A 4W8IA 3BWNA 4LNMA 3WCNA 4K2BA 1WYTB 2ZJGA 4Q6RA 2GQNA 1PMMA 4GSAA 5FT8A 3VK2A 5HXXA 1OHWA 1QZ9A 1AMRA 3DZZA 2YKXA 2VGTA 3VK4A 2VLHA 4EB5A 4ADCA 2BIGA 4PIWA 4GDYA 2O1BA 2BYJA 1OATA 5EIGB 3HVYA 1BJOA 2CANA 2HZPA 2C44A 5EUEA 4MQPA 4OTLA 1WKGA 1UU0A 4MSOA 2VMWA 2JJEA 3K40A 1AIAA 1M0NA 4UOYA 1T3IA 1V2DA 2YKYA 4BA4A 4F5FA 4XJPA 2VMNA 2VMZA 3MKJA 1V72A 3ELPA 3FD0A 3HL2A 3MADA 1WYTA 5D95A 1D7UA 1AJSA 1FC4A 2G6WA 2YOBA 2BI3A 2R5EA 1ARIA 3A8UX 1LK9A 1YOOA 4ADBA 1IJIA 4WD2A 4P3MA 3AOWA 4A0RA 1J32A 4OC9A 1YJYA 2AY9A 3DR4A 3AEMA 1B9HA 2HOYA 3LVKA 4GE9A 7AATA 2OGAA 3GSBA 1JG8A 4CVQA 2BI5A 3WX9A 4RLGA 1I43A 3BCBA 4DBCA 1QITA 1ARHA 1BS0A 3DXVA 3AV7A 1BKGA 2WKAA 3QBOA 1GEWA 3QI6A 1AHFA 3AELA 1H0CA 3KGWA 5DJ1A 2ZY4A 3USFA 2CFBA 3WGCA 1S09A 3LWSA 3GWPA 1RV4A 4K2IA 4AO4A 4W5KA 2CSTA 2GMUA 3ASAA 2PB2A 3ECDA 1AJSB 2R0TA 3GBXA 4WYGA 2EZ2A 1ASMA 4R2NA 4A0FA 3MAUA 5M4BA 1SF2A 3QGUA 1M32A 4EB7A 1TOGA 2F8JA 1B5OA 3RBLA 2C0RA 4R5FA 1OHVA 4A00A 1CQ7A 2W7GA 4ZM4A 4ZDPA 2CTZA 5LHAA 1ELUA 1KKPA 1P3WA 3PDBB 2YRRA 3VOMA 2VMSA 1WYVA 3D6KA 3LG0A 1BJOB 4F5GA 4Q31A 1G4VA 4Y0IA 3E2FA 3R4TA 4UQVA 1W3UA 5F8VA 4H51A 2EO5A 4JF1A 1YIZA 2YHKA 5K8BA
chains in the Genus database with same CATH superfamily
1PFFA 3FDDA 2AATA 1GEXA 4BQ0A 2FYFA 4W1XA 1KL1A 2CJHA 1ASLA 1SPAA 3KE3A 3NUIA 2AY5A 4ZWVA 2DOUA 4MKKA 1S08A 3VP6A 5G4IA 1M6SA 2FM1A 1U08A 3W1HA 2AY4A 3BN1A 3GZDC 3DODA 5F9SA 9AATA 4XJOA 2ZY2A 1VJOA 5DB5A 4CBSA 3NUBA 1CZEA 1S0AA 2Z1YA 3R9AA 3VK3A 4WXBA 3HBXA 4EU1A 1WSTA 1D7SA 3BS8A 2VMOA 3FVSA 3ISLA 5EAAA 3RBFA 3VAXA 1DJ9A 5EIGA 2CJGA 4A6RA 1ASGA 1TOKA 3DRDA 1X2AA 4MY5A 5I92A 3FSLA 3T32A 2VGWA 2Z9XA 4WYEA 1MDZA 2HUUA 2W8VA 3F6TA 2W7KA 1S06A 3RCHA 3TQXA 1X0MA 1ASAA 1KMJA 3E2YA 3TATA 1MDOA 4MQRA 4WYDA 4WYFA 1SZUA 1EQBA 2BI9A 3MBBA 1TATA 4NOGA 4JEWA 5EFSA 2G7JA 1SVVA 1BJNA 3BC8A 2HUIA 3N75A 4MQQA 1IX7A 2HP2A 2W8WA 4WYAA 3N4RA 1W7LA 2D66A 3CQ6A 4W91A 4RITA 4JEZA 5HDMA 3LVLB 2CH2A 3QHXA 1N2TA 2GB3A 2YKUA 1CL2A 2Z67A 4M2JA 5G2QA 1KMKA 4RIZA 2YCPA 5DX5A 4OMAA 1G7XA 2ZSLA 3DXWA 3BCXA 4UHOA 4XJMA 2CY8A 1EJIA 3G8MA 4K2MA 3WKRA 1BT4A 4ITXA 2QSRA 3EIAA 1I29A 2BI2A 3FTBA 1AMSA 1QISA 2FQ6A 3HT4A 3DU4A 3GR9A 1J04A 4R8DA 3JU7A 4LC3A 4XJLA 3PA9A 1BJ4A 2HP1A 3BV0A 4AOAA 2FNIA 4JE5A 4A0HA 1O4SA 2Z9UA 3LV2A 2Z9VA 2O0RA 3ZRPA 2BWNA 4WYCA 2O7CA 4WXGA 4W1VA 2YRIA 3PPLA 4EFFA 3NTJA 2KFPA 1KAFA 3FRKA 1AKCA 3FVUA 2QLRA 3GZCA 3PD6A 3MC6C 4Q75A 4GEBA 2W8JA 2AEUA 1CS1A 1JS6A 5EQCA 5E5IA 1D7VA 2C81A 2E54A 3WKSA 1B9IA 1VP4A 3FDBA 1IAXA 2BYLA 5M46A 1QIRA 3DR7A 1KL2A 3FZ8A 3RI6A 3NDNA 3B1DA 2ZP7A 1B4XA 4LNLA 1AHGA 3N0LA 3N7NA 1C7GA 1GBNA 5JAYA 1AY8A 4JEVA 2BWOA 3AOVA 3WGBA 2OQXA 1AHEA 3BWNC 4TV7A 3PIUA 4JE5D 1ZC9A 2XBNA 4IXOA 4MGRA 1OHYA 1ASEA 2D65A 2E7JA 1ASDA 2D7ZA 1WYUB 2W7IA 5EAVA 4KAMA 4ZLVA 2AY2A 4LW4A 4AH3A 2W7FA 5C6UA 3PD6B 2VGZA 3FQAA 1JF9A 4WB0A 4JEYA 3OKSA 2AEVA 3MAFB 2NMPA 4F5MA 3AEOA 3EUCA 1DGDA 5BJ4A 2VMQA 2R5CB 2VMTA 2VMYA 3TFUA 2VIAA 4PFNA 5FT6A 3RQ1A 4DQ6A 4ADEA 2Z1ZA 3EI5A 2OKKA 4J8LA 2VGVA 3P6KA 5M4DA 2JJFA 1AKBA 4LNJA 4ZASA 1PG8A 2DGKA 1X28A 1UU2A 2VGUA 1JS3A 2ZY3A 1D2FA 1BQDA 1ELQA 4W1WA 4RJYA 3N5MA 2A1VA 4FL0A 4WLJA 1BJWA 1LKCA 3BWOA 1H1CA 5TF5A 4F5IA 3KKIA 4OYTA 2XH1A 3CBFA 2VYCA 3B8XA 1ASFA 1ASCA 2EPJA 1Y4IA 1YAAA 4Q76A 3ATHA 1ARTA 4XQ2A 1CJ0A 1AIBA 1RVYA 2RFVA 3COGA 2BWPA 2FNUA 3EZSA 1XEYA 3G0TA 3AATA 1TOJA 4OT8A 4F5JA 2ORDA 1IVRA 3ASBA 3FKDA 3WLXA 4N0WA 4U1TA 3ZRQA 3FZ7A 2QB2A 2JISA 3PDBA 4XK1A 1QJ3A 2EH6A 1Z7DA 1YJSA 3AENA 2D7YA 3AENB 3JTXA 3Q8NA 1M0QA 3QM2A 4IW7A 4ZDOA 2HOZA 3ZZKA 3WZFA 3ZRRA 3H7FA 1YJZA 2PO3A 3AEJA 1AKAA 4B9BA 4BHDA 2BIAA 3NYUA 1KKJA 4L0OA 4RM1A 3UE8A 2QMAA 1FG3A 1GC2A 2DR1A 1ARGA 1W23A 1WYUA 3EZ1A 2X5FA 1AMAA 3GETA 1CQ6A 1AJRA 1I41A 3PDXA 3DC1A 3EI7A 1IAYA 3FVXA 3BB8A 3A2BA 1C9CA 1SFFA 4H63Q 4BA5A 1AY4A 3II0A 5FT5A 4IXSA 4IY7A 4E3RA 4F5KA 4M2MA 2R5CA 4A6TA 4WXFA 1YNUA 1MGVA 1ASNA 1MLZA 4QGRA 3F9TA 3HLMA 3OP7A 1MAPA 1VEFA 3NX3A 2YCTA 1OXPA 1D7RA 4R5ZA 3MEBA 1AY5A 3WY7A 4CBRA 3IF2A 2D64A 2VLFA 1YIYA 3EIBA 2D5YA 2HORA 1Z3ZA 2EGYA 3P1TA 4UHNA 4E1OA 4ISYA 1V2FA 4HF8A 4PVFA 1TPLA 4PFFA 3L8AA 1B8GA 1DTYA 1UKJA 4Y0HA 2QBTA 2W7HA 4MKJA 2GSAA 4WB0B 5HHYA 1GCKA 2W8UA 4BMKA 2X3LA 2HOXA 1I48A 1AX4A 1LC5A 4WLHA 4FFCA 2VMUA 3A9YA 2V0YA 3JZLA 4E77A 3HQTA 3TCMA 3GJUA 1N31A 1FG7A 2JJGA 4JF0A 3FZ6A 1MAQA 2E7IA 1SZSA 3B1CA 2AY1A 4IXZA 3NU8A 1DJEA 1AHXA 4Y0DA 1BW0A 4OBUA 2D63A 2ZSMA 3ACZA 1WYVB 1N8PA 1TARA 1G7WA 1GC3A 2ZC0A 3EI8A 3JW9A 3L44A 1ARSA 1UU1A 3PJ0A 4HVKA 1GC4A 3LVJA 1DGEA 1LW5A 3BCAA 1AAWA 5E4ZA 8AATA 2GMSA 2WK7A 1M4NA 2W8TA 2QB3A 2X8UA 3MC6A 4AO9A 4DGTA 3DYDA 3HDOA 3NNKA 5BJ3A 1TASA 2YKVA 3H14A 4JEXA 1QGNA 5G2PA 2JGTA 1DKAA 2V1PA 1E5EA 1MDXA 3NYSA 2VGSA 4RAEA 4F5LA 1IUGA 3CQ4A 5DJ9A 4F4EA 3CQ5A 2W7DA 2ZYJA 3PGYA 4OCAA 3RUYA 2W7EA 3A9ZA 3E77A 1E5FA 1CL1A 1LS3A 4LW2A 1GC0A 4ATPA 5M49A 3G7QA 1CQ8A 2VMXA 1LC7A 3E6GA 2DGMA 2BHXA 2FN6A 3E9KA 2VMPA 3B46A 5J8QA 2AY8A 2W7LA 2C7TA 4ZWMA 5AX8A 2D61A 1C4KA 1M0PA 3IHJA 4CXQA 1MLYA 3RCHB 4F5HA 4RKCA 1ZOBA 4ZDLA 4AZKA 1DJUA 1O69A 4EMYA 3NU7A 1C7NA 3M5UA 3W1IA 2WK8A 4AZJA 2JJHA 1AICA 3GZDA 3UWCA 4CXRA 3JWBA 4ZAHA 1AMQA 3NYTA 1ECXA 4KYOA 4ATQA 2VMVA 2E7UA 