1AY5A

Aromatic amino acid aminotransferase complex with maleate
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
394
structure length
394
Chain Sequence
MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINO ACID AMINOTRANSFERASE
publication title Crystal structures of Paracoccus denitrificans aromatic amino acid aminotransferase: a substrate recognition site constructed by rearrangement of hydrogen bond network.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Transferase
total genus 141
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature ec 2.6.1.57: Aromatic-amino-acid transaminase.
pdb deposition date 1997-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1ay5A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1ay5A01
4R5ZA 5EFSA 1CZEA 1AIAA 1TATA 4XEWA 1X0MA 1AIBA 1DTYA 2RFVA 2PB2A 3IHJA 1BJOA 4R5FA 1ZOBA 2YKYA 1H1CA 3BB8A 4ITGA 1CQ8A 1PMMA 2W7JA 2O7CA 1ECXA 4J8LA 4LNJA 4F5FA 3GBXA 4MKJA 1CZCA 2ZYJA 1D7UA 4F4EA 3ISLA 3OKSA 4F5MA 5F9SA 2OQXA 3PD6B 4WYFA 1LC8A 1AMAA 1UU1A 4AZJA 1CJ0A 5G2PA 1GDEA 3HQTA 4WLJA 3NRAA 2DKBA 2CANA 4A0GA 3WKSA 4HF8A 2AATA 4RIZA 1ASLA 2D61A 2EZ2A 1WYUB 4QGRA 2VMZA 4EB5A 3D6KA 4WLHA 4MSOA 1JF9A 2YCPA 3JU7A 3ZRRA 4ZM3A 3HBXA 3MBBA 3AEOA 4A6TA 1BJWA 3PDBA 3AATA 1ASMA 1CQ7A 3FVXA 5HXXA 1GEWA 1O61A 1GCKA 1YJSA 3LG0A 4GDYA 3A9YA 3RCHB 5EAAA 2YHKA 3TFTA 1MGVA 4UQVA 1WYVB 2AEUA 4ZASA 3ZZKA 4BA5A 1W7NA 2W7GA 4OBUA 4E77A 3DYDA 4ISYA 3L44A 2BIEA 3AEPA 1W23A 5EUEA 3FVUA 2VMRA 3FQ8A 1FC4A 3QI6A 4JEVA 2X3LA 1M0NA 1AAWA 2ZC0A 5G09A 2AY2A 3E2YA 4R2NA 3NUBA 5M46A 1JG8A 4EU1A 1FG3A 2W8VA 4N0BA 2QBTA 1QJ5A 1AJSA 3B1EA 3KE3A 4FL0A 3WZFA 1MLZA 1TOJA 2E7UA 3N75A 1C0NA 3NYUA 2CH2A 3TCMA 4JE5D 3GR9A 5DJ1A 3B8XA 4A72A 2ZY5A 2OKKA 5G2QA 2VI9A 3E2ZB 2W7FA 1X29A 3NNKA 2W7DA 3JWBA 5D95A 3UAKA 3R4TA 1B4XA 3GSBA 3K40A 2CJHA 3PDXA 3RBLA 5AX8A 4A0FA 3E2FA 1AHXA 4W8IA 3WLXA 4JE5A 1UU2A 1B5OA 2C81A 4DBCA 2CB1A 3NUIA 4XJLA 4WYCA 1JS3A 1OHWA 2JJGA 2VMQA 3FZ8A 4OYTA 5G4JA 5I92A 4F5IA 1GBNA 4MY5A 1XI9A 2JG2A 2Z9VA 4WBTA 2O0RA 2BI1A 3FTBA 3NDNA 2CJGA 4IX8A 3FRKA 4A6RA 1MDOA 4KYOA 1AHEA 3F6TA 3AEMA 4TMRA 1AKCA 2D65A 1TPLA 2Z9XA 1TASA 2ZUKA 3A2BA 1AJRA 2C7TA 4W1VA 3W1HA 3COGA 1OXOA 1AHGA 1SVVA 3G7QA 4ZDLA 3BCXA 3MC6A 4MGRA 4UHMA 3DODA 1YOOA 4CXQA 2YCNA 1B9IA 3GETA 1M6SA 2FQ6A 1IX6A 2D66A 4OTLA 3CBFA 2AY1A 2AY4A 2JJFA 4XJOA 3TATA 1Z3ZA 2DGKA 1IAXA 4E3QA 3FZ7A 4P3MA 2WK8A 2JJEA 5LHAA 2YRRA 3I5TA 2W8TA 4LW2A 3VAXA 3DR4A 3GJUA 3I4JA 4H51A 1CQ6A 4Q6RA 1VEFA 1ASGA 1SZKA 4BHDA 2VMVA 1BT4A 1X2AA 4Y0IA 2W7HA 5D5SA 5M4BA 1BJNA 3W1JA 4B9BA 2OGAA 3LVMA 1RVUA 4BMKA 2X5DA 1YIYA 3BCAA 4ADEA 2QLRA 4GE9A 1LC5A 1TOEA 4OBVA 1WYTA 1C7GA 2C44A 2D7ZA 3FQ7A 1AAMA 1CS1A 2VGWA 3AENA 3EIAA 3QBOA 4WYGA 4WXBA 5DJ9A 4RAEA 3B46A 1TOIA 1YJYA 2EO5A 3FDDA 1ASEA 1Y4IA 4RLGA 5JAYA 4XK1A 1I29A 2EH6A 1LK9A 3CQ6A 4Q76A 4MQPA 3AEMC 3KGXA 3ECDA 4ZDPA 1KMKA 3ASAA 4JF1A 3NYTA 3VK4A 1QITA 1OHVA 1ASBA 1EJIA 2OGEA 3EZ1A 4M2JA 1M0OA 5FT4A 3UWCA 2V1PA 4UOYA 2FM1A 4OT8A 1DJEA 3N5MA 1SZUA 3JZLA 1AMRA 4JEWA 2VLFA 3MC6C 4WYAA 5EUNA 2HP2A 5M49A 3L8AA 1IUGA 2GMUA 1EQBA 3NU8A 4W5KA 1YAAA 4TV7A 1E5EA 2EGYA 1AMSA 2AY8A 4O6ZA 4F5KA 5E3KA 1S0AA 3G0TA 3W1IA 2D63A 3WX9A 1KL1A 4UHOA 4WP0A 4WYEA 1I43A 1VP4A 4IW7A 1B9HA 2HZPA 1SFFA 2ZSMA 3VK2A 3H14A 4IYOB 4N0WA 2VGUA 5C6UA 1S06A 4ZLVA 3DR7A 5G0AA 2BYJA 1BKGA 2OATA 1ASFA 1GC2A 1ORDA 3DXVA 1I48A 3LWSA 3JW9A 3FDBA 1AHFA 1D7VA 1GC3A 1JS6A 3BWOA 1PFFA 1RV4A 1SF2A 2BIAA 3FVSA 3NTJA 3PIUA 4EMYA 1TARA 3MAFA 1I41A 1V72A 2W7EA 3E6GA 2DGMA 1AKAA 2W7LA 3AV7A 5EIGB 2NMPA 1OATA 3P1TA 2QB3A 4WB0A 2CY8A 5EQCA 2R5CB 3NX3A 4ADBA 3LV2A 1CL1A 3AOWA 5E4ZA 1AMQA 3NU7A 4ZSWA 1G4XA 3QPGA 1V2EA 4CVQA 4JEXA 4LNMA 3B1DA 2QA3A 1AY5A 4OCAA 4CBRA 4Q75A 2FYFA 3IF2A 1B5PA 4K2MA 2EZ1A 3TQXA 1RVYA 3UE8A 8AATA 2R2NA 3RUYA 3M5UA 2CSTA 3EI9A 1ZC9A 2GMSA 1WKHA 3PD6A 4LW4A 1TOKA 3ZRPA 1MDZA 5K8BA 2BKWA 4JF0A 2Z1ZA 2HUUA 1W7LA 7AATA 4PFNA 1BQDA 2GB3A 3AEJC 1WYUA 2YKUA 4WYDA 2DR1A 2WK7A 4FFCA 2VMSA 2CTZA 4RJ0A 3BS8A 4DQ6A 2YKVA 4E1OA 1IX8A 4W91A 3RCHA 3AOVA 3CAIA 2VYCA 3A9XA 1ASAA 1YNUA 3AENB 3FSLA 3VOMA 1WYVA 1BJOB 1VJOA 1E5FA 2VMXA 4RJYA 1C4KA 1J32A 1D7SA 3GZDA 4P7YA 1V2DA 4PFFA 2R0TA 2AY5A 1ASDA 2Z9WA 1LS3A 2CJDA 3USFA 2W7MA 1QJ3A 3LVLB 3EI7A 2R5EA 4KXKA 3BWNA 2XBNA 2X8UA 3HL2A 4ZDOA 1D2FA 1AX4A 1Z7DA 3T32A 3WGBA 1P3WA 1LC7A 4A0RA 4HVKA 3LY1A 5TF5A 2WKAA 4Q31A 3ATHA 1S09A 3BC8A 3A9ZA 1BW0A 2FNUA 4K2BA 9AATA 1EG5A 1BQAA 1QIRA 1M0QA 3E2ZA 3GZCA 1GEYA 4XQ2A 1IBJA 3PDBB 4ADDA 3NYSA 2JISA 3PA9A 