1IBJA 1RV3A 4ITGA 2BKWA 4P7YA 2OKJA 2YCNA 3FCRA 4N0BA 1X29A 3EI6A 4U2HA 4O6ZA 2W7MA 2CINA 2HUFA 3JWAA 1RVUA 3I5TA 3AEJC 5IWQA 2AY3A 2AY6A 2AY7A 2DKJA 1C0NA 3HMUA 5EUDA 4WP0A 4GE7A 1WKHA 1ASBA 4TMRA 2WK9A 1BQAA 1OXOA 2JG2A 1AHYA 4ZSYA 3N4XA 2VIBA 1IX6A 1CZCA 4XAUA 3ELEA 3A9XA 2OATA 1W7NA 3B1EA 2Z9WA 1ZODA 1LW4A 4IX8A 4ZM3A 4M2KA 3TFTA 3AEPA 1M7YA 3AEMC 2OGEA 2BI1A 4OBVA 4WBTA 4A6UA 4XEWA 1GD9A 3FFHA 5LH9A 1B5PA 3F0HA 3CAIA 3FQ7A 1AAMA 1GDEA 2VI9A 3K7YA 5G4JA 1SZKA 1XI9A 4IYOB 4ZSWA 1O61A 4IYOA 2BIEA 4KXKA 5G0AA 2VI8A 3KGXA 1EG5A 3LVMA 1IX8A 3WCOA 2ZUKA 1O62A 3UAKA 1DFOA 1ORDA 3NRAA 3QPGA 2R2NA 1PMOA 3LY1A 4A0GA 2PB0A 2VMRA 3ZZJA 1TOEA 1G4XA 3EI9A 2TPLA 4GE4A 4I8AA 1LC8A 3W1JA 2QA3A 2X5DA 3QN6A 2CB1A 2Z20A 3E2ZA 3FQ8A 4J5UA 4TN4A 4UHMA 2W7JA 3E2ZB 1M0OA 3I4JA 4B98A 1QJ5A 2EZ1A 5FT4A 5G09A 4A72A 1C7OA 3I16A 4E3QA 3FFRA 2DKBA 2CJDA 4GRXA 2Z61A 3N4SA 3PAAA 1TOIA 4RJ0A 1V2EA 2DGLA 2CH1A 3MAFA 3K28A 2Q7WA 5D5SA 4RKDA 5E3KA 1W7MA 4ADDA 1S07A 5EUNA 1GEYA 2ZY5A 4W8IA 3BWNA 4LNMA 3WCNA 4K2BA 1WYTB 2ZJGA 4Q6RA 2GQNA 1PMMA 4GSAA 5FT8A 3VK2A 5HXXA 1OHWA 1QZ9A 1AMRA 3DZZA 2YKXA 2VGTA 3VK4A 2VLHA 4EB5A 4ADCA 2BIGA 4PIWA 4GDYA 2O1BA 2EYQA 2BYJA 1OATA 5EIGB 3HVYA 1BJOA 2CANA 2HZPA 2C44A 5EUEA 4MQPA 4OTLA 1WKGA 2FKIA 1UU0A 4MSOA 3H9XA 2VMWA 2JJEA 3K40A 1AIAA 1M0NA 4UOYA 1T3IA 1V2DA 4K05A 2YKYA 4BA4A 4F5FA 4XJPA 2VMNA 2VMZA 3MKJA 1V72A 3ELPA 3FD0A 3HL2A 3MADA 1WYTA 5D95A 1D7UA 1AJSA 1FC4A 2G6WA 2YOBA 2BI3A 2R5EA 2WB6A 1ARIA 3A8UX 1LK9A 1YOOA 4ADBA 1IJIA 4WD2A 4P3MA 3AOWA 4A0RA 1J32A 4OC9A 1YJYA 2AY9A 3DR4A 3AEMA 1B9HA 2HOYA 3LVKA 4GE9A 7AATA 2OGAA 3GSBA 1JG8A 4CVQA 2BI5A 3WX9A 4RLGA 1I43A 3BCBA 4DBCA 1QITA 5KTBA 1ARHA 1BS0A 3DXVA 3AV7A 1BKGA 2WKAA 3QBOA 1GEWA 3QI6A 1AHFA 3AELA 1H0CA 3KGWA 5DJ1A 2ZY4A 3USFA 2CFBA 3WGCA 1S09A 3LWSA 3GWPA 1RV4A 4K2IA 4AO4A 4W5KA 2CSTA 2GMUA 3ASAA 2PB2A 3ECDA 1AJSB 2R0TA 3GBXA 4WYGA 2EZ2A 1ASMA 4R2NA 4A0FA 3MAUA 5M4BA 1SF2A 3QGUA 1M32A 4EB7A 1TOGA 2F8JA 1B5OA 3RBLA 2C0RA 4R5FA 1OHVA 4A00A 1CQ7A 2W7GA 4ZM4A 4ZDPA 2CTZA 5LHAA 1ELUA 1KKPA 1P3WA 3PDBB 2YRRA 3VOMA 2VMSA 1WYVA 3D6KA 3LG0A 1BJOB 4F5GA 4Q31A 1G4VA 4Y0IA 3E2FA 3R4TA 4UQVA 1W3UA 5F8VA 4H51A 2EO5A 4JF1A 1YIZA 2YHKA 5K8BA
chains in the Genus database with same CATH topology
1PFFA 3FDDA 2AATA 1GEXA 4BQ0A 2FYFA 4W1XA 1KL1A 2CJHA 1ASLA 1SPAA 3KE3A 3NUIA 2AY5A 4ZWVA 2DOUA 4MKKA 1S08A 3VP6A 5G4IA 1M6SA 2FM1A 1U08A 3W1HA 2AY4A 3BN1A 3GZDC 3DODA 5F9SA 9AATA 4XJOA 2ZY2A 1VJOA 5DB5A 4CBSA 3NUBA 1CZEA 1S0AA 2Z1YA 3R9AA 3VK3A 4WXBA 3HBXA 4EU1A 1WSTA 1D7SA 3BS8A 2VMOA 3FVSA 3ISLA 5EAAA 3RBFA 3VAXA 1DJ9A 5EIGA 2CJGA 4A6RA 1ASGA 1TOKA 3DRDA 1X2AA 4MY5A 5I92A 3FSLA 3T32A 2VGWA 2Z9XA 4WYEA 1MDZA 2HUUA 2W8VA 3F6TA 2W7KA 1S06A 3RCHA 3TQXA 1X0MA 1ASAA 1KMJA 3E2YA 3TATA 1MDOA 4MQRA 4WYDA 4WYFA 1SZUA 1EQBA 2BI9A 3MBBA 1TATA 4NOGA 4JEWA 5EFSA 2G7JA 1SVVA 1BJNA 3BC8A 2HUIA 3N75A 4MQQA 1IX7A 2HP2A 2W8WA 4WYAA 3N4RA 1W7LA 2D66A 3CQ6A 4W91A 4RITA 4JEZA 5HDMA 3LVLB 2CH2A 3QHXA 1N2TA 2GB3A 2YKUA 1CL2A 2Z67A 4M2JA 5G2QA 1KMKA 4RIZA 2YCPA 5DX5A 4OMAA 1G7XA 2ZSLA 3DXWA 3BCXA 4UHOA 4XJMA 2CY8A 1EJIA 3G8MA 4K2MA 3WKRA 1BT4A 4ITXA 2QSRA 3EIAA 1I29A 2BI2A 3FTBA 1AMSA 1QISA 2FQ6A 3HT4A 3DU4A 3GR9A 1J04A 4R8DA 3JU7A 4LC3A 4XJLA 3PA9A 1BJ4A 2HP1A 3BV0A 4AOAA 2FNIA 4JE5A 4A0HA 1O4SA 2Z9UA 3LV2A 2Z9VA 2O0RA 3ZRPA 2BWNA 4WYCA 2O7CA 4WXGA 4W1VA 2YRIA 3PPLA 4EFFA 3NTJA 2KFPA 3FRKA 1AKCA 3FVUA 2QLRA 3GZCA 3PD6A 3MC6C 4Q75A 4GEBA 2W8JA 2AEUA 1CS1A 1JS6A 5EQCA 5E5IA 1D7VA 2C81A 2E54A 3WKSA 1B9IA 1VP4A 3FDBA 1IAXA 2BYLA 5M46A 1QIRA 3DR7A 1KL2A 3FZ8A 3RI6A 3NDNA 3B1DA 2ZP7A 1B4XA 4LNLA 1AHGA 3N0LA 3N7NA 1C7GA 1GBNA 5JAYA 1AY8A 4JEVA 2BWOA 3AOVA 3WGBA 2OQXA 1AHEA 3BWNC 4TV7A 3PIUA 4JE5D 1ZC9A 2XBNA 4IXOA 4MGRA 1OHYA 1ASEA 2D65A 2E7JA 1ASDA 2D7ZA 1WYUB 2W7IA 5EAVA 4KAMA 4ZLVA 2AY2A 4LW4A 4AH3A 2W7FA 5C6UA 3PD6B 2VGZA 3FQAA 1JF9A 4WB0A 4JEYA 3OKSA 2AEVA 3MAFB 2NMPA 4F5MA 3AEOA 3EUCA 1DGDA 5BJ4A 2VMQA 2R5CB 2VMTA 2VMYA 3TFUA 2VIAA 4PFNA 5FT6A 3RQ1A 4DQ6A 4ADEA 2Z1ZA 3EI5A 2OKKA 4J8LA 2VGVA 3P6KA 5M4DA 2JJFA 1AKBA 4LNJA 4ZASA 1PG8A 2DGKA 1X28A 1UU2A 2VGUA 1JS3A 2ZY3A 1D2FA 1BQDA 1ELQA 4W1WA 4RJYA 3N5MA 2A1VA 4FL0A 4WLJA 1BJWA 1LKCA 3BWOA 1H1CA 5TF5A 4F5IA 3KKIA 4OYTA 2XH1A 3CBFA 2VYCA 3B8XA 1ASFA 1ASCA 2EPJA 1Y4IA 1YAAA 4Q76A 3ATHA 1ARTA 4XQ2A 1CJ0A 1AIBA 1RVYA 2RFVA 3COGA 2BWPA 2FNUA 3EZSA 1XEYA 3G0TA 3AATA 1TOJA 4OT8A 4F5JA 2ORDA 1IVRA 3ASBA 3FKDA 3WLXA 4N0WA 4U1TA 3ZRQA 3FZ7A 2QB2A 2JISA 3PDBA 4XK1A 1QJ3A 2EH6A 1Z7DA 1YJSA 3AENA 2D7YA 3AENB 3JTXA 3Q8NA 1M0QA 3QM2A 4IW7A 4ZDOA 2HOZA 3ZZKA 3WZFA 3ZRRA 3H7FA 1YJZA 2PO3A 3AEJA 1AKAA 4B9BA 4BHDA 2BIAA 3NYUA 1KKJA 4L0OA 4RM1A 3UE8A 2QMAA 1FG3A 1GC2A 2DR1A 1ARGA 1W23A 1WYUA 3EZ1A 2X5FA 1AMAA 3GETA 1CQ6A 1AJRA 1I41A 3PDXA 3DC1A 3EI7A 1IAYA 3FVXA 3BB8A 3A2BA 1C9CA 1SFFA 4H63Q 4BA5A 1AY4A 3II0A 5FT5A 4IXSA 4IY7A 4E3RA 4F5KA 4M2MA 2R5CA 4A6TA 4WXFA 1YNUA 1MGVA 1ASNA 1MLZA 4QGRA 3F9TA 3HLMA 3OP7A 1MAPA 1VEFA 3NX3A 2YCTA 1OXPA 1D7RA 4R5ZA 3MEBA 1AY5A 3WY7A 4CBRA 3IF2A 2D64A 2VLFA 1YIYA 3EIBA 2D5YA 2HORA 1Z3ZA 2EGYA 3P1TA 4UHNA 4E1OA 4ISYA 1V2FA 4HF8A 4PVFA 1TPLA 4PFFA 3L8AA 1B8GA 1DTYA 1UKJA 4Y0HA 2QBTA 2W7HA 4MKJA 2GSAA 4WB0B 5HHYA 1GCKA 2W8UA 4BMKA 2X3LA 2HOXA 1I48A 1AX4A 1LC5A 4WLHA 4FFCA 2VMUA 3A9YA 2V0YA 3JZLA 4E77A 3HQTA 3TCMA 3GJUA 1N31A 1FG7A 2JJGA 4JF0A 3FZ6A 1MAQA 2E7IA 1SZSA 3B1CA 2AY1A 4IXZA 3NU8A 1DJEA 1AHXA 4Y0DA 1BW0A 4OBUA 2D63A 2ZSMA 3ACZA 1WYVB 1N8PA 1TARA 1G7WA 1GC3A 2ZC0A 3EI8A 3JW9A 3L44A 1ARSA 1UU1A 3PJ0A 4HVKA 1GC4A 3LVJA 1DGEA 1LW5A 3BCAA 1AAWA 5E4ZA 8AATA 2GMSA 2WK7A 1M4NA 2W8TA 2QB3A 2X8UA 3MC6A 4AO9A 4DGTA 3DYDA 3HDOA 3NNKA 5BJ3A 1TASA 2YKVA 3H14A 4JEXA 1QGNA 5G2PA 2JGTA 1DKAA 2V1PA 1E5EA 1MDXA 3NYSA 2VGSA 4RAEA 4F5LA 1IUGA 3CQ4A 5DJ9A 4F4EA 3CQ5A 2W7DA 2ZYJA 3PGYA 4OCAA 3RUYA 2W7EA 3A9ZA 3E77A 1E5FA 1CL1A 1LS3A 4LW2A 1GC0A 4ATPA 5M49A 3G7QA 1CQ8A 2VMXA 1LC7A 3E6GA 2DGMA 2BHXA 2FN6A 3E9KA 2VMPA 3B46A 5J8QA 2AY8A 2W7LA 2C7TA 4ZWMA 5AX8A 2D61A 1C4KA 1M0PA 3IHJA 4CXQA 1MLYA 3RCHB 4F5HA 4RKCA 1ZOBA 4ZDLA 4AZKA 1DJUA 1O69A 4EMYA 3NU7A 1C7NA 3M5UA 3W1IA 2WK8A 4AZJA 2JJHA 1AICA 3GZDA 3UWCA 4CXRA 3JWBA 4ZAHA 1AMQA 3NYTA 1ECXA 4KYOA 4ATQA 2VMVA 2E7UA 1IBJA 1RV3A 4ITGA 2BKWA 4P7YA 2OKJA 2YCNA 3FCRA 4N0BA 1X29A 3EI6A 4U2HA 4O6ZA 2W7MA 2CINA 2HUFA 3JWAA 1RVUA 3I5TA 3AEJC 5IWQA 2AY3A 2AY6A 2AY7A 2DKJA 1C0NA 3HMUA 5EUDA 4WP0A 4GE7A 1WKHA 1ASBA 4TMRA 2WK9A 1BQAA 1OXOA 2JG2A 1AHYA 4ZSYA 3N4XA 2VIBA 1IX6A 1CZCA 4XAUA 3ELEA 3A9XA 2OATA 1W7NA 3B1EA 2Z9WA 1ZODA 1LW4A 4IX8A 4ZM3A 4M2KA 3TFTA 3AEPA 1M7YA 3AEMC 2OGEA 2BI1A 4OBVA 4WBTA 4A6UA 4XEWA 1GD9A 3FFHA 5LH9A 1B5PA 3F0HA 3CAIA 3FQ7A 1AAMA 1GDEA 2VI9A 3K7YA 5G4JA 1SZKA 1XI9A 4IYOB 4ZSWA 1O61A 4IYOA 2BIEA 4KXKA 5G0AA 2VI8A 3KGXA 1EG5A 3LVMA 1IX8A 3WCOA 2ZUKA 1O62A 3UAKA 1DFOA 1ORDA 3NRAA 3QPGA 2R2NA 1PMOA 3LY1A 4A0GA 2PB0A 2VMRA 3ZZJA 1TOEA 1G4XA 3EI9A 2TPLA 4GE4A 4I8AA 1LC8A 3W1JA 2QA3A 2X5DA 3QN6A 2CB1A 2Z20A 3E2ZA 3FQ8A 4J5UA 4TN4A 4UHMA 2W7JA 3E2ZB 1M0OA 3I4JA 4B98A 1QJ5A 2EZ1A 5FT4A 5G09A 4A72A 1C7OA 3I16A 4E3QA 3FFRA 2DKBA 2CJDA 4GRXA 2Z61A 3N4SA 3PAAA 1TOIA 4RJ0A 1V2EA 2DGLA 2CH1A 3MAFA 3K28A 2Q7WA 5D5SA 4RKDA 5E3KA 1W7MA 4ADDA 1S07A 5EUNA 1GEYA 2ZY5A 4W8IA 3BWNA 4LNMA 3WCNA 4K2BA 1WYTB 2ZJGA 4Q6RA 2GQNA 1PMMA 4GSAA 5FT8A 3VK2A 5HXXA 1OHWA 1QZ9A 1AMRA 3DZZA 2YKXA 2VGTA 3VK4A 2VLHA 4EB5A 4ADCA 2BIGA 4PIWA 4GDYA 2O1BA 2EYQA 2BYJA 1OATA 5EIGB 3HVYA 1BJOA 2CANA 2HZPA 2C44A 5EUEA 4MQPA 4OTLA 1WKGA 2FKIA 1UU0A 4MSOA 3H9XA 2VMWA 2JJEA 3K40A 1AIAA 1M0NA 4UOYA 1T3IA 1V2DA 4K05A 2YKYA 4BA4A 4F5FA 4XJPA 2VMNA 2VMZA 3MKJA 1V72A 3ELPA 3FD0A 3HL2A 3MADA 1WYTA 5D95A 1D7UA 1AJSA 1FC4A 2G6WA 2YOBA 2BI3A 2R5EA 2WB6A 1ARIA 3A8UX 1LK9A 1YOOA 4ADBA 1IJIA 4WD2A 4P3MA 3AOWA 4A0RA 1J32A 4OC9A 1YJYA 2AY9A 3DR4A 3AEMA 1B9HA 2HOYA 3LVKA 4GE9A 7AATA 2OGAA 3GSBA 1JG8A 4CVQA 2BI5A 3WX9A 4RLGA 1I43A 3BCBA 4DBCA 1QITA 5KTBA 1ARHA 1BS0A 3DXVA 3AV7A 1BKGA 2WKAA 3QBOA 1GEWA 3QI6A 1AHFA 3AELA 1H0CA 3KGWA 5DJ1A 2ZY4A 3USFA 2CFBA 3WGCA 1S09A 3LWSA 3GWPA 1RV4A 4K2IA 4AO4A 4W5KA 2CSTA 2GMUA 3ASAA 2PB2A 3ECDA 1AJSB 2R0TA 3GBXA 4WYGA 2EZ2A 1ASMA 4R2NA 4A0FA 3MAUA 5M4BA 1SF2A 3QGUA 1M32A 4EB7A 1TOGA 2F8JA 1B5OA 3RBLA 2C0RA 4R5FA 1OHVA 4A00A 1CQ7A 2W7GA 4ZM4A 4ZDPA 2CTZA 5LHAA 1ELUA 1KKPA 1P3WA 3PDBB 2YRRA 3VOMA 2VMSA 1WYVA 3D6KA 3LG0A 1BJOB 4F5GA 4Q31A 1G4VA 4Y0IA 3E2FA 3R4TA 4UQVA 1W3UA 5F8VA 4H51A 2EO5A 4JF1A 1YIZA 2YHKA 5K8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFF A;  3FDD A;  2AAT A;  1GEX A;  4BQ0 A;  2FYF A;  4W1X A;  1KL1 A;  2CJH A;  1ASL A;  1SPA A;  3KE3 A;  3NUI A;  2AY5 A;  4ZWV A;  2DOU A;  4MKK A;  1S08 A;  3VP6 A;  5G4I A;  1M6S A;  2FM1 A;  1U08 A;  3W1H A;  2AY4 A;  3BN1 A;  3GZD C;  3DOD A;  5F9S A;  9AAT A;  4XJO A;  2ZY2 A;  1VJO A;  5DB5 A;  4CBS A;  3NUB A;  1CZE A;  1S0A A;  2Z1Y A;  3R9A A;  3VK3 A;  4WXB A;  3HBX A;  4EU1 A;  1WST A;  1D7S A;  3BS8 A;  2VMO A;  3FVS A;  3ISL A;  5EAA A;  3RBF A;  3VAX A;  1DJ9 A;  5EIG A;  2CJG A;  4A6R A;  1ASG A;  1TOK A;  3DRD A;  1X2A A;  4MY5 A;  5I92 A;  3FSL A;  3T32 A;  2VGW A;  2Z9X A;  4WYE A;  1MDZ A;  2HUU A;  2W8V A;  3F6T A;  2W7K A;  1S06 A;  3RCH A;  3TQX A;  1X0M A;  1ASA A;  1KMJ A;  3E2Y A;  3TAT A;  1MDO A;  4MQR A;  4WYD A;  4WYF A;  1SZU A;  1EQB A;  2BI9 A;  3MBB A;  1TAT A;  4NOG A;  4JEW A;  5EFS A;  1SVV A;  1BJN A;  3BC8 A;  2HUI A;  3N75 A;  4MQQ A;  1IX7 A;  2HP2 A;  2W8W A;  4WYA A;  1W7L A;  2D66 A;  3CQ6 A;  4W91 A;  4RIT A;  4JEZ A;  5HDM A;  3LVL B;  2CH2 A;  3QHX A;  1N2T A;  2GB3 A;  2YKU A;  1CL2 A;  2Z67 A;  4M2J A;  5G2Q A;  1KMK A;  4RIZ A;  2YCP A;  5DX5 A;  4OMA A;  1G7X A;  2ZSL A;  3DXW A;  3BCX A;  4UHO A;  4XJM A;  2CY8 A;  1EJI A;  3G8M A;  4K2M A;  3WKR A;  1BT4 A;  4ITX A;  3EIA A;  1I29 A;  2BI2 A;  3FTB A;  1AMS A;  1QIS A;  2FQ6 A;  3HT4 A;  3DU4 A;  3GR9 A;  1J04 A;  4R8D A;  3JU7 A;  4LC3 A;  4XJL A;  3PA9 A;  1BJ4 A;  2HP1 A;  3BV0 A;  4AOA A;  2FNI A;  4JE5 A;  4A0H A;  1O4S A;  2Z9U A;  3LV2 A;  2Z9V A;  2O0R A;  3ZRP A;  2BWN A;  4WYC A;  2O7C A;  4WXG A;  4W1V A;  2YRI A;  3PPL A;  4EFF A;  3NTJ A;  3FRK A;  1AKC A;  3FVU A;  2QLR A;  3GZC A;  3PD6 A;  3MC6 C;  4Q75 A;  4GEB A;  2W8J A;  2AEU A;  1CS1 A;  1JS6 A;  5EQC A;  5E5I A;  1D7V A;  2C81 A;  2E54 A;  3WKS A;  1B9I A;  1VP4 A;  3FDB A;  