2BYLA 4UHNA 2PB0A 1N2TA 1SZSA 2TPLA 4RKCA 2BI9A 2BHXA 1G7WA 4IY7A 2ZY4A 4M2KA 3DC1A 4MQQA 5LH9A 1KL2A 5DB5A 3II0A 4U2HA 1ARTA 4GE7A 1ASNA 2D7YA 3FFRA 2HOYA 4E3RA 5G4IA 2CFBA 4ZAHA 4ADCA 4A0HA 3LVJA 2GQNA 4RITA 1J04A 2Z20A 2E7IA 4M2MA 3DU4A 1YIZA 1MAQA 3ZZJA 1GC0A 1C7NA 1LKCA 5HDMA 3WCNA 1N31A 3EUCA 4ATPA 2QB2A 4F5GA 2HOZA 3WGCA 4A00A 1D7RA 3QN6A 2ZY2A 1M32A 4W1XA 1U08A 2VI8A 3HLMA 2HUFA 3GZDC 5J8QA 3RI6A 3HT4A 1BJ4A 4XJMA 2D64A 2D5YA 1AJSB 1IJIA 4TN4A 1ARHA 4IXSA 5DX5A 1ARIA 4DGTA 4OC9A 4KAMA 5BJ3A 3BWNC 4U1TA 4CBSA 2BIGA 1QISA 2G6WA 3AEJA 4LC3A 4BA4A 1S07A 3HDOA 1ELUA 3MAUA 4PVFA 4NOGA 1QZ9A 3MEBA 2DGLA 4AH3A 1PG8A 4F5JA 1V2FA 1ARSA 1N8PA 3MKJA 2PO3A 4ATQA 5E5IA 4PIWA 1H0CA 4ZWVA 3R9AA 1OHYA 1OXPA 1C7OA 3DXWA 1SPAA 2BI3A 2JJHA 3A8UX 1IX7A 1M0PA 3QM2A 4CXRA 1W7MA 4JEYA 4MKKA 3FKDA 2VIBA 2VGZA 2BI5A 1G4VA 5EAVA 2ZP7A 3K7YA 1TOGA 5M4DA 3PJ0A 1T3IA 2GSAA 5EUDA 5FT6A 4K2IA 2BI2A 2VMYA 3WKRA 2E7JA 4L0OA 4XAUA 1W3UA 2ORDA 1GC4A 1ELQA 2HOXA 2W7KA 2YOBA 3Q8NA 4JEZA 4R8DA 3I16A 4A6UA 2W8WA 3KKIA 5F8VA 2Q7WA 2VGVA 3ZRQA 4I8AA 2VIAA 1M4NA 1YJZA 3B1CA 3EIBA 2DOUA 2AEVA 1O69A 1DJ9A 2WK9A 2QMAA 4MQRA 4GRXA 3RBFA 3PPLA 2AY6A 3K28A 2C0RA 2VGTA 3ELPA 2EPJA 3FD0A 3WCOA 2AY9A 1MDXA 3WY7A 4Y0DA 1ZODA 3FZ6A 3TFUA 2Z1YA 2Z9UA 2W7IA 2ZY3A 4ZM4A 1IAYA 4AZKA 4ZSYA 1BS0A 1O4SA 1G7XA 2ZSLA 1AICA 1DGDA 1ASCA 2AY3A 4F5LA 2HUIA 3FFHA 3N0LA 1B8GA 1UKJA 1DFOA 4IYOA 3ELEA 2O1BA 3DRDA 3F9TA 1DJUA 3FQAA 1WYTB 2HORA 2OKJA 1KMJA 4EB7A 1X28A 3GWPA 4J5UA 1C9CA 3PGYA 4ZWMA 3AELA 4ITXA 2HP1A 2FN6A 2JGTA 3VP6A 1KKPA 4IXOA 3QHXA 5EIGA 1WKGA 2VMTA 2XH1A 3CQ4A 4WXFA 5FT8A 2R5CA 1M7YA 1LW4A 4W1WA 2AY7A 3RQ1A 5BJ4A 3JWAA 2V0YA 4LNLA 2VMNA 2BWPA 1AY4A 1WSTA 4GE4A 3H7FA 4IXZA 2FNIA 1AHYA 1LW5A 2YKXA 3PAAA 2VGSA 2CH1A 3BCBA 2ZJGA 4GSAA 2BWOA 3OP7A 2X5FA 3CQ5A 3EI6A 4F5HA 3EZSA 1AY8A 2YCTA 2YRIA 2CINA 2VMWA 2VMUA 4WD2A 3ASBA 3VK3A 1GEXA 3E77A 1RV3A 1DKAA 1ARGA 1XEYA 4RKDA 3HVYA 1S08A 2VMPA 3FCRA 4RM1A 4B98A 4OMAA 2W8JA 3P6KA 4Y0HA 2VLHA 1MAPA 1O62A 2E54A 3EI8A 1FG7A 5HHYA 2BWNA 2Z61A 5IWQA 2VMOA 2Z67A 2W8UA 3E9KA 1DGEA 1CL2A 4WXGA 1UU0A 4XJPA 4AO9A 4EFFA 1AKBA 4AOAA 3MAFB 3BN1A 3F0HA 2DKJA 1MLYA 4GEBA 3ACZA 2F8JA 4AO4A 3LVKA 5FT5A 3DZZA 1IVRA 3EI5A 1PMOA 3G8MA 3JTXA 4WB0B 4BQ0A 1KKJA 1GD9A 3MADA 3BV0A 1QGNA 3KGWA 3QGUA 3HMUA
chains in the Genus database with same CATH superfamily
4R5ZA 5EFSA 1CZEA 1AIAA 1TATA 4XEWA 1X0MA 1AIBA 1DTYA 2RFVA 2PB2A 3IHJA 1BJOA 4R5FA 1ZOBA 2YKYA 1H1CA 3BB8A 4ITGA 1CQ8A 1PMMA 2W7JA 2O7CA 1ECXA 4J8LA 4LNJA 4F5FA 3GBXA 4MKJA 1CZCA 2ZYJA 1D7UA 4F4EA 3ISLA 3OKSA 4F5MA 5F9SA 2OQXA 3PD6B 4WYFA 1LC8A 1AMAA 1UU1A 4AZJA 1CJ0A 5G2PA 1GDEA 3HQTA 4WLJA 3NRAA 2DKBA 2CANA 4A0GA 3WKSA 4HF8A 2AATA 4RIZA 1ASLA 2D61A 2EZ2A 1WYUB 4QGRA 2VMZA 4EB5A 3D6KA 4WLHA 4MSOA 1JF9A 2YCPA 3JU7A 3ZRRA 4ZM3A 3HBXA 3MBBA 3AEOA 4A6TA 1BJWA 3PDBA 3AATA 1ASMA 1CQ7A 3FVXA 5HXXA 1GEWA 1O61A 1GCKA 1YJSA 3LG0A 4GDYA 3A9YA 3RCHB 5EAAA 2YHKA 3TFTA 1MGVA 2WB6A 4UQVA 1WYVB 2AEUA 4ZASA 3ZZKA 4BA5A 1W7NA 2W7GA 4OBUA 4E77A 3DYDA 4ISYA 3L44A 2BIEA 3AEPA 1W23A 5EUEA 3FVUA 2VMRA 3FQ8A 1FC4A 3QI6A 4JEVA 2X3LA 1M0NA 1AAWA 2ZC0A 5G09A 2AY2A 3E2YA 4R2NA 2G7JA 3NUBA 5M46A 1JG8A 4EU1A 1FG3A 2W8VA 4N0BA 2QBTA 1QJ5A 1AJSA 3B1EA 3KE3A 4FL0A 3WZFA 1MLZA 1TOJA 2E7UA 3N75A 1C0NA 3NYUA 2CH2A 3TCMA 4JE5D 3GR9A 5DJ1A 3B8XA 4A72A 2ZY5A 2OKKA 5G2QA 2VI9A 3E2ZB 2W7FA 1X29A 3NNKA 2W7DA 3JWBA 5D95A 3UAKA 3R4TA 1B4XA 3GSBA 3K40A 2CJHA 3PDXA 3RBLA 5AX8A 4A0FA 3E2FA 1AHXA 4W8IA 3WLXA 4JE5A 1UU2A 1B5OA 2C81A 4DBCA 2CB1A 3NUIA 4XJLA 1KAFA 4WYCA 1JS3A 1OHWA 2JJGA 2VMQA 3FZ8A 4OYTA 5G4JA 5I92A 4F5IA 1GBNA 4MY5A 1XI9A 2JG2A 2Z9VA 4WBTA 2O0RA 2BI1A 3FTBA 3NDNA 2CJGA 4IX8A 3FRKA 4A6RA 1MDOA 4KYOA 1AHEA 3F6TA 3AEMA 4TMRA 1AKCA 2D65A 1TPLA 2Z9XA 1TASA 2ZUKA 3A2BA 1AJRA 2C7TA 4W1VA 3W1HA 3COGA 1OXOA 1AHGA 1SVVA 3G7QA 4ZDLA 3BCXA 3MC6A 4MGRA 4UHMA 3DODA 3N4RA 1YOOA 4CXQA 2YCNA 1B9IA 3GETA 1M6SA 2FQ6A 1IX6A 2D66A 4OTLA 3CBFA 2AY1A 2AY4A 2JJFA 4XJOA 3TATA 1Z3ZA 2DGKA 1IAXA 4E3QA 3FZ7A 4P3MA 2WK8A 2JJEA 5LHAA 2YRRA 3I5TA 2W8TA 4LW2A 3VAXA 3DR4A 3GJUA 3I4JA 4H51A 1CQ6A 4Q6RA 1VEFA 1ASGA 2QSRA 1SZKA 4BHDA 2VMVA 1BT4A 1X2AA 4Y0IA 2W7HA 5D5SA 5M4BA 1BJNA 3W1JA 4B9BA 2OGAA 3LVMA 1RVUA 3N4SA 4BMKA 2X5DA 1YIYA 3BCAA 4ADEA 2QLRA 4GE9A 1LC5A 1TOEA 4OBVA 1WYTA 1C7GA 2C44A 2D7ZA 3FQ7A 1AAMA 1CS1A 2VGWA 3AENA 3EIAA 3QBOA 4WYGA 4WXBA 5DJ9A 4RAEA 3B46A 1TOIA 1YJYA 2EO5A 3FDDA 1ASEA 1Y4IA 4RLGA 5JAYA 4XK1A 1I29A 2EH6A 1LK9A 3CQ6A 4Q76A 4MQPA 3AEMC 3KGXA 3ECDA 4ZDPA 1KMKA 