1IAX A;  2BYL A;  5M46 A;  1QIR A;  3DR7 A;  1KL2 A;  3FZ8 A;  3RI6 A;  3NDN A;  3B1D A;  2ZP7 A;  1B4X A;  4LNL A;  1AHG A;  3N0L A;  1C7G A;  1GBN A;  5JAY A;  1AY8 A;  4JEV A;  2BWO A;  3AOV A;  3WGB A;  2OQX A;  1AHE A;  3BWN C;  4TV7 A;  3PIU A;  4JE5 D;  1ZC9 A;  2XBN A;  4IXO A;  4MGR A;  1OHY A;  1ASE A;  2D65 A;  2E7J A;  1ASD A;  2D7Z A;  1WYU B;  2W7I A;  5EAV A;  4KAM A;  4ZLV A;  2AY2 A;  4LW4 A;  4AH3 A;  2W7F A;  5C6U A;  3PD6 B;  2VGZ A;  3FQA A;  1JF9 A;  4WB0 A;  4JEY A;  3OKS A;  2AEV A;  3MAF B;  2NMP A;  4F5M A;  3AEO A;  3EUC A;  1DGD A;  5BJ4 A;  2VMQ A;  2R5C B;  2VMT A;  2VMY A;  3TFU A;  2VIA A;  4PFN A;  5FT6 A;  3RQ1 A;  4DQ6 A;  4ADE A;  2Z1Z A;  3EI5 A;  2OKK A;  4J8L A;  2VGV A;  3P6K A;  5M4D A;  2JJF A;  1AKB A;  4LNJ A;  4ZAS A;  1PG8 A;  2DGK A;  1X28 A;  1UU2 A;  2VGU A;  1JS3 A;  2ZY3 A;  1D2F A;  1BQD A;  1ELQ A;  4W1W A;  4RJY A;  3N5M A;  4FL0 A;  4WLJ A;  1BJW A;  1LKC A;  3BWO A;  1H1C A;  5TF5 A;  4F5I A;  3KKI A;  4OYT A;  2XH1 A;  3CBF A;  2VYC A;  3B8X A;  1ASF A;  1ASC A;  2EPJ A;  1Y4I A;  1YAA A;  4Q76 A;  3ATH A;  1ART A;  4XQ2 A;  1CJ0 A;  1AIB A;  1RVY A;  2RFV A;  3COG A;  2BWP A;  2FNU A;  3EZS A;  1XEY A;  3G0T A;  3AAT A;  1TOJ A;  4OT8 A;  4F5J A;  2ORD A;  1IVR A;  3ASB A;  3FKD A;  3WLX A;  4N0W A;  4U1T A;  3ZRQ A;  3FZ7 A;  2QB2 A;  2JIS A;  3PDB A;  4XK1 A;  1QJ3 A;  2EH6 A;  1Z7D A;  1YJS A;  3AEN A;  2D7Y A;  3AEN B;  3JTX A;  3Q8N A;  1M0Q A;  3QM2 A;  4IW7 A;  4ZDO A;  2HOZ A;  3ZZK A;  3WZF A;  3ZRR A;  3H7F A;  1YJZ A;  2PO3 A;  3AEJ A;  1AKA A;  4B9B A;  4BHD A;  2BIA A;  3NYU A;  1KKJ A;  4L0O A;  4RM1 A;  3UE8 A;  2QMA A;  1FG3 A;  1GC2 A;  2DR1 A;  1ARG A;  1W23 A;  1WYU A;  3EZ1 A;  2X5F A;  1AMA A;  3GET A;  1CQ6 A;  1AJR A;  1I41 A;  3PDX A;  3DC1 A;  3EI7 A;  1IAY A;  3FVX A;  3BB8 A;  3A2B A;  1C9C A;  1SFF A;  4BA5 A;  1AY4 A;  3II0 A;  5FT5 A;  4IXS A;  4IY7 A;  4E3R A;  4F5K A;  4M2M A;  2R5C A;  4A6T A;  4WXF A;  1YNU A;  1MGV A;  1ASN A;  1MLZ A;  4QGR A;  3F9T A;  3HLM A;  3OP7 A;  1MAP A;  1VEF A;  3NX3 A;  2YCT A;  1OXP A;  1D7R A;  4R5Z A;  3MEB A;  1AY5 A;  3WY7 A;  4CBR A;  3IF2 A;  2D64 A;  2VLF A;  1YIY A;  3EIB A;  2D5Y A;  2HOR A;  1Z3Z A;  2EGY A;  3P1T A;  4UHN A;  4E1O A;  4ISY A;  1V2F A;  4HF8 A;  4PVF A;  1TPL A;  4PFF A;  3L8A A;  1B8G A;  1DTY A;  1UKJ A;  4Y0H A;  2QBT A;  2W7H A;  4MKJ A;  2GSA A;  4WB0 B;  5HHY A;  1GCK A;  2W8U A;  4BMK A;  2X3L A;  2HOX A;  1I48 A;  1AX4 A;  1LC5 A;  4WLH A;  4FFC A;  2VMU A;  3A9Y A;  2V0Y A;  3JZL A;  4E77 A;  3HQT A;  3TCM A;  3GJU A;  1N31 A;  1FG7 A;  2JJG A;  4JF0 A;  3FZ6 A;  1MAQ A;  2E7I A;  1SZS A;  3B1C A;  2AY1 A;  4IXZ A;  3NU8 A;  1DJE A;  1AHX A;  4Y0D A;  1BW0 A;  4OBU A;  2D63 A;  2ZSM A;  3ACZ A;  1WYV B;  1N8P A;  1TAR A;  1G7W A;  1GC3 A;  2ZC0 A;  3EI8 A;  3JW9 A;  3L44 A;  1ARS A;  1UU1 A;  3PJ0 A;  4HVK A;  1GC4 A;  3LVJ A;  1DGE A;  1LW5 A;  3BCA A;  1AAW A;  5E4Z A;  8AAT A;  2GMS A;  2WK7 A;  1M4N A;  2W8T A;  2QB3 A;  2X8U A;  3MC6 A;  4AO9 A;  4DGT A;  3DYD A;  3HDO A;  3NNK A;  5BJ3 A;  1TAS A;  2YKV A;  3H14 A;  4JEX A;  1QGN A;  5G2P A;  2JGT A;  1DKA A;  2V1P A;  1E5E A;  1MDX A;  3NYS A;  2VGS A;  4RAE A;  4F5L A;  1IUG A;  3CQ4 A;  5DJ9 A;  4F4E A;  3CQ5 A;  2W7D A;  2ZYJ A;  3PGY A;  4OCA A;  3RUY A;  2W7E A;  3A9Z A;  3E77 A;  1E5F A;  1CL1 A;  1LS3 A;  4LW2 A;  1GC0 A;  4ATP A;  5M49 A;  3G7Q A;  1CQ8 A;  2VMX A;  1LC7 A;  3E6G A;  2DGM A;  2BHX A;  2FN6 A;  3E9K A;  2VMP A;  3B46 A;  5J8Q A;  2AY8 A;  2W7L A;  2C7T A;  4ZWM A;  5AX8 A;  2D61 A;  1C4K A;  1M0P A;  3IHJ A;  4CXQ A;  1MLY A;  3RCH B;  4F5H A;  4RKC A;  1ZOB A;  4ZDL A;  4AZK A;  1DJU A;  1O69 A;  4EMY A;  3NU7 A;  1C7N A;  3M5U A;  3W1I A;  2WK8 A;  4AZJ A;  2JJH A;  1AIC A;  3GZD A;  3UWC A;  4CXR A;  3JWB A;  4ZAH A;  1AMQ A;  3NYT A;  1ECX A;  4KYO A;  4ATQ A;  2VMV A;  2E7U A;  1IBJ A;  1RV3 A;  4ITG A;  2BKW A;  4P7Y A;  2OKJ A;  2YCN A;  3FCR A;  4N0B A;  1X29 A;  3EI6 A;  4U2H A;  4O6Z A;  2W7M A;  2CIN A;  2HUF A;  3JWA A;  1RVU A;  3I5T A;  3AEJ C;  5IWQ A;  2AY3 A;  2AY6 A;  2AY7 A;  2DKJ A;  1C0N A;  3HMU A;  5EUD A;  4WP0 A;  4GE7 A;  1WKH A;  1ASB A;  4TMR A;  2WK9 A;  1BQA A;  1OXO A;  2JG2 A;  1AHY A;  4ZSY A;  2VIB A;  1IX6 A;  1CZC A;  4XAU A;  3ELE A;  3A9X A;  2OAT A;  1W7N A;  3B1E A;  2Z9W A;  1ZOD A;  1LW4 A;  4IX8 A;  4ZM3 A;  4M2K A;  3TFT A;  3AEP A;  1M7Y A;  3AEM C;  2OGE A;  2BI1 A;  4OBV A;  4WBT A;  4A6U A;  4XEW A;  1GD9 A;  3FFH A;  5LH9 A;  1B5P A;  3F0H A;  3CAI A;  3FQ7 A;  1AAM A;  1GDE A;  2VI9 A;  3K7Y A;  5G4J A;  1SZK A;  1XI9 A;  4IYO B;  4ZSW A;  1O61 A;  4IYO A;  2BIE A;  4KXK A;  5G0A A;  2VI8 A;  3KGX A;  1EG5 A;  3LVM A;  1IX8 A;  3WCO A;  2ZUK A;  1O62 A;  3UAK A;  1DFO A;  1ORD A;  3NRA A;  3QPG A;  2R2N A;  1PMO A;  3LY1 A;  4A0G A;  2PB0 A;  2VMR A;  3ZZJ A;  1TOE A;  1G4X A;  3EI9 A;  2TPL A;  4GE4 A;  4I8A A;  1LC8 A;  3W1J A;  2QA3 A;  2X5D A;  3QN6 A;  2CB1 A;  2Z20 A;  3E2Z A;  3FQ8 A;  4J5U A;  4TN4 A;  4UHM A;  2W7J A;  3E2Z B;  1M0O A;  3I4J A;  4B98 A;  1QJ5 A;  2EZ1 A;  5FT4 A;  5G09 A;  4A72 A;  1C7O A;  3I16 A;  4E3Q A;  3FFR A;  2DKB A;  2CJD A;  4GRX A;  2Z61 A;  3PAA A;  1TOI A;  4RJ0 A;  1V2E A;  2DGL A;  2CH1 A;  3MAF A;  3K28 A;  2Q7W A;  5D5S A;  4RKD A;  5E3K A;  1W7M A;  4ADD A;  1S07 A;  5EUN A;  1GEY A;  2ZY5 A;  4W8I A;  3BWN A;  4LNM A;  3WCN A;  4K2B A;  1WYT B;  2ZJG A;  4Q6R A;  2GQN A;  1PMM A;  4GSA A;  5FT8 A;  3VK2 A;  5HXX A;  1OHW A;  1QZ9 A;  1AMR A;  3DZZ A;  2YKX A;  2VGT A;  3VK4 A;  2VLH A;  4EB5 A;  4ADC A;  2BIG A;  4PIW A;  4GDY A;  2O1B A;  2BYJ A;  1OAT A;  5EIG B;  3HVY A;  1BJO A;  2CAN A;  2HZP A;  2C44 A;  5EUE A;  4MQP A;  4OTL A;  1WKG A;  1UU0 A;  4MSO A;  2VMW A;  2JJE A;  3K40 A;  1AIA A;  1M0N A;  4UOY A;  1T3I A;  1V2D A;  2YKY A;  4BA4 A;  4F5F A;  4XJP A;  2VMN A;  2VMZ A;  3MKJ A;  1V72 A;  3ELP A;  3FD0 A;  3HL2 A;  3MAD A;  1WYT A;  5D95 A;  1D7U A;  1AJS A;  1FC4 A;  2G6W A;  2YOB A;  2BI3 A;  2R5E A;  1ARI A;  3A8U X;  1LK9 A;  1YOO A;  4ADB A;  1IJI A;  4WD2 A;  4P3M A;  3AOW A;  4A0R A;  1J32 A;  4OC9 A;  1YJY A;  2AY9 A;  3DR4 A;  3AEM A;  1B9H A;  2HOY A;  3LVK A;  4GE9 A;  7AAT A;  2OGA A;  3GSB A;  1JG8 A;  4CVQ A;  2BI5 A;  3WX9 A;  4RLG A;  1I43 A;  3BCB A;  4DBC A;  1QIT A;  1ARH A;  1BS0 A;  3DXV A;  3AV7 A;  1BKG A;  2WKA A;  3QBO A;  1GEW A;  3QI6 A;  1AHF A;  3AEL A;  1H0C A;  3KGW A;  5DJ1 A;  2ZY4 A;  3USF A;  2CFB A;  3WGC A;  1S09 A;  3LWS A;  3GWP A;  1RV4 A;  4K2I A;  4AO4 A;  4W5K A;  2CST A;  2GMU A;  3ASA A;  2PB2 A;  3ECD A;  1AJS B;  2R0T A;  3GBX A;  4WYG A;  2EZ2 A;  1ASM A;  4R2N A;  4A0F A;  3MAU A;  5M4B A;  1SF2 A;  3QGU A;  1M32 A;  4EB7 A;  1TOG A;  2F8J A;  1B5O A;  3RBL A;  2C0R A;  4R5F A;  1OHV A;  4A00 A;  1CQ7 A;  2W7G A;  4ZM4 A;  4ZDP A;  2CTZ A;  5LHA A;  1ELU A;  1KKP A;  1P3W A;  3PDB B;  2YRR A;  3VOM A;  2VMS A;  1WYV A;  3D6K A;  3LG0 A;  1BJO B;  4F5G A;  4Q31 A;  1G4V A;  4Y0I A;  3E2F A;  3R4T A;  4UQV A;  1W3U A;  5F8V A;  4H51 A;  2EO5 A;  4JF1 A;  1YIZ A;  2YHK A;  5K8B A; 
#chains in the Genus database with same CATH topology
 1PFF A;  3FDD A;  2AAT A;  1GEX A;  4BQ0 A;  2FYF A;  4W1X A;  1KL1 A;  2CJH A;  1ASL A;  1SPA A;  3KE3 A;  3NUI A;  2AY5 A;  4ZWV A;  2DOU A;  4MKK A;  1S08 A;  3VP6 A;  5G4I A;  1M6S A;  2FM1 A;  1U08 A;  3W1H A;  2AY4 A;  3BN1 A;  3GZD C;  3DOD A;  5F9S A;  9AAT A;  4XJO A;  2ZY2 A;  1VJO A;  5DB5 A;  4CBS A;  3NUB A;  1CZE A;  1S0A A;  2Z1Y A;  3R9A A;  3VK3 A;  4WXB A;  3HBX A;  4EU1 A;  1WST A;  1D7S A;  3BS8 A;  2VMO A;  3FVS A;  3ISL A;  5EAA A;  3RBF A;  3VAX A;  1DJ9 A;  5EIG A;  2CJG A;  4A6R A;  1ASG A;  1TOK A;  3DRD A;  1X2A A;  4MY5 A;  5I92 A;  3FSL A;  3T32 A;  2VGW A;  2Z9X A;  4WYE A;  1MDZ A;  2HUU A;  2W8V A;  3F6T A;  2W7K A;  1S06 A;  3RCH A;  3TQX A;  1X0M A;  1ASA A;  1KMJ A;  3E2Y A;  3TAT A;  1MDO A;  4MQR A;  4WYD A;  4WYF A;  1SZU A;  1EQB A;  2BI9 A;  3MBB A;  1TAT A;  4NOG A;  4JEW A;  5EFS A;  2G7J A;  1SVV A;  1BJN A;  3BC8 A;  2HUI A;  3N75 A;  4MQQ A;  1IX7 A;  2HP2 A;  2W8W A;  4WYA A;  3N4R A;  1W7L A;  2D66 A;  3CQ6 A;  4W91 A;  4RIT A;  4JEZ A;  5HDM A;  3LVL B;  2CH2 A;  3QHX A;  1N2T A;  2GB3 A;  2YKU A;  1CL2 A;  2Z67 A;  4M2J A;  5G2Q A;  1KMK A;  4RIZ A;  2YCP A;  5DX5 A;  4OMA A;  1G7X A;  2ZSL A;  3DXW A;  3BCX A;  4UHO A;  4XJM A;  2CY8 A;  1EJI A;  3G8M A;  4K2M A;  3WKR A;  1BT4 A;  4ITX A;  2QSR A;  3EIA A;  1I29 A;  2BI2 A;  3FTB A;  1AMS A;  1QIS A;  2FQ6 A;  3HT4 A;  3DU4 A;  3GR9 A;  1J04 A;  4R8D A;  3JU7 A;  4LC3 A;  4XJL A;  3PA9 A;  1BJ4 A;  2HP1 A;  3BV0 A;  4AOA A;  2FNI A;  4JE5 A;  4A0H A;  1O4S A;  2Z9U A;  3LV2 A;  2Z9V A;  2O0R A;  3ZRP A;  2BWN A;  4WYC A;  2O7C A;  4WXG A;  4W1V A;  2YRI A;  3PPL A;  4EFF A;  3NTJ A;  2KFP A;  1KAF A;  3FRK A;  1AKC A;  3FVU A;  2QLR A;  3GZC A;  3PD6 A;  3MC6 C;  4Q75 A;  4GEB A;  2W8J A;  2AEU A;  1CS1 A;  1JS6 A;  5EQC A;  5E5I A;  1D7V A;  2C81 A;  2E54 A;  3WKS A;  1B9I A;  1VP4 A;  3FDB A;  1IAX A;  2BYL A;  5M46 A;  1QIR A;  3DR7 A;  1KL2 A;  3FZ8 A;  3RI6 A;  3NDN A;  3B1D A;  2ZP7 A;  1B4X A;  4LNL A;  1AHG A;  3N0L A;  3N7N A;  1C7G A;  1GBN A;  5JAY A;  1AY8 A;  4JEV A;  2BWO A;  3AOV A;  3WGB A;  2OQX A;  1AHE A;  3BWN C;  4TV7 A;  3PIU A;  4JE5 D;  1ZC9 A;  2XBN A;  4IXO A;  4MGR A;  1OHY A;  1ASE A;  2D65 A;  2E7J A;  1ASD A;  2D7Z A;  1WYU B;  2W7I A;  5EAV A;  4KAM A;  4ZLV A;  2AY2 A;  4LW4 A;  4AH3 A;  2W7F A;  5C6U A;  3PD6 B;  2VGZ A;  3FQA A;  1JF9 A;  4WB0 A;  4JEY A;  3OKS A;  2AEV A;  3MAF B;  2NMP A;  4F5M A;  3AEO A;  3EUC A;  1DGD A;  5BJ4 A;  2VMQ A;  2R5C B;  2VMT A;  2VMY A;  3TFU A;  2VIA A;  4PFN A;  5FT6 A;  3RQ1 A;  4DQ6 A;  4ADE A;  2Z1Z A;  3EI5 A;  2OKK A;  4J8L A;  2VGV A;  3P6K A;  5M4D A;  2JJF A;  1AKB A;  4LNJ A;  4ZAS A;  1PG8 A;  2DGK A;  1X28 A;  1UU2 A;  2VGU A;  1JS3 A;  2ZY3 A;  1D2F A;  1BQD A;  1ELQ A;  4W1W A;  4RJY A;  3N5M A;  2A1V A;  4FL0 A;  4WLJ A;  1BJW A;  1LKC A;  3BWO A;  1H1C A;  5TF5 A;  4F5I A;  3KKI A;  4OYT A;  2XH1 A;  3CBF A;  2VYC A;  3B8X A;  1ASF A;  1ASC A;  2EPJ A;  1Y4I A;  1YAA A;  4Q76 A;  3ATH A;  