3ASAA 4JF1A 3NYTA 3VK4A 1QITA 1OHVA 1ASBA 1EJIA 2OGEA 3EZ1A 4M2JA 1M0OA 5FT4A 3UWCA 2V1PA 4UOYA 2FM1A 4OT8A 1DJEA 3N5MA 1SZUA 3JZLA 1AMRA 4JEWA 2VLFA 3MC6C 4WYAA 5EUNA 2HP2A 5M49A 3L8AA 1IUGA 2GMUA 1EQBA 3NU8A 4W5KA 1YAAA 4TV7A 1E5EA 2EGYA 1AMSA 2AY8A 4O6ZA 4F5KA 5E3KA 1S0AA 3G0TA 3W1IA 2D63A 3WX9A 1KL1A 4UHOA 4WP0A 4WYEA 1I43A 1VP4A 4IW7A 1B9HA 2HZPA 1SFFA 2ZSMA 3VK2A 3H14A 4IYOB 4N0WA 2VGUA 5C6UA 1S06A 4ZLVA 3DR7A 5G0AA 2BYJA 1BKGA 2OATA 1ASFA 1GC2A 1ORDA 3DXVA 1I48A 3LWSA 3JW9A 3FDBA 1AHFA 1D7VA 1GC3A 1JS6A 3BWOA 1PFFA 1RV4A 1SF2A 2BIAA 3FVSA 3NTJA 3PIUA 4EMYA 1TARA 3MAFA 1I41A 1V72A 2W7EA 3E6GA 2DGMA 1AKAA 2W7LA 3AV7A 5EIGB 2NMPA 1OATA 3P1TA 2QB3A 4WB0A 2CY8A 5EQCA 2R5CB 3NX3A 4ADBA 3LV2A 1CL1A 3AOWA 5E4ZA 1AMQA 3NU7A 4ZSWA 1G4XA 3QPGA 1V2EA 4CVQA 4JEXA 4LNMA 3B1DA 2QA3A 1AY5A 4OCAA 4CBRA 4Q75A 2FYFA 3IF2A 3H9XA 1B5PA 4K2MA 2EZ1A 3TQXA 1RVYA 3UE8A 8AATA 2R2NA 3RUYA 3M5UA 2CSTA 3EI9A 1ZC9A 2GMSA 1WKHA 3PD6A 4LW4A 1TOKA 3ZRPA 1MDZA 5K8BA 2BKWA 4JF0A 2Z1ZA 2HUUA 1W7LA 7AATA 4PFNA 1BQDA 2GB3A 3AEJC 1WYUA 2YKUA 4WYDA 2DR1A 2WK7A 4FFCA 2VMSA 2CTZA 4RJ0A 3BS8A 4DQ6A 2YKVA 4E1OA 1IX8A 4W91A 3RCHA 3AOVA 3CAIA 2VYCA 3A9XA 1ASAA 1YNUA 3AENB 3FSLA 3VOMA 1WYVA 1BJOB 1VJOA 1E5FA 2VMXA 4RJYA 1C4KA 1J32A 1D7SA 3GZDA 4P7YA 1V2DA 4PFFA 2R0TA 2AY5A 1ASDA 2Z9WA 1LS3A 2CJDA 3USFA 2W7MA 1QJ3A 3LVLB 3EI7A 2R5EA 4KXKA 3BWNA 2XBNA 2X8UA 3HL2A 4ZDOA 1D2FA 1AX4A 1Z7DA 3T32A 3WGBA 1P3WA 1LC7A 4A0RA 4HVKA 3LY1A 5TF5A 2WKAA 4Q31A 3ATHA 1S09A 3BC8A 3A9ZA 1BW0A 2FNUA 4K2BA 9AATA 1EG5A 1BQAA 1QIRA 1M0QA 3E2ZA 3GZCA 1GEYA 4XQ2A 1IBJA 3PDBB 4ADDA 3NYSA 2JISA 3PA9A 2BYLA 4UHNA 2PB0A 1N2TA 1SZSA 2TPLA 4RKCA 2BI9A 2BHXA 1G7WA 4IY7A 2ZY4A 4M2KA 3DC1A 4MQQA 5LH9A 1KL2A 5DB5A 3II0A 4U2HA 1ARTA 4GE7A 1ASNA 2D7YA 3FFRA 2HOYA 4E3RA 5G4IA 2CFBA 4ZAHA 4ADCA 4A0HA 3LVJA 2GQNA 4RITA 1J04A 2Z20A 2E7IA 4M2MA 3DU4A 1YIZA 1MAQA 3ZZJA 1GC0A 1C7NA 1LKCA 5HDMA 3WCNA 1N31A 3EUCA 4ATPA 2QB2A 4F5GA 2HOZA 3WGCA 4A00A 1D7RA 3QN6A 2ZY2A 1M32A 4W1XA 1U08A 2VI8A 3HLMA 2HUFA 3GZDC 5J8QA 3RI6A 3HT4A 1BJ4A 2FKIA 4XJMA 2D64A 2EYQA 2D5YA 1AJSB 1IJIA 4TN4A 1ARHA 4IXSA 5DX5A 1ARIA 4DGTA 4OC9A 4KAMA 5BJ3A 3BWNC 4U1TA 4CBSA 2BIGA 1QISA 2G6WA 3AEJA 4LC3A 4BA4A 1S07A 3HDOA 1ELUA 3MAUA 4PVFA 4NOGA 1QZ9A 3MEBA 3N4XA 2DGLA 4AH3A 1PG8A 4F5JA 1V2FA 1ARSA 1N8PA 3MKJA 2PO3A 4ATQA 5E5IA 4PIWA 1H0CA 4ZWVA 3R9AA 1OHYA 1OXPA 1C7OA 3DXWA 1SPAA 2BI3A 2JJHA 3A8UX 1IX7A 1M0PA 3QM2A 4CXRA 1W7MA 4JEYA 4MKKA 3FKDA 2VIBA 2VGZA 2BI5A 1G4VA 5EAVA 2ZP7A 3K7YA 1TOGA 5M4DA 3PJ0A 1T3IA 2GSAA 5EUDA 5FT6A 4K2IA 2BI2A 2VMYA 3WKRA 2E7JA 4L0OA 4XAUA 1W3UA 2ORDA 1GC4A 1ELQA 2HOXA 2W7KA 2YOBA 3Q8NA 4JEZA 4R8DA 3I16A 4A6UA 2W8WA 3KKIA 5F8VA 2Q7WA 2VGVA 3ZRQA 4I8AA 2VIAA 1M4NA 1YJZA 3B1CA 3EIBA 2DOUA 2AEVA 1O69A 1DJ9A 2WK9A 2QMAA 4MQRA 4GRXA 3RBFA 3PPLA 2AY6A 3K28A 2C0RA 2VGTA 3ELPA 2EPJA 3FD0A 3WCOA 2AY9A 1MDXA 3WY7A 4Y0DA 1ZODA 3FZ6A 3TFUA 2Z1YA 2Z9UA 2W7IA 2ZY3A 4ZM4A 1IAYA 4AZKA 4ZSYA 1BS0A 1O4SA 1G7XA 2ZSLA 1AICA 1DGDA 2A1VA 1ASCA 2AY3A 4F5LA 2HUIA 3FFHA 3N0LA 1B8GA 1UKJA 1DFOA 4IYOA 3ELEA 2O1BA 3DRDA 3F9TA 1DJUA 3FQAA 1WYTB 2HORA 2OKJA 1KMJA 4EB7A 1X28A 3GWPA 4J5UA 1C9CA 3PGYA 4ZWMA 3AELA 4ITXA 2HP1A 2FN6A 2JGTA 3VP6A 1KKPA 4IXOA 3QHXA 5EIGA 1WKGA 2VMTA 2XH1A 3CQ4A 4WXFA 5FT8A 4H63Q 2R5CA 1M7YA 1LW4A 4W1WA 2AY7A 3RQ1A 5BJ4A 3JWAA 2V0YA 4LNLA 2VMNA 2BWPA 1AY4A 1WSTA 4GE4A 3H7FA 4IXZA 2FNIA 1AHYA 1LW5A 2YKXA 3PAAA 2VGSA 2CH1A 3BCBA 2ZJGA 4GSAA 2BWOA 3OP7A 2X5FA 3CQ5A 3EI6A 4F5HA 3EZSA 1AY8A 2YCTA 2YRIA 5KTBA 2CINA 2VMWA 2VMUA 4WD2A 3ASBA 3VK3A 1GEXA 3E77A 1RV3A 1DKAA 1ARGA 1XEYA 4RKDA 4K05A 3HVYA 1S08A 2VMPA 3FCRA 4RM1A 4B98A 4OMAA 2W8JA 3P6KA 4Y0HA 2VLHA 1MAPA 1O62A 2E54A 3EI8A 3N7NA 1FG7A 5HHYA 2BWNA 2Z61A 5IWQA 2VMOA 2Z67A 2W8UA 3E9KA 1DGEA 1CL2A 4WXGA 1UU0A 4XJPA 4AO9A 4EFFA 2KFPA 1AKBA 4AOAA 3MAFB 3BN1A 3F0HA 2DKJA 1MLYA 4GEBA 3ACZA 2F8JA 4AO4A 3LVKA 5FT5A 3DZZA 1IVRA 3EI5A 1PMOA 3G8MA 3JTXA 4WB0B 4BQ0A 1KKJA 1GD9A 3MADA 3BV0A 1QGNA 3KGWA 3QGUA 3HMUA
chains in the Genus database with same CATH topology