1ART A;  4XQ2 A;  1CJ0 A;  1AIB A;  1RVY A;  2RFV A;  3COG A;  2BWP A;  2FNU A;  3EZS A;  1XEY A;  3G0T A;  3AAT A;  1TOJ A;  4OT8 A;  4F5J A;  2ORD A;  1IVR A;  3ASB A;  3FKD A;  3WLX A;  4N0W A;  4U1T A;  3ZRQ A;  3FZ7 A;  2QB2 A;  2JIS A;  3PDB A;  4XK1 A;  1QJ3 A;  2EH6 A;  1Z7D A;  1YJS A;  3AEN A;  2D7Y A;  3AEN B;  3JTX A;  3Q8N A;  1M0Q A;  3QM2 A;  4IW7 A;  4ZDO A;  2HOZ A;  3ZZK A;  3WZF A;  3ZRR A;  3H7F A;  1YJZ A;  2PO3 A;  3AEJ A;  1AKA A;  4B9B A;  4BHD A;  2BIA A;  3NYU A;  1KKJ A;  4L0O A;  4RM1 A;  3UE8 A;  2QMA A;  1FG3 A;  1GC2 A;  2DR1 A;  1ARG A;  1W23 A;  1WYU A;  3EZ1 A;  2X5F A;  1AMA A;  3GET A;  1CQ6 A;  1AJR A;  1I41 A;  3PDX A;  3DC1 A;  3EI7 A;  1IAY A;  3FVX A;  3BB8 A;  3A2B A;  1C9C A;  1SFF A;  4H63 Q;  4BA5 A;  1AY4 A;  3II0 A;  5FT5 A;  4IXS A;  4IY7 A;  4E3R A;  4F5K A;  4M2M A;  2R5C A;  4A6T A;  4WXF A;  1YNU A;  1MGV A;  1ASN A;  1MLZ A;  4QGR A;  3F9T A;  3HLM A;  3OP7 A;  1MAP A;  1VEF A;  3NX3 A;  2YCT A;  1OXP A;  1D7R A;  4R5Z A;  3MEB A;  1AY5 A;  3WY7 A;  4CBR A;  3IF2 A;  2D64 A;  2VLF A;  1YIY A;  3EIB A;  2D5Y A;  2HOR A;  1Z3Z A;  2EGY A;  3P1T A;  4UHN A;  4E1O A;  4ISY A;  1V2F A;  4HF8 A;  4PVF A;  1TPL A;  4PFF A;  3L8A A;  1B8G A;  1DTY A;  1UKJ A;  4Y0H A;  2QBT A;  2W7H A;  4MKJ A;  2GSA A;  4WB0 B;  5HHY A;  1GCK A;  2W8U A;  4BMK A;  2X3L A;  2HOX A;  1I48 A;  1AX4 A;  1LC5 A;  4WLH A;  4FFC A;  2VMU A;  3A9Y A;  2V0Y A;  3JZL A;  4E77 A;  3HQT A;  3TCM A;  3GJU A;  1N31 A;  1FG7 A;  2JJG A;  4JF0 A;  3FZ6 A;  1MAQ A;  2E7I A;  1SZS A;  3B1C A;  2AY1 A;  4IXZ A;  3NU8 A;  1DJE A;  1AHX A;  4Y0D A;  1BW0 A;  4OBU A;  2D63 A;  2ZSM A;  3ACZ A;  1WYV B;  1N8P A;  1TAR A;  1G7W A;  1GC3 A;  2ZC0 A;  3EI8 A;  3JW9 A;  3L44 A;  1ARS A;  1UU1 A;  3PJ0 A;  4HVK A;  1GC4 A;  3LVJ A;  1DGE A;  1LW5 A;  3BCA A;  1AAW A;  5E4Z A;  8AAT A;  2GMS A;  2WK7 A;  1M4N A;  2W8T A;  2QB3 A;  2X8U A;  3MC6 A;  4AO9 A;  4DGT A;  3DYD A;  3HDO A;  3NNK A;  5BJ3 A;  1TAS A;  2YKV A;  3H14 A;  4JEX A;  1QGN A;  5G2P A;  2JGT A;  1DKA A;  2V1P A;  1E5E A;  1MDX A;  3NYS A;  2VGS A;  4RAE A;  4F5L A;  1IUG A;  3CQ4 A;  5DJ9 A;  4F4E A;  3CQ5 A;  2W7D A;  2ZYJ A;  3PGY A;  4OCA A;  3RUY A;  2W7E A;  3A9Z A;  3E77 A;  1E5F A;  1CL1 A;  1LS3 A;  4LW2 A;  1GC0 A;  4ATP A;  5M49 A;  3G7Q A;  1CQ8 A;  2VMX A;  1LC7 A;  3E6G A;  2DGM A;  2BHX A;  2FN6 A;  3E9K A;  2VMP A;  3B46 A;  5J8Q A;  2AY8 A;  2W7L A;  2C7T A;  4ZWM A;  5AX8 A;  2D61 A;  1C4K A;  1M0P A;  3IHJ A;  4CXQ A;  1MLY A;  3RCH B;  4F5H A;  4RKC A;  1ZOB A;  4ZDL A;  4AZK A;  1DJU A;  1O69 A;  4EMY A;  3NU7 A;  1C7N A;  3M5U A;  3W1I A;  2WK8 A;  4AZJ A;  2JJH A;  1AIC A;  3GZD A;  3UWC A;  4CXR A;  3JWB A;  4ZAH A;  1AMQ A;  3NYT A;  1ECX A;  4KYO A;  4ATQ A;  2VMV A;  2E7U A;  1IBJ A;  1RV3 A;  4ITG A;  2BKW A;  4P7Y A;  2OKJ A;  2YCN A;  3FCR A;  4N0B A;  1X29 A;  3EI6 A;  4U2H A;  4O6Z A;  2W7M A;  2CIN A;  2HUF A;  3JWA A;  1RVU A;  3I5T A;  3AEJ C;  5IWQ A;  2AY3 A;  2AY6 A;  2AY7 A;  2DKJ A;  1C0N A;  3HMU A;  5EUD A;  4WP0 A;  4GE7 A;  1WKH A;  1ASB A;  4TMR A;  2WK9 A;  1BQA A;  1OXO A;  2JG2 A;  1AHY A;  4ZSY A;  3N4X A;  2VIB A;  1IX6 A;  1CZC A;  4XAU A;  3ELE A;  3A9X A;  2OAT A;  1W7N A;  3B1E A;  2Z9W A;  1ZOD A;  1LW4 A;  4IX8 A;  4ZM3 A;  4M2K A;  3TFT A;  3AEP A;  1M7Y A;  3AEM C;  2OGE A;  2BI1 A;  4OBV A;  4WBT A;  4A6U A;  4XEW A;  1GD9 A;  3FFH A;  5LH9 A;  1B5P A;  3F0H A;  3CAI A;  3FQ7 A;  1AAM A;  1GDE A;  2VI9 A;  3K7Y A;  5G4J A;  1SZK A;  1XI9 A;  4IYO B;  4ZSW A;  1O61 A;  4IYO A;  2BIE A;  4KXK A;  5G0A A;  2VI8 A;  3KGX A;  1EG5 A;  3LVM A;  1IX8 A;  3WCO A;  2ZUK A;  1O62 A;  3UAK A;  1DFO A;  1ORD A;  3NRA A;  3QPG A;  2R2N A;  1PMO A;  3LY1 A;  4A0G A;  2PB0 A;  2VMR A;  3ZZJ A;  1TOE A;  1G4X A;  3EI9 A;  2TPL A;  4GE4 A;  4I8A A;  1LC8 A;  3W1J A;  2QA3 A;  2X5D A;  3QN6 A;  2CB1 A;  2Z20 A;  3E2Z A;  3FQ8 A;  4J5U A;  4TN4 A;  4UHM A;  2W7J A;  3E2Z B;  1M0O A;  3I4J A;  4B98 A;  1QJ5 A;  2EZ1 A;  5FT4 A;  5G09 A;  4A72 A;  1C7O A;  3I16 A;  4E3Q A;  3FFR A;  2DKB A;  2CJD A;  4GRX A;  2Z61 A;  3N4S A;  3PAA A;  1TOI A;  4RJ0 A;  1V2E A;  2DGL A;  2CH1 A;  3MAF A;  3K28 A;  2Q7W A;  5D5S A;  4RKD A;  5E3K A;  1W7M A;  4ADD A;  1S07 A;  5EUN A;  1GEY A;  2ZY5 A;  4W8I A;  3BWN A;  4LNM A;  3WCN A;  4K2B A;  1WYT B;  2ZJG A;  4Q6R A;  2GQN A;  1PMM A;  4GSA A;  5FT8 A;  3VK2 A;  5HXX A;  1OHW A;  1QZ9 A;  1AMR A;  3DZZ A;  2YKX A;  2VGT A;  3VK4 A;  2VLH A;  4EB5 A;  4ADC A;  2BIG A;  4PIW A;  4GDY A;  2O1B A;  2EYQ A;  2BYJ A;  1OAT A;  5EIG B;  3HVY A;  1BJO A;  2CAN A;  2HZP A;  2C44 A;  5EUE A;  4MQP A;  4OTL A;  1WKG A;  2FKI A;  1UU0 A;  4MSO A;  3H9X A;  2VMW A;  2JJE A;  3K40 A;  1AIA A;  1M0N A;  4UOY A;  1T3I A;  1V2D A;  4K05 A;  2YKY A;  4BA4 A;  4F5F A;  4XJP A;  2VMN A;  2VMZ A;  3MKJ A;  1V72 A;  3ELP A;  3FD0 A;  3HL2 A;  3MAD A;  1WYT A;  5D95 A;  1D7U A;  1AJS A;  1FC4 A;  2G6W A;  2YOB A;  2BI3 A;  2R5E A;  2WB6 A;  1ARI A;  3A8U X;  1LK9 A;  1YOO A;  4ADB A;  1IJI A;  4WD2 A;  4P3M A;  3AOW A;  4A0R A;  1J32 A;  4OC9 A;  1YJY A;  2AY9 A;  3DR4 A;  3AEM A;  1B9H A;  2HOY A;  3LVK A;  4GE9 A;  7AAT A;  2OGA A;  3GSB A;  1JG8 A;  4CVQ A;  2BI5 A;  3WX9 A;  4RLG A;  1I43 A;  3BCB A;  4DBC A;  1QIT A;  5KTB A;  1ARH A;  1BS0 A;  3DXV A;  3AV7 A;  1BKG A;  2WKA A;  3QBO A;  1GEW A;  3QI6 A;  1AHF A;  3AEL A;  1H0C A;  3KGW A;  5DJ1 A;  2ZY4 A;  3USF A;  2CFB A;  3WGC A;  1S09 A;  3LWS A;  3GWP A;  1RV4 A;  4K2I A;  4AO4 A;  4W5K A;  2CST A;  2GMU A;  3ASA A;  2PB2 A;  3ECD A;  1AJS B;  2R0T A;  3GBX A;  4WYG A;  2EZ2 A;  1ASM A;  4R2N A;  4A0F A;  3MAU A;  5M4B A;  1SF2 A;  3QGU A;  1M32 A;  4EB7 A;  1TOG A;  2F8J A;  1B5O A;  3RBL A;  2C0R A;  4R5F A;  1OHV A;  4A00 A;  1CQ7 A;  2W7G A;  4ZM4 A;  4ZDP A;  2CTZ A;  5LHA A;  1ELU A;  1KKP A;  1P3W A;  3PDB B;  2YRR A;  3VOM A;  2VMS A;  1WYV A;  3D6K A;  3LG0 A;  1BJO B;  4F5G A;  4Q31 A;  1G4V A;  4Y0I A;  3E2F A;  3R4T A;  4UQV A;  1W3U A;  5F8V A;  4H51 A;  2EO5 A;  4JF1 A;  1YIZ A;  2YHK A;  5K8B A; 
#chains in the Genus database with same CATH homology
 1PFF A;  3FDD A;  2AAT A;  1GEX A;  4BQ0 A;  2FYF A;  4W1X A;  1KL1 A;  2CJH A;  1ASL A;  1SPA A;  3KE3 A;  3NUI A;  2AY5 A;  4ZWV A;  2DOU A;  4MKK A;  1S08 A;  3VP6 A;  5G4I A;  1M6S A;  2FM1 A;  1U08 A;  3W1H A;  2AY4 A;  3BN1 A;  3GZD C;  3DOD A;  5F9S A;  9AAT A;  4XJO A;  2ZY2 A;  1VJO A;  5DB5 A;  4CBS A;  3NUB A;  1CZE A;  1S0A A;  2Z1Y A;  3R9A A;  3VK3 A;  4WXB A;  3HBX A;  4EU1 A;  1WST A;  1D7S A;  3BS8 A;  2VMO A;  3FVS A;  3ISL A;  5EAA A;  3RBF A;  3VAX A;  1DJ9 A;  5EIG A;  2CJG A;  4A6R A;  1ASG A;  1TOK A;  3DRD A;  1X2A A;  4MY5 A;  5I92 A;  3FSL A;  3T32 A;  2VGW A;  2Z9X A;  4WYE A;  1MDZ A;  2HUU A;  2W8V A;  3F6T A;  2W7K A;  1S06 A;  3RCH A;  3TQX A;  1X0M A;  1ASA A;  1KMJ A;  3E2Y A;  3TAT A;  1MDO A;  4MQR A;  4WYD A;  4WYF A;  1SZU A;  1EQB A;  2BI9 A;  3MBB A;  1TAT A;  4NOG A;  4JEW A;  5EFS A;  2G7J A;  1SVV A;  1BJN A;  3BC8 A;  2HUI A;  3N75 A;  4MQQ A;  1IX7 A;  2HP2 A;  2W8W A;  4WYA A;  3N4R A;  1W7L A;  2D66 A;  3CQ6 A;  4W91 A;  4RIT A;  4JEZ A;  5HDM A;  3LVL B;  2CH2 A;  3QHX A;  1N2T A;  2GB3 A;  2YKU A;  1CL2 A;  2Z67 A;  4M2J A;  5G2Q A;  1KMK A;  4RIZ A;  2YCP A;  5DX5 A;  4OMA A;  1G7X A;  2ZSL A;  3DXW A;  3BCX A;  4UHO A;  4XJM A;  2CY8 A;  1EJI A;  3G8M A;  4K2M A;  3WKR A;  1BT4 A;  4ITX A;  2QSR A;  3EIA A;  1I29 A;  2BI2 A;  3FTB A;  1AMS A;  1QIS A;  2FQ6 A;  3HT4 A;  3DU4 A;  3GR9 A;  1J04 A;  4R8D A;  3JU7 A;  4LC3 A;  4XJL A;  3PA9 A;  1BJ4 A;  2HP1 A;  3BV0 A;  4AOA A;  2FNI A;  4JE5 A;  4A0H A;  1O4S A;  2Z9U A;  3LV2 A;  2Z9V A;  2O0R A;  3ZRP A;  2BWN A;  4WYC A;  2O7C A;  4WXG A;  4W1V A;  2YRI A;  3PPL A;  4EFF A;  3NTJ A;  2KFP A;  3FRK A;  1AKC A;  3FVU A;  2QLR A;  3GZC A;  3PD6 A;  3MC6 C;  4Q75 A;  4GEB A;  2W8J A;  2AEU A;  1CS1 A;  1JS6 A;  5EQC A;  5E5I A;  1D7V A;  2C81 A;  2E54 A;  3WKS A;  1B9I A;  1VP4 A;  3FDB A;  1IAX A;  2BYL A;  5M46 A;  1QIR A;  3DR7 A;  1KL2 A;  3FZ8 A;  3RI6 A;  3NDN A;  3B1D A;  2ZP7 A;  1B4X A;  4LNL A;  1AHG A;  3N0L A;  3N7N A;  1C7G A;  1GBN A;  5JAY A;  1AY8 A;  4JEV A;  2BWO A;  3AOV A;  3WGB A;  2OQX A;  1AHE A;  3BWN C;  4TV7 A;  3PIU A;  4JE5 D;  1ZC9 A;  2XBN A;  4IXO A;  4MGR A;  1OHY A;  1ASE A;  2D65 A;  2E7J A;  1ASD A;  2D7Z A;  1WYU B;  2W7I A;  5EAV A;  4KAM A;  4ZLV A;  2AY2 A;  4LW4 A;  4AH3 A;  2W7F A;  5C6U A;  3PD6 B;  2VGZ A;  3FQA A;  1JF9 A;  4WB0 A;  4JEY A;  3OKS A;  2AEV A;  3MAF B;  2NMP A;  4F5M A;  3AEO A;  3EUC A;  1DGD A;  5BJ4 A;  2VMQ A;  2R5C B;  2VMT A;  2VMY A;  3TFU A;  2VIA A;  4PFN A;  5FT6 A;  3RQ1 A;  4DQ6 A;  4ADE A;  2Z1Z A;  3EI5 A;  2OKK A;  4J8L A;  2VGV A;  3P6K A;  5M4D A;  2JJF A;  1AKB A;  4LNJ A;  4ZAS A;  1PG8 A;  2DGK A;  1X28 A;  1UU2 A;  2VGU A;  1JS3 A;  2ZY3 A;  1D2F A;  1BQD A;  1ELQ A;  4W1W A;  4RJY A;  3N5M A;  2A1V A;  4FL0 A;  4WLJ A;  1BJW A;  1LKC A;  3BWO A;  1H1C A;  5TF5 A;  4F5I A;  3KKI A;  4OYT A;  2XH1 A;  3CBF A;  2VYC A;  3B8X A;  1ASF A;  1ASC A;  2EPJ A;  1Y4I A;  1YAA A;  4Q76 A;  3ATH A;  1ART A;  4XQ2 A;  1CJ0 A;  1AIB A;  1RVY A;  2RFV A;  3COG A;  2BWP A;  2FNU A;  3EZS A;  1XEY A;  3G0T A;  3AAT A;  1TOJ A;  4OT8 A;  4F5J A;  2ORD A;  1IVR A;  3ASB A;  3FKD A;  3WLX A;  4N0W A;  4U1T A;  3ZRQ A;  3FZ7 A;  2QB2 A;  2JIS A;  3PDB A;  4XK1 A;  1QJ3 A;  2EH6 A;  1Z7D A;  1YJS A;  3AEN A;  2D7Y A;  3AEN B;  3JTX A;  3Q8N A;  1M0Q A;  3QM2 A;  4IW7 A;  4ZDO A;  2HOZ A;  3ZZK A;  3WZF A;  3ZRR A;  3H7F A;  1YJZ A;  2PO3 A;  3AEJ A;  1AKA A;  4B9B A;  4BHD A;  2BIA A;  3NYU A;  1KKJ A;  4L0O A;  4RM1 A;  3UE8 A;  2QMA A;  1FG3 A;  1GC2 A;  2DR1 A;  1ARG A;  1W23 A;  1WYU A;  3EZ1 A;  2X5F A;  1AMA A;  3GET A;  1CQ6 A;  1AJR A;  1I41 A;  3PDX A;  3DC1 A;  3EI7 A;  1IAY A;  3FVX A;  3BB8 A;  3A2B A;  1C9C A;  1SFF A;  4H63 Q;  4BA5 A;  1AY4 A;  3II0 A;  5FT5 A;  4IXS A;  4IY7 A;  4E3R A;  4F5K A;  4M2M A;  2R5C A;  4A6T A;  4WXF A;  1YNU A;  1MGV A;  1ASN A;  1MLZ A;  4QGR A;  3F9T A;  3HLM A;  3OP7 A;  1MAP A;  1VEF A;  3NX3 A;  2YCT A;  1OXP A;  1D7R A;  4R5Z A;  3MEB A;  1AY5 A;  3WY7 