4R5ZA 5EFSA 1CZEA 1AIAA 1TATA 4XEWA 1X0MA 1AIBA 1DTYA 2RFVA 2PB2A 3IHJA 1BJOA 4R5FA 1ZOBA 2YKYA 1H1CA 3BB8A 4ITGA 1CQ8A 1PMMA 2W7JA 2O7CA 1ECXA 4J8LA 4LNJA 4F5FA 3GBXA 4MKJA 1CZCA 2ZYJA 1D7UA 4F4EA 3ISLA 3OKSA 4F5MA 5F9SA 2OQXA 3PD6B 4WYFA 1LC8A 1AMAA 1UU1A 4AZJA 1CJ0A 5G2PA 1GDEA 3HQTA 4WLJA 3NRAA 2DKBA 2CANA 4A0GA 3WKSA 4HF8A 2AATA 4RIZA 1ASLA 2D61A 2EZ2A 1WYUB 4QGRA 2VMZA 4EB5A 3D6KA 4WLHA 4MSOA 1JF9A 2YCPA 3JU7A 3ZRRA 4ZM3A 3HBXA 3MBBA 3AEOA 4A6TA 1BJWA 3PDBA 3AATA 1ASMA 1CQ7A 3FVXA 5HXXA 1GEWA 1O61A 1GCKA 1YJSA 3LG0A 4GDYA 3A9YA 3RCHB 5EAAA 2YHKA 3TFTA 1MGVA 2WB6A 4UQVA 1WYVB 2AEUA 4ZASA 3ZZKA 4BA5A 1W7NA 2W7GA 4OBUA 4E77A 3DYDA 4ISYA 3L44A 2BIEA 3AEPA 1W23A 5EUEA 3FVUA 2VMRA 3FQ8A 1FC4A 3QI6A 4JEVA 2X3LA 1M0NA 1AAWA 2ZC0A 5G09A 2AY2A 3E2YA 4R2NA 2G7JA 3NUBA 5M46A 1JG8A 4EU1A 1FG3A 2W8VA 4N0BA 2QBTA 1QJ5A 1AJSA 3B1EA 3KE3A 4FL0A 3WZFA 1MLZA 1TOJA 2E7UA 3N75A 1C0NA 3NYUA 2CH2A 3TCMA 4JE5D 3GR9A 5DJ1A 3B8XA 4A72A 2ZY5A 2OKKA 5G2QA 2VI9A 3E2ZB 2W7FA 1X29A 3NNKA 2W7DA 3JWBA 5D95A 3UAKA 3R4TA 1B4XA 3GSBA 3K40A 2CJHA 3PDXA 3RBLA 5AX8A 4A0FA 3E2FA 1AHXA 4W8IA 3WLXA 4JE5A 1UU2A 1B5OA 2C81A 4DBCA 2CB1A 3NUIA 4XJLA 4WYCA 1JS3A 1OHWA 2JJGA 2VMQA 3FZ8A 4OYTA 5G4JA 5I92A 4F5IA 1GBNA 4MY5A 1XI9A 2JG2A 2Z9VA 4WBTA 2O0RA 2BI1A 3FTBA 3NDNA 2CJGA 4IX8A 3FRKA 4A6RA 1MDOA 4KYOA 1AHEA 3F6TA 3AEMA 4TMRA 1AKCA 2D65A 1TPLA 2Z9XA 1TASA 2ZUKA 3A2BA 1AJRA 2C7TA 4W1VA 3W1HA 3COGA 1OXOA 1AHGA 1SVVA 3G7QA 4ZDLA 3BCXA 3MC6A 4MGRA 4UHMA 3DODA 3N4RA 1YOOA 4CXQA 2YCNA 1B9IA 3GETA 1M6SA 2FQ6A 1IX6A 2D66A 4OTLA 3CBFA 2AY1A 2AY4A 2JJFA 4XJOA 3TATA 1Z3ZA 2DGKA 1IAXA 4E3QA 3FZ7A 4P3MA 2WK8A 2JJEA 5LHAA 2YRRA 3I5TA 2W8TA 4LW2A 3VAXA 3DR4A 3GJUA 3I4JA 4H51A 1CQ6A 4Q6RA 1VEFA 1ASGA 2QSRA 1SZKA 4BHDA 2VMVA 1BT4A 1X2AA 4Y0IA 2W7HA 5D5SA 5M4BA 1BJNA 3W1JA 4B9BA 2OGAA 3LVMA 1RVUA 3N4SA 4BMKA 2X5DA 1YIYA 3BCAA 4ADEA 2QLRA 4GE9A 1LC5A 1TOEA 4OBVA 1WYTA 1C7GA 2C44A 2D7ZA 3FQ7A 1AAMA 1CS1A 2VGWA 3AENA 3EIAA 3QBOA 4WYGA 4WXBA 5DJ9A 4RAEA 3B46A 1TOIA 1YJYA 2EO5A 3FDDA 1ASEA 1Y4IA 4RLGA 5JAYA 4XK1A 1I29A 2EH6A 1LK9A 3CQ6A 4Q76A 4MQPA 3AEMC 3KGXA 3ECDA 4ZDPA 1KMKA 3ASAA 4JF1A 3NYTA 3VK4A 1QITA 1OHVA 1ASBA 1EJIA 2OGEA 3EZ1A 4M2JA 1M0OA 5FT4A 3UWCA 2V1PA 4UOYA 2FM1A 4OT8A 1DJEA 3N5MA 1SZUA 3JZLA 1AMRA 4JEWA 2VLFA 3MC6C 4WYAA 5EUNA 2HP2A 5M49A 3L8AA 1IUGA 2GMUA 1EQBA 3NU8A 4W5KA 1YAAA 4TV7A 1E5EA 2EGYA 1AMSA 2AY8A 4O6ZA 4F5KA 5E3KA 1S0AA 3G0TA 3W1IA 2D63A 3WX9A 1KL1A 4UHOA 4WP0A 4WYEA 1I43A 1VP4A 4IW7A 1B9HA 2HZPA 1SFFA 2ZSMA 3VK2A 3H14A 4IYOB 4N0WA 2VGUA 5C6UA 1S06A 4ZLVA 3DR7A 5G0AA 2BYJA 1BKGA 2OATA 1ASFA 1GC2A 1ORDA 3DXVA 1I48A 3LWSA 3JW9A 3FDBA 1AHFA 1D7VA 1GC3A 1JS6A 3BWOA 1PFFA 1RV4A 1SF2A 2BIAA 3FVSA 3NTJA 3PIUA 4EMYA 1TARA 3MAFA 1I41A 1V72A 2W7EA 3E6GA 2DGMA 1AKAA 2W7LA 3AV7A 5EIGB 2NMPA 1OATA 3P1TA 2QB3A 4WB0A 2CY8A 5EQCA 2R5CB 3NX3A 4ADBA 3LV2A 1CL1A 3AOWA 5E4ZA 1AMQA 3NU7A 4ZSWA 1G4XA 3QPGA 1V2EA 4CVQA 4JEXA 4LNMA 3B1DA 2QA3A 1AY5A 4OCAA 4CBRA 4Q75A 2FYFA 3IF2A 3H9XA 1B5PA 4K2MA 2EZ1A 3TQXA 1RVYA 3UE8A 8AATA 2R2NA 3RUYA 3M5UA 2CSTA 3EI9A 1ZC9A 2GMSA 1WKHA 3PD6A 4LW4A 1TOKA 3ZRPA 1MDZA 5K8BA 2BKWA 4JF0A 2Z1ZA 2HUUA 1W7LA 7AATA 4PFNA 1BQDA 2GB3A 3AEJC 1WYUA 2YKUA 4WYDA 2DR1A 2WK7A 4FFCA 2VMSA 2CTZA 4RJ0A 3BS8A 4DQ6A 2YKVA 4E1OA 1IX8A 4W91A 3RCHA 3AOVA 3CAIA 2VYCA 3A9XA 1ASAA 1YNUA 3AENB 3FSLA 3VOMA 1WYVA 1BJOB 1VJOA 1E5FA 2VMXA 4RJYA 1C4KA 1J32A 1D7SA 3GZDA 4P7YA 1V2DA 4PFFA 2R0TA 2AY5A 1ASDA 2Z9WA 1LS3A 2CJDA 3USFA 2W7MA 1QJ3A 3LVLB 3EI7A 2R5EA 4KXKA 3BWNA 2XBNA 2X8UA 3HL2A 4ZDOA 1D2FA 1AX4A 1Z7DA 3T32A 3WGBA 1P3WA 1LC7A 4A0RA 4HVKA 3LY1A 5TF5A 2WKAA 4Q31A 3ATHA 1S09A 3BC8A 3A9ZA 1BW0A 2FNUA 4K2BA 9AATA 1EG5A 1BQAA 1QIRA 1M0QA 3E2ZA 3GZCA 1GEYA 4XQ2A 1IBJA 3PDBB 4ADDA 3NYSA 2JISA 3PA9A 2BYLA 4UHNA 2PB0A 1N2TA 1SZSA 2TPLA 4RKCA 2BI9A 2BHXA 1G7WA 4IY7A 2ZY4A 4M2KA 3DC1A 4MQQA 5LH9A 1KL2A 5DB5A 3II0A 4U2HA 1ARTA 4GE7A 1ASNA 2D7YA 3FFRA 2HOYA 4E3RA 5G4IA 2CFBA 4ZAHA 4ADCA 4A0HA 3LVJA 2GQNA 4RITA 1J04A 2Z20A 2E7IA 4M2MA 3DU4A 1YIZA 1MAQA 3ZZJA 1GC0A 1C7NA 1LKCA 5HDMA 3WCNA 1N31A 3EUCA 4ATPA 2QB2A 4F5GA 2HOZA 3WGCA 4A00A 1D7RA 3QN6A 2ZY2A 1M32A 4W1XA 1U08A 2VI8A 3HLMA 2HUFA 3GZDC 5J8QA 3RI6A 3HT4A 1BJ4A 2FKIA 4XJMA 2D64A 2EYQA 2D5YA 1AJSB 1IJIA 4TN4A 1ARHA 4IXSA 5DX5A 1ARIA 4DGTA 4OC9A 4KAMA 5BJ3A 3BWNC 4U1TA 4CBSA 2BIGA 1QISA 2G6WA 3AEJA 4LC3A 4BA4A 1S07A 3HDOA 1ELUA 3MAUA 4PVFA 4NOGA 1QZ9A 3MEBA 3N4XA 2DGLA 4AH3A 1PG8A 4F5JA 1V2FA 1ARSA 1N8PA 3MKJA 2PO3A 4ATQA 5E5IA 4PIWA 1H0CA 4ZWVA 3R9AA 1OHYA 1OXPA 1C7OA 3DXWA 1SPAA 2BI3A 2JJHA 3A8UX 1IX7A 1M0PA 3QM2A 4CXRA 1W7MA 4JEYA 4MKKA 3FKDA 2VIBA 2VGZA 2BI5A 1G4VA 5EAVA 2ZP7A 3K7YA 1TOGA 5M4DA 3PJ0A 1T3IA 2GSAA 5EUDA 5FT6A 4K2IA 2BI2A 2VMYA 3WKRA 2E7JA 4L0OA 4XAUA 1W3UA 2ORDA 1GC4A 1ELQA 2HOXA 2W7KA 2YOBA 3Q8NA 4JEZA 4R8DA 3I16A 4A6UA 2W8WA 3KKIA 5F8VA 2Q7WA 2VGVA 3ZRQA 4I8AA 2VIAA 1M4NA 1YJZA 3B1CA 3EIBA 2DOUA 2AEVA 1O69A 1DJ9A 2WK9A 2QMAA 4MQRA 4GRXA 3RBFA 3PPLA 2AY6A 3K28A 2C0RA 2VGTA 