A;  4CBR A;  3IF2 A;  2D64 A;  2VLF A;  1YIY A;  3EIB A;  2D5Y A;  2HOR A;  1Z3Z A;  2EGY A;  3P1T A;  4UHN A;  4E1O A;  4ISY A;  1V2F A;  4HF8 A;  4PVF A;  1TPL A;  4PFF A;  3L8A A;  1B8G A;  1DTY A;  1UKJ A;  4Y0H A;  2QBT A;  2W7H A;  4MKJ A;  2GSA A;  4WB0 B;  5HHY A;  1GCK A;  2W8U A;  4BMK A;  2X3L A;  2HOX A;  1I48 A;  1AX4 A;  1LC5 A;  4WLH A;  4FFC A;  2VMU A;  3A9Y A;  2V0Y A;  3JZL A;  4E77 A;  3HQT A;  3TCM A;  3GJU A;  1N31 A;  1FG7 A;  2JJG A;  4JF0 A;  3FZ6 A;  1MAQ A;  2E7I A;  1SZS A;  3B1C A;  2AY1 A;  4IXZ A;  3NU8 A;  1DJE A;  1AHX A;  4Y0D A;  1BW0 A;  4OBU A;  2D63 A;  2ZSM A;  3ACZ A;  1WYV B;  1N8P A;  1TAR A;  1G7W A;  1GC3 A;  2ZC0 A;  3EI8 A;  3JW9 A;  3L44 A;  1ARS A;  1UU1 A;  3PJ0 A;  4HVK A;  1GC4 A;  3LVJ A;  1DGE A;  1LW5 A;  3BCA A;  1AAW A;  5E4Z A;  8AAT A;  2GMS A;  2WK7 A;  1M4N A;  2W8T A;  2QB3 A;  2X8U A;  3MC6 A;  4AO9 A;  4DGT A;  3DYD A;  3HDO A;  3NNK A;  5BJ3 A;  1TAS A;  2YKV A;  3H14 A;  4JEX A;  1QGN A;  5G2P A;  2JGT A;  1DKA A;  2V1P A;  1E5E A;  1MDX A;  3NYS A;  2VGS A;  4RAE A;  4F5L A;  1IUG A;  3CQ4 A;  5DJ9 A;  4F4E A;  3CQ5 A;  2W7D A;  2ZYJ A;  3PGY A;  4OCA A;  3RUY A;  2W7E A;  3A9Z A;  3E77 A;  1E5F A;  1CL1 A;  1LS3 A;  4LW2 A;  1GC0 A;  4ATP A;  5M49 A;  3G7Q A;  1CQ8 A;  2VMX A;  1LC7 A;  3E6G A;  2DGM A;  2BHX A;  2FN6 A;  3E9K A;  2VMP A;  3B46 A;  5J8Q A;  2AY8 A;  2W7L A;  2C7T A;  4ZWM A;  5AX8 A;  2D61 A;  1C4K A;  1M0P A;  3IHJ A;  4CXQ A;  1MLY A;  3RCH B;  4F5H A;  4RKC A;  1ZOB A;  4ZDL A;  4AZK A;  1DJU A;  1O69 A;  4EMY A;  3NU7 A;  1C7N A;  3M5U A;  3W1I A;  2WK8 A;  4AZJ A;  2JJH A;  1AIC A;  3GZD A;  3UWC A;  4CXR A;  3JWB A;  4ZAH A;  1AMQ A;  3NYT A;  1ECX A;  4KYO A;  4ATQ A;  2VMV A;  2E7U A;  1IBJ A;  1RV3 A;  4ITG A;  2BKW A;  4P7Y A;  2OKJ A;  2YCN A;  3FCR A;  4N0B A;  1X29 A;  3EI6 A;  4U2H A;  4O6Z A;  2W7M A;  2CIN A;  2HUF A;  3JWA A;  1RVU A;  3I5T A;  3AEJ C;  5IWQ A;  2AY3 A;  2AY6 A;  2AY7 A;  2DKJ A;  1C0N A;  3HMU A;  5EUD A;  4WP0 A;  4GE7 A;  1WKH A;  1ASB A;  4TMR A;  2WK9 A;  1BQA A;  1OXO A;  2JG2 A;  1AHY A;  4ZSY A;  3N4X A;  2VIB A;  1IX6 A;  1CZC A;  4XAU A;  3ELE A;  3A9X A;  2OAT A;  1W7N A;  3B1E A;  2Z9W A;  1ZOD A;  1LW4 A;  4IX8 A;  4ZM3 A;  4M2K A;  3TFT A;  3AEP A;  1M7Y A;  3AEM C;  2OGE A;  2BI1 A;  4OBV A;  4WBT A;  4A6U A;  4XEW A;  1GD9 A;  3FFH A;  5LH9 A;  1B5P A;  3F0H A;  3CAI A;  3FQ7 A;  1AAM A;  1GDE A;  2VI9 A;  3K7Y A;  5G4J A;  1SZK A;  1XI9 A;  4IYO B;  4ZSW A;  1O61 A;  4IYO A;  2BIE A;  4KXK A;  5G0A A;  2VI8 A;  3KGX A;  1EG5 A;  3LVM A;  1IX8 A;  3WCO A;  2ZUK A;  1O62 A;  3UAK A;  1DFO A;  1ORD A;  3NRA A;  3QPG A;  2R2N A;  1PMO A;  3LY1 A;  4A0G A;  2PB0 A;  2VMR A;  3ZZJ A;  1TOE A;  1G4X A;  3EI9 A;  2TPL A;  4GE4 A;  4I8A A;  1LC8 A;  3W1J A;  2QA3 A;  2X5D A;  3QN6 A;  2CB1 A;  2Z20 A;  3E2Z A;  3FQ8 A;  4J5U A;  4TN4 A;  4UHM A;  2W7J A;  3E2Z B;  1M0O A;  3I4J A;  4B98 A;  1QJ5 A;  2EZ1 A;  5FT4 A;  5G09 A;  4A72 A;  1C7O A;  3I16 A;  4E3Q A;  3FFR A;  2DKB A;  2CJD A;  4GRX A;  2Z61 A;  3N4S A;  3PAA A;  1TOI A;  4RJ0 A;  1V2E A;  2DGL A;  2CH1 A;  3MAF A;  3K28 A;  2Q7W A;  5D5S A;  4RKD A;  5E3K A;  1W7M A;  4ADD A;  1S07 A;  5EUN A;  1GEY A;  2ZY5 A;  4W8I A;  3BWN A;  4LNM A;  3WCN A;  4K2B A;  1WYT B;  2ZJG A;  4Q6R A;  2GQN A;  1PMM A;  4GSA A;  5FT8 A;  3VK2 A;  5HXX A;  1OHW A;  1QZ9 A;  1AMR A;  3DZZ A;  2YKX A;  2VGT A;  3VK4 A;  2VLH A;  4EB5 A;  4ADC A;  2BIG A;  4PIW A;  4GDY A;  2O1B A;  2EYQ A;  2BYJ A;  1OAT A;  5EIG B;  3HVY A;  1BJO A;  2CAN A;  2HZP A;  2C44 A;  5EUE A;  4MQP A;  4OTL A;  1WKG A;  2FKI A;  1UU0 A;  4MSO A;  3H9X A;  2VMW A;  2JJE A;  3K40 A;  1AIA A;  1M0N A;  4UOY A;  1T3I A;  1V2D A;  4K05 A;  2YKY A;  4BA4 A;  4F5F A;  4XJP A;  2VMN A;  2VMZ A;  3MKJ A;  1V72 A;  3ELP A;  3FD0 A;  3HL2 A;  3MAD A;  1WYT A;  5D95 A;  1D7U A;  1AJS A;  1FC4 A;  2G6W A;  2YOB A;  2BI3 A;  2R5E A;  2WB6 A;  1ARI A;  3A8U X;  1LK9 A;  1YOO A;  4ADB A;  1IJI A;  4WD2 A;  4P3M A;  3AOW A;  4A0R A;  1J32 A;  4OC9 A;  1YJY A;  2AY9 A;  3DR4 A;  3AEM A;  1B9H A;  2HOY A;  3LVK A;  4GE9 A;  7AAT A;  2OGA A;  3GSB A;  1JG8 A;  4CVQ A;  2BI5 A;  3WX9 A;  4RLG A;  1I43 A;  3BCB A;  4DBC A;  1QIT A;  5KTB A;  1ARH A;  1BS0 A;  3DXV A;  3AV7 A;  1BKG A;  2WKA A;  3QBO A;  1GEW A;  3QI6 A;  1AHF A;  3AEL A;  1H0C A;  3KGW A;  5DJ1 A;  2ZY4 A;  3USF A;  2CFB A;  3WGC A;  1S09 A;  3LWS A;  3GWP A;  1RV4 A;  4K2I A;  4AO4 A;  4W5K A;  2CST A;  2GMU A;  3ASA A;  2PB2 A;  3ECD A;  1AJS B;  2R0T A;  3GBX A;  4WYG A;  2EZ2 A;  1ASM A;  4R2N A;  4A0F A;  3MAU A;  5M4B A;  1SF2 A;  3QGU A;  1M32 A;  4EB7 A;  1TOG A;  2F8J A;  1B5O A;  3RBL A;  2C0R A;  4R5F A;  1OHV A;  4A00 A;  1CQ7 A;  2W7G A;  4ZM4 A;  4ZDP A;  2CTZ A;  5LHA A;  1ELU A;  1KKP A;  1P3W A;  3PDB B;  2YRR A;  3VOM A;  2VMS A;  1WYV A;  3D6K A;  3LG0 A;  1BJO B;  4F5G A;  4Q31 A;  1G4V A;  4Y0I A;  3E2F A;  3R4T A;  4UQV A;  1W3U A;  5F8V A;  4H51 A;  2EO5 A;  4JF1 A;  1YIZ A;  2YHK A;  5K8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...