3ELPA 2EPJA 3FD0A 3WCOA 2AY9A 1MDXA 3WY7A 4Y0DA 1ZODA 3FZ6A 3TFUA 2Z1YA 2Z9UA 2W7IA 2ZY3A 4ZM4A 1IAYA 4AZKA 4ZSYA 1BS0A 1O4SA 1G7XA 2ZSLA 1AICA 1DGDA 2A1VA 1ASCA 2AY3A 4F5LA 2HUIA 3FFHA 3N0LA 1B8GA 1UKJA 1DFOA 4IYOA 3ELEA 2O1BA 3DRDA 3F9TA 1DJUA 3FQAA 1WYTB 2HORA 2OKJA 1KMJA 4EB7A 1X28A 3GWPA 4J5UA 1C9CA 3PGYA 4ZWMA 3AELA 4ITXA 2HP1A 2FN6A 2JGTA 3VP6A 1KKPA 4IXOA 3QHXA 5EIGA 1WKGA 2VMTA 2XH1A 3CQ4A 4WXFA 5FT8A 4H63Q 2R5CA 1M7YA 1LW4A 4W1WA 2AY7A 3RQ1A 5BJ4A 3JWAA 2V0YA 4LNLA 2VMNA 2BWPA 1AY4A 1WSTA 4GE4A 3H7FA 4IXZA 2FNIA 1AHYA 1LW5A 2YKXA 3PAAA 2VGSA 2CH1A 3BCBA 2ZJGA 4GSAA 2BWOA 3OP7A 2X5FA 3CQ5A 3EI6A 4F5HA 3EZSA 1AY8A 2YCTA 2YRIA 5KTBA 2CINA 2VMWA 2VMUA 4WD2A 3ASBA 3VK3A 1GEXA 3E77A 1RV3A 1DKAA 1ARGA 1XEYA 4RKDA 4K05A 3HVYA 1S08A 2VMPA 3FCRA 4RM1A 4B98A 4OMAA 2W8JA 3P6KA 4Y0HA 2VLHA 1MAPA 1O62A 2E54A 3EI8A 3N7NA 1FG7A 5HHYA 2BWNA 2Z61A 5IWQA 2VMOA 2Z67A 2W8UA 3E9KA 1DGEA 1CL2A 4WXGA 1UU0A 4XJPA 4AO9A 4EFFA 2KFPA 1AKBA 4AOAA 3MAFB 3BN1A 3F0HA 2DKJA 1MLYA 4GEBA 3ACZA 2F8JA 4AO4A 3LVKA 5FT5A 3DZZA 1IVRA 3EI5A 1PMOA 3G8MA 3JTXA 4WB0B 4BQ0A 1KKJA 1GD9A 3MADA 3BV0A 1QGNA 3KGWA 3QGUA 3HMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R5Z A;  5EFS A;  1CZE A;  1AIA A;  1TAT A;  4XEW A;  1X0M A;  1AIB A;  1DTY A;  2RFV A;  2PB2 A;  3IHJ A;  1BJO A;  4R5F A;  1ZOB A;  2YKY A;  1H1C A;  3BB8 A;  4ITG A;  1CQ8 A;  1PMM A;  2W7J A;  2O7C A;  1ECX A;  4J8L A;  4LNJ A;  4F5F A;  3GBX A;  4MKJ A;  1CZC A;  2ZYJ A;  1D7U A;  4F4E A;  3ISL A;  3OKS A;  4F5M A;  5F9S A;  2OQX A;  3PD6 B;  4WYF A;  1LC8 A;  1AMA A;  1UU1 A;  4AZJ A;  1CJ0 A;  5G2P A;  1GDE A;  3HQT A;  4WLJ A;  3NRA A;  2DKB A;  2CAN A;  4A0G A;  3WKS A;  4HF8 A;  2AAT A;  4RIZ A;  1ASL A;  2D61 A;  2EZ2 A;  1WYU B;  4QGR A;  2VMZ A;  4EB5 A;  3D6K A;  4WLH A;  4MSO A;  1JF9 A;  2YCP A;  3JU7 A;  3ZRR A;  4ZM3 A;  3HBX A;  3MBB A;  3AEO A;  4A6T A;  1BJW A;  3PDB A;  3AAT A;  1ASM A;  1CQ7 A;  3FVX A;  5HXX A;  1GEW A;  1O61 A;  1GCK A;  1YJS A;  3LG0 A;  4GDY A;  3A9Y A;  3RCH B;  5EAA A;  2YHK A;  3TFT A;  1MGV A;  4UQV A;  1WYV B;  2AEU A;  4ZAS A;  3ZZK A;  4BA5 A;  1W7N A;  2W7G A;  4OBU A;  4E77 A;  3DYD A;  4ISY A;  3L44 A;  2BIE A;  3AEP A;  1W23 A;  5EUE A;  3FVU A;  2VMR A;  3FQ8 A;  1FC4 A;  3QI6 A;  4JEV A;  2X3L A;  1M0N A;  1AAW A;  2ZC0 A;  5G09 A;  2AY2 A;  3E2Y A;  4R2N A;  3NUB A;  5M46 A;  1JG8 A;  4EU1 A;  1FG3 A;  2W8V A;  4N0B A;  2QBT A;  1QJ5 A;  1AJS A;  3B1E A;  3KE3 A;  4FL0 A;  3WZF A;  1MLZ A;  1TOJ A;  2E7U A;  3N75 A;  1C0N A;  3NYU A;  2CH2 A;  3TCM A;  4JE5 D;  3GR9 A;  5DJ1 A;  3B8X A;  4A72 A;  2ZY5 A;  2OKK A;  5G2Q A;  2VI9 A;  3E2Z B;  2W7F A;  1X29 A;  3NNK A;  2W7D A;  3JWB A;  5D95 A;  3UAK A;  3R4T A;  1B4X A;  3GSB A;  3K40 A;  2CJH A;  3PDX A;  3RBL A;  5AX8 A;  4A0F A;  3E2F A;  1AHX A;  4W8I A;  3WLX A;  4JE5 A;  1UU2 A;  1B5O A;  2C81 A;  4DBC A;  2CB1 A;  3NUI A;  4XJL A;  4WYC A;  1JS3 A;  1OHW A;  2JJG A;  2VMQ A;  3FZ8 A;  4OYT A;  5G4J A;  5I92 A;  4F5I A;  1GBN A;  4MY5 A;  1XI9 A;  2JG2 A;  2Z9V A;  4WBT A;  2O0R A;  2BI1 A;  3FTB A;  3NDN A;  2CJG A;  4IX8 A;  3FRK A;  4A6R A;  1MDO A;  4KYO A;  1AHE A;  3F6T A;  3AEM A;  4TMR A;  1AKC A;  2D65 A;  1TPL A;  2Z9X A;  1TAS A;  2ZUK A;  3A2B A;  1AJR A;  2C7T A;  4W1V A;  3W1H A;  3COG A;  1OXO A;  1AHG A;  1SVV A;  3G7Q A;  4ZDL A;  3BCX A;  3MC6 A;  4MGR A;  4UHM A;  3DOD A;  1YOO A;  4CXQ A;  2YCN A;  1B9I A;  3GET A;  1M6S A;  2FQ6 A;  1IX6 A;  2D66 A;  4OTL A;  3CBF A;  2AY1 A;  2AY4 A;  2JJF A;  4XJO A;  3TAT A;  1Z3Z A;  2DGK A;  1IAX A;  4E3Q A;  3FZ7 A;  4P3M A;  2WK8 A;  2JJE A;  5LHA A;  2YRR A;  3I5T A;  2W8T A;  4LW2 A;  3VAX A;  3DR4 A;  3GJU A;  3I4J A;  4H51 A;  1CQ6 A;  4Q6R A;  1VEF A;  1ASG A;  1SZK A;  4BHD A;  2VMV A;  1BT4 A;  1X2A A;  4Y0I A;  2W7H A;  5D5S A;  5M4B A;  1BJN A;  3W1J A;  4B9B A;  2OGA A;  3LVM A;  1RVU A;  4BMK A;  2X5D A;  1YIY A;  3BCA A;  4ADE A;  2QLR A;  4GE9 A;  1LC5 A;  1TOE A;  4OBV A;  1WYT A;  1C7G A;  2C44 A;  2D7Z A;  3FQ7 A;  1AAM A;  1CS1 A;  2VGW A;  3AEN A;  3EIA A;  3QBO A;  4WYG A;  4WXB A;  5DJ9 A;  4RAE A;  3B46 A;  1TOI A;  1YJY A;  2EO5 A;  3FDD A;  1ASE A;  1Y4I A;  4RLG A;  5JAY A;  4XK1 A;  1I29 A;  2EH6 A;  1LK9 A;  3CQ6 A;  4Q76 A;  4MQP A;  3AEM C;  3KGX A;  3ECD A;  4ZDP A;  1KMK A;  3ASA A;  4JF1 A;  3NYT A;  3VK4 A;  1QIT A;  1OHV A;  1ASB A;  1EJI A;  2OGE A;  3EZ1 A;  4M2J A;  1M0O A;  5FT4 A;  3UWC A;  2V1P A;  4UOY A;  2FM1 A;  4OT8 A;  1DJE A;  3N5M A;  1SZU A;  3JZL A;  1AMR A;  4JEW A;  2VLF A;  3MC6 C;  4WYA A;  5EUN A;  2HP2 A;  5M49 A;  3L8A A;  1IUG A;  2GMU A;  1EQB A;  3NU8 A;  4W5K A;  1YAA A;  4TV7 A;  1E5E A;  2EGY A;  1AMS A;  2AY8 A;  4O6Z A;  4F5K A;  5E3K A;  1S0A A;  3G0T A;  3W1I A;  2D63 A;  3WX9 A;  1KL1 A;  4UHO A;  4WP0 A;  4WYE A;  1I43 A;  1VP4 A;  4IW7 A;  1B9H A;  2HZP A;  1SFF A;  2ZSM A;  3VK2 A;  3H14 A;  4IYO B;  4N0W A;  2VGU A;  5C6U A;  1S06 A;  4ZLV A;  3DR7 A;  5G0A A;  2BYJ A;  1BKG A;  2OAT A;  1ASF A;  1GC2 A;  1ORD A;  3DXV A;  1I48 A;  3LWS A;  3JW9 A;  3FDB A;  1AHF A;  1D7V A;  1GC3 A;  1JS6 A;  3BWO A;  1PFF A;  1RV4 A;  1SF2 A;  2BIA A;  3FVS A;  3NTJ A;  3PIU A;  4EMY A;  1TAR A;  3MAF A;  1I41 A;  1V72 A;  2W7E A;  3E6G A;  2DGM A;  1AKA A;  2W7L A;  3AV7 A;  5EIG B;  2NMP A;  1OAT A;  3P1T A;  2QB3 A;  4WB0 A;  2CY8 A;  5EQC A;  2R5C B;  3NX3 A;  4ADB A;  3LV2 A;  1CL1 A;  3AOW A;  5E4Z A;  1AMQ A;  3NU7 A;  4ZSW A;  1G4X A;  3QPG A;  1V2E A;  4CVQ A;  4JEX A;  4LNM A;  3B1D A;  2QA3 A;  1AY5 A;  4OCA A;  4CBR A;  4Q75 A;  2FYF A;  3IF2 A;  1B5P A;  4K2M A;  2EZ1 A;  3TQX A;  1RVY A;  3UE8 A;  8AAT A;  2R2N A;  3RUY A;  3M5U A;  2CST A;  3EI9 A;  1ZC9 A;  2GMS A;  1WKH A;  3PD6 A;  4LW4 A;  1TOK A;  3ZRP A;  1MDZ A;  5K8B A;  2BKW A;  4JF0 A;  2Z1Z A;  2HUU A;  1W7L A;  7AAT A;  4PFN A;  1BQD A;  2GB3 A;  3AEJ C;  1WYU A;  2YKU A;  4WYD A;  2DR1 A;  2WK7 A;  4FFC A;  2VMS A;  2CTZ A;  4RJ0 A;  3BS8 A;  4DQ6 A;  2YKV A;  4E1O A;  1IX8 A;  4W91 A;  3RCH A;  3AOV A;  3CAI A;  2VYC A;  3A9X A;  1ASA A;  1YNU A;  3AEN B;  3FSL A;  3VOM A;  1WYV A;  1BJO B;  1VJO A;  1E5F A;  2VMX A;  4RJY A;  1C4K A;  1J32 A;  1D7S A;  3GZD A;  4P7Y A;  1V2D A;  4PFF A;  2R0T A;  2AY5 A;  1ASD A;  2Z9W A;  1LS3 A;  2CJD A;  3USF A;  2W7M A;  1QJ3 A;  3LVL B;  3EI7 A;  2R5E A;  4KXK A;  3BWN A;  2XBN A;  2X8U A;  3HL2 A;  4ZDO A;  1D2F A;  1AX4 A;  1Z7D A;  3T32 A;  3WGB A;  1P3W A;  1LC7 A;  4A0R A;  4HVK A;  3LY1 A;  5TF5 A;  2WKA A;  4Q31 A;  3ATH A;  1S09 A;  3BC8 A;  3A9Z A;  1BW0 A;  2FNU A;  4K2B A;  9AAT A;  1EG5 A;  1BQA A;  1QIR A;  1M0Q A;  3E2Z A;  3GZC A;  1GEY A;  4XQ2 A;  1IBJ A;  3PDB B;  4ADD A;  3NYS A;  2JIS A;  3PA9 A;  2BYL A;  4UHN A;  2PB0 A;  1N2T A;  1SZS A;  2TPL A;  4RKC A;  2BI9 A;  2BHX A;  1G7W A;  4IY7 A;  2ZY4 A;  4M2K A;  3DC1 A;  4MQQ A;  5LH9 A;  1KL2 A;  5DB5 A;  3II0 A;  4U2H A;  1ART A;  4GE7 A;  1ASN A;  2D7Y A;  3FFR A;  2HOY A;  4E3R A;  5G4I A;  2CFB A;  4ZAH A;  4ADC A;  4A0H A;  3LVJ A;  2GQN A;  4RIT A;  1J04 A;  2Z20 A;  2E7I A;  4M2M A;  3DU4 A;  1YIZ A;  1MAQ A;  3ZZJ A;  1GC0 A;  1C7N A;  1LKC A;  5HDM A;  3WCN A;  1N31 A;  3EUC A;  4ATP A;  2QB2 A;  4F5G A;  2HOZ A;  3WGC A;  4A00 A;  1D7R A;  3QN6 A;  2ZY2 A;  1M32 A;  4W1X A;  1U08 A;  2VI8 A;  3HLM A;  2HUF A;  3GZD C;  5J8Q A;  3RI6 A;  3HT4 A;  1BJ4 A;  4XJM A;  2D64 A;  2D5Y A;  1AJS B;  1IJI A;  4TN4 A;  1ARH A;  4IXS A;  5DX5 A;  1ARI A;  4DGT A;  4OC9 A;  4KAM A;  5BJ3 A;  3BWN C;  4U1T A;  4CBS A;  2BIG A;  1QIS A;  2G6W A;  3AEJ A;  4LC3 A;  4BA4 A;  1S07 A;  3HDO A;  1ELU A;  3MAU A;  4PVF A;  4NOG A;  1QZ9 A;  3MEB A;  2DGL A;  4AH3 A;  1PG8 A;  4F5J A;  1V2F A;  1ARS A;  1N8P A;  3MKJ A;  2PO3 A;  4ATQ A;  5E5I A;  4PIW A;  1H0C A;  4ZWV A;  3R9A A;  1OHY A;  1OXP A;  1C7O A;  3DXW A;  1SPA A;  2BI3 A;  2JJH A;  3A8U X;  1IX7 A;  1M0P A;  3QM2 A;  4CXR A;  1W7M A;  4JEY A;  4MKK A;  3FKD A;  2VIB A;  2VGZ A;  2BI5 A;  1G4V A;  5EAV A;  2ZP7 A;  3K7Y A;  1TOG A;  5M4D A;  3PJ0 A;  1T3I A;  2GSA A;  5EUD A;  5FT6 A;  4K2I A;  2BI2 A;  2VMY A;  3WKR A;  2E7J A;  4L0O A;  4XAU A;  1W3U A;  2ORD A;  1GC4 A;  1ELQ A;  2HOX A;  2W7K A;  2YOB A;  3Q8N A;  4JEZ A;  4R8D A;  3I16 A;  4A6U A;  2W8W A;  3KKI A;  5F8V A;  2Q7W A;  2VGV A;  3ZRQ A;  4I8A A;  2VIA A;  1M4N A;  1YJZ A;  3B1C A;  3EIB A;  2DOU A;  2AEV A;  1O69 A;  1DJ9 A;  2WK9 A;  2QMA A;  4MQR A;  4GRX A;  3RBF A;  3PPL A;  2AY6 A;  3K28 A;  2C0R A;  2VGT A;  3ELP A;  2EPJ A;  3FD0 A;  3WCO A;  2AY9 A;  1MDX A;  3WY7 A;  4Y0D A;  1ZOD A;  3FZ6 A;  3TFU A;  2Z1Y A;  2Z9U A;  2W7I A;  2ZY3 A;  4ZM4 A;  1IAY A;  4AZK A;  4ZSY A;  1BS0 A;  1O4S A;  1G7X A;  2ZSL A;  1AIC A;  1DGD A;  1ASC A;  2AY3 A;  4F5L A;  2HUI A;  3FFH A;  3N0L A;  1B8G A;  1UKJ A;  1DFO A;  4IYO A;  3ELE A;  2O1B A;  3DRD A;  3F9T A;  1DJU A;  3FQA A;  1WYT B;  2HOR A;  2OKJ A;  1KMJ A;  4EB7 A;  1X28 A;  3GWP A;  4J5U A;  1C9C A;  3PGY A;  4ZWM A;  3AEL A;  4ITX A;  2HP1 A;  2FN6 A;  2JGT A;  3VP6 A;  1KKP A;  4IXO A;  3QHX A;  5EIG A;  1WKG A;  2VMT A;  2XH1 A;  3CQ4 A;  4WXF A;  5FT8 A;  2R5C A;  1M7Y A;  1LW4 A;  4W1W A;  2AY7 A;  3RQ1 A;  5BJ4 A;  3JWA A;  2V0Y A;  4LNL A;  2VMN A;  2BWP A;  1AY4 A;  1WST A;  4GE4 A;  3H7F A;  4IXZ A;  2FNI A;  1AHY A;  1LW5 A;  2YKX A;  3PAA A;  2VGS A;  2CH1 A;  3BCB A;  2ZJG A;  4GSA A;  2BWO A;  3OP7 A;  2X5F A;  3CQ5 A;  3EI6 A;  4F5H A;  3EZS A;  1AY8 A;  2YCT A;  2YRI A;  2CIN A;  2VMW A;  2VMU A;  4WD2 A;  3ASB A;  3VK3 A;  1GEX A;  3E77 A;  1RV3 A;  1DKA A;  1ARG A;  1XEY A;  4RKD A;  3HVY A;  1S08 A;  2VMP A;  3FCR A;  4RM1 A;  4B98 A;  4OMA A;  2W8J A;  3P6K A;  4Y0H A;  2VLH A;  1MAP A;  1O62 A;  2E54 A;  3EI8 A;  1FG7 A;  5HHY A;  2BWN A;  2Z61 A;  5IWQ A;  2VMO A;  2Z67 A;  2W8U A;  3E9K A;  1DGE A;  1CL2 A;  4WXG A;  1UU0 A;  4XJP A;  4AO9 A;  4EFF A;  1AKB A;  4AOA A;  3MAF B;  3BN1 A;  3F0H A;  2DKJ A;  1MLY A;  4GEB A;  3ACZ A;  2F8J A;  4AO4 A;  3LVK A;  5FT5 A;  3DZZ A;  1IVR A;  3EI5 A;  1PMO A;  3G8M A;  3JTX A;  4WB0 B;  4BQ0 A;  1KKJ A;  1GD9 A;  3MAD A;  3BV0 A;  1QGN A;  3KGW A;  3QGU A;  3HMU A; 
#chains in the Genus database with same CATH topology
 4R5Z A;  5EFS A;  1CZE A;  1AIA A;  1TAT A;  4XEW A;  1X0M A;  1AIB A;  1DTY A;  2RFV A;  2PB2 A;  3IHJ A;  1BJO A;  4R5F A;  1ZOB A;  2YKY A;  1H1C A;  3BB8 A;  4ITG A;  1CQ8 A;  1PMM A;  2W7J A;  2O7C A;  1ECX A;  4J8L A;  4LNJ A;  4F5F A;  3GBX A;  4MKJ A;  1CZC A;  2ZYJ A;  1D7U A;  4F4E A;  3ISL A;  3OKS A;  4F5M A;  5F9S A;  2OQX A;  3PD6 B;  4WYF A;  1LC8 A;  1AMA A;  1UU1 A;  4AZJ A;  1CJ0 A;  5G2P A;  1GDE A;  3HQT A;  4WLJ A;  3NRA A;  2DKB A;  2CAN A;  4A0G A;  3WKS A;  4HF8 A;  2AAT A;  4RIZ A;  1ASL A;  2D61 A;  2EZ2 A;  1WYU B;  4QGR A;  2VMZ A;  4EB5 A;  3D6K A;  4WLH A;  4MSO A;  1JF9 A;  2YCP A;  3JU7 A;  3ZRR A;  4ZM3 A;  3HBX A;  3MBB A;  3AEO A;  4A6T A;  1BJW A;  3PDB A;  3AAT A;  1ASM A;  1CQ7 A;  3FVX A;  5HXX A;  1GEW A;  1O61 A;  1GCK A;  1YJS A;  3LG0 A;  4GDY A;  3A9Y A;  3RCH B;  5EAA A;  2YHK A;  3TFT A;  1MGV A;  2WB6 A;  4UQV A;  1WYV B;  2AEU A;  4ZAS A;  3ZZK A;  4BA5 A;  1W7N A;  2W7G A;  4OBU A;  4E77 A;  3DYD A;  4ISY A;  3L44 A;  2BIE A;  3AEP A;  1W23 A;  5EUE A;  3FVU A;  2VMR A;  3FQ8 A;  1FC4 A;  3QI6 A;  4JEV A;  2X3L A;  1M0N A;  1AAW A;  2ZC0 A;  5G09 A;  2AY2 A;  3E2Y A;  4R2N A;  2G7J A;  3NUB A;  5M46 A;  1JG8 A;  4EU1 A;  1FG3 A;  2W8V A;  4N0B A;  2QBT A;  1QJ5 A;  1AJS A;  3B1E A;  3KE3 A;  4FL0 A;  3WZF A;  1MLZ A;  1TOJ A;  2E7U A;  3N75 A;  1C0N A;  3NYU A;  2CH2 A;  3TCM A;  4JE5 D;  3GR9 A;  5DJ1 A;  3B8X A;  4A72 A;  2ZY5 A;  2OKK A;  5G2Q A;  2VI9 A;  3E2Z B;  2W7F A;  1X29 A;  3NNK A;  2W7D A;  3JWB A;  5D95 A;  3UAK A;  3R4T A;  1B4X A;  3GSB A;  3K40 A;  2CJH A;  3PDX A;  3RBL A;  5AX8 A;  4A0F A;  3E2F A;  1AHX A;  4W8I A;  3WLX A;  4JE5 A;  1UU2 A;  1B5O A;  2C81 A;  4DBC A;  2CB1 A;  3NUI A;  4XJL A;  1KAF A;  4WYC A;  1JS3 A;  1OHW A;  2JJG A;  2VMQ A;  3FZ8 A;  4OYT A;  5G4J A;  5I92 A;  4F5I A;  1GBN A;  4MY5 A;  1XI9 A;  2JG2 A;  2Z9V A;  4WBT A;  2O0R A;  2BI1 A;  3FTB A;  3NDN A;  2CJG A;  4IX8 A;  3FRK A;  4A6R A;  1MDO A;  4KYO A;  1AHE A;  3F6T A;  3AEM A;  4TMR A;  1AKC A;  2D65 A;  1TPL A;  2Z9X A;  1TAS A;  2ZUK A;  3A2B A;  1AJR A;  2C7T A;  4W1V A;  3W1H A;  3COG A;  1OXO A;  1AHG A;  1SVV A;  3G7Q A;  4ZDL A;  3BCX A;  3MC6 A;  4MGR A;  4UHM A;  3DOD A;  3N4R A;  1YOO A;  4CXQ A;  2YCN A;  1B9I A;  3GET A;  1M6S A;  2FQ6 A;  1IX6 A;  2D66 A;  4OTL A;  3CBF A;  2AY1 A;  2AY4 A;  2JJF A;  4XJO A;  3TAT A;  1Z3Z A;  2DGK A;  1IAX A;  4E3Q A;  3FZ7 A;  4P3M A;  2WK8 A;  2JJE A;  5LHA A;  2YRR A;  3I5T A;  2W8T A;  4LW2 A;  3VAX A;  3DR4 A;  3GJU A;  3I4J A;  4H51 A;  1CQ6 A;  4Q6R A;  1VEF A;  1ASG A;  2QSR A;  1SZK A;  4BHD A;  2VMV A;  1BT4 A;  1X2A A;  4Y0I A;  2W7H A;  5D5S A;  5M4B A;  1BJN A;  3W1J A;  4B9B A;  2OGA A;  3LVM A;  1RVU A;  3N4S A;  4BMK A;  2X5D A;  1YIY A;  3BCA A;  4ADE A;  2QLR A;  4GE9 A;  1LC5 A;  1TOE A;  4OBV A;  1WYT A;  1C7G A;  2C44 A;  2D7Z A;  3FQ7 A;  1AAM A;  1CS1 A;  2VGW A;  3AEN A;  3EIA A;  3QBO A;  4WYG A;  4WXB A;  5DJ9 A;  4RAE A;  3B46 A;  1TOI A;  1YJY A;  2EO5 A;  3FDD A;  1ASE A;  1Y4I A;  4RLG A;  5JAY A;  4XK1 A;  1I29 A;  2EH6 A;  1LK9 A;  3CQ6 A;  4Q76 A;  4MQP A;  3AEM C;  3KGX A;  3ECD A;  4ZDP A;  1KMK A;  3ASA A;  4JF1 A;  3NYT A;  3VK4 A;  1QIT A;  1OHV A;  1ASB A;  1EJI A;  2OGE A;  3EZ1 A;  4M2J A;  1M0O A;  5FT4 A;  3UWC A;  2V1P A;  4UOY A;  2FM1 A;  4OT8 A;  1DJE A;  3N5M A;  1SZU A;  3JZL A;  1AMR A;  4JEW A;  2VLF A;  3MC6 C;  4WYA A;  5EUN A;  2HP2 A;  5M49 A;  3L8A A;  1IUG A;  2GMU A;  1EQB A;  3NU8 A;  4W5K A;  1YAA A;  4TV7 A;  1E5E A;  2EGY A;  1AMS A;  2AY8 A;  4O6Z A;  4F5K A;  5E3K A;  1S0A A;  3G0T A;  3W1I A;  2D63 A;  3WX9 A;  1KL1 A;  4UHO A;  4WP0 A;  4WYE A;  1I43 A;  1VP4 A;  4IW7 A;  1B9H A;  2HZP A;  1SFF A;  2ZSM A;  3VK2 A;  3H14 A;  4IYO B;  4N0W A;  2VGU A;  5C6U A;  1S06 A;  4ZLV A;  3DR7 A;  5G0A A;  2BYJ A;  1BKG A;  2OAT A;  1ASF A;  1GC2 A;  1ORD A;  3DXV A;  1I48 A;  3LWS A;  3JW9 A;  3FDB A;  1AHF A;  1D7V A;  1GC3 A;  1JS6 A;  3BWO A;  1PFF A;  1RV4 A;  1SF2 A;  2BIA A;  3FVS A;  3NTJ A;  3PIU A;  4EMY A;  1TAR A;  3MAF A;  1I41 A;  1V72 A;  2W7E A;  3E6G A;  2DGM A;  1AKA A;  2W7L A;  3AV7 A;  5EIG B;  2NMP A;  1OAT A;  3P1T A;  2QB3 A;  4WB0 A;  2CY8 A;  5EQC A;  2R5C B;  3NX3 A;  4ADB A;  3LV2 A;  1CL1 A;  3AOW A;  5E4Z A;  1AMQ A;  3NU7 A;  4ZSW A;  1G4X A;  3QPG A;  1V2E A;  4CVQ A;  4JEX A;  4LNM A;  3B1D A;  2QA3 A;  1AY5 A;  4OCA A;  4CBR A;  4Q75 A;  2FYF A;  3IF2 A;  3H9X A;  1B5P A;  4K2M A;  2EZ1 A;  3TQX A;  1RVY A;  3UE8 A;  8AAT A;  2R2N A;  3RUY A;  3M5U A;  2CST A;  3EI9 A;  1ZC9 A;  2GMS A;  1WKH A;  3PD6 A;  4LW4 A;  1TOK A;  3ZRP A;  1MDZ A;  5K8B A;  2BKW A;  4JF0 A;  2Z1Z A;  2HUU A;  1W7L A;  7AAT A;  4PFN A;  1BQD A;  2GB3 A;  3AEJ C;  1WYU A;  2YKU A;  4WYD A;  2DR1 A;  2WK7 A;  4FFC A;  2VMS A;  2CTZ A;  4RJ0 A;  3BS8 A;  4DQ6 A;  2YKV A;  4E1O A;  1IX8 A;  4W91 A;  3RCH A;  3AOV A;  3CAI A;  2VYC A;  3A9X A;  1ASA A;  1YNU A;  3AEN B;  3FSL A;  3VOM A;  1WYV A;  1BJO B;  1VJO A;  1E5F A;  2VMX A;  4RJY A;  1C4K A;  1J32 A;  1D7S A;  3GZD A;  4P7Y A;  1V2D A;  4PFF A;  2R0T A;  2AY5 A;  1ASD A;  2Z9W A;  1LS3 A;  2CJD A;  3USF A;  2W7M A;  1QJ3 A;  3LVL B;  3EI7 A;  2R5E A;  4KXK A;  3BWN A;  2XBN A;  2X8U A;  3HL2 A;  4ZDO A;  1D2F A;  1AX4 A;  1Z7D A;  3T32 A;  3WGB A;  1P3W A;  1LC7 A;  4A0R A;  4HVK A;  3LY1 A;  5TF5 A;  2WKA A;  4Q31 A;  3ATH A;  1S09 A;  3BC8 A;  3A9Z A;  1BW0 A;  2FNU A;  4K2B A;  9AAT A;  1EG5 A;  1BQA A;  1QIR A;  1M0Q A;  3E2Z A;  3GZC A;  1GEY A;  4XQ2 A;  1IBJ A;  3PDB B;  4ADD A;  3NYS A;  2JIS A;  3PA9 A;  2BYL A;  4UHN A;  2PB0 A;  1N2T A;  1SZS A;  2TPL A;  4RKC A;  2BI9 A;  2BHX A;  1G7W A;  4IY7 A;  2ZY4 A;  4M2K A;  3DC1 A;  4MQQ A;  5LH9 A;  1KL2 A;  5DB5 A;  3II0 A;  4U2H A;  1ART A;  4GE7 A;  1ASN A;  2D7Y A;  3FFR A;  2HOY A;  4E3R A;  5G4I A;  2CFB A;  4ZAH A;  4ADC A;  4A0H A;  3LVJ A;  2GQN A;  4RIT A;  1J04 A;  2Z20 A;  2E7I A;  4M2M A;  3DU4 A;  1YIZ A;  1MAQ A;  3ZZJ A;  1GC0 A;  1C7N A;  1LKC A;  5HDM A;  3WCN A;  1N31 A;  3EUC A;  4ATP A;  2QB2 A;  4F5G A;  2HOZ A;  3WGC A;  4A00 A;  1D7R A;  3QN6 A;  2ZY2 A;  1M32 A;  4W1X A;  1U08 A;  2VI8 A;  3HLM A;  2HUF A;  3GZD C;  5J8Q A;  3RI6 A;  3HT4 A;  1BJ4 A;  2FKI A;  4XJM A;  2D64 A;  2EYQ A;  2D5Y A;  1AJS B;  1IJI A;  4TN4 A;  1ARH A;  4IXS A;  5DX5 A;  1ARI A;  4DGT A;  4OC9 A;  4KAM A;  5BJ3 A;  3BWN C;  4U1T A;  4CBS A;  2BIG A;  1QIS A;  2G6W A;  3AEJ A;  4LC3 A;  4BA4 A;  1S07 A;  3HDO A;  1ELU A;  3MAU A;  4PVF A;  4NOG A;  1QZ9 A;  3MEB A;  3N4X A;  2DGL A;  4AH3 A;  1PG8 A;  4F5J A;  1V2F A;  1ARS A;  1N8P A;  3MKJ A;  2PO3 A;  4ATQ A;  5E5I A;  4PIW A;  1H0C A;  4ZWV A;  3R9A A;  1OHY A;  1OXP A;  1C7O A;  3DXW A;  1SPA A;  2BI3 A;  2JJH A;  3A8U X;  1IX7 A;  1M0P A;  3QM2 A;  4CXR A;  1W7M A;  4JEY A;  4MKK A;  3FKD A;  2VIB A;  2VGZ A;  2BI5 A;  1G4V A;  5EAV A;  2ZP7 A;  3K7Y A;  1TOG A;  5M4D A;  3PJ0 A;  1T3I A;  2GSA A;  5EUD A;  5FT6 A;  4K2I A;  2BI2 A;  2VMY A;  3WKR A;  2E7J A;  4L0O A;  4XAU A;  1W3U A;  2ORD A;  1GC4 A;  1ELQ A;  2HOX A;  2W7K A;  2YOB A;  3Q8N A;  4JEZ A;  4R8D A;  3I16 A;  4A6U A;  2W8W A;  3KKI A;  5F8V A;  2Q7W A;  2VGV A;  3ZRQ A;  4I8A A;  2VIA A;  1M4N A;  1YJZ A;  3B1C A;  3EIB A;  2DOU A;  2AEV A;  1O69 A;  1DJ9 A;  2WK9 A;  2QMA A;  4MQR A;  4GRX A;  3RBF A;  3PPL A;  2AY6 A;  3K28 A;  2C0R A;  2VGT A;  3ELP A;  2EPJ A;  3FD0 A;  3WCO A;  2AY9 A;  1MDX A;  3WY7 A;  4Y0D A;  1ZOD A;  3FZ6 A;  3TFU A;  2Z1Y A;  2Z9U A;  2W7I A;  2ZY3 A;  4ZM4 A;  1IAY A;  4AZK A;  4ZSY A;  1BS0 A;  1O4S A;  1G7X A;  2ZSL A;  1AIC A;  1DGD A;  2A1V A;  1ASC A;  2AY3 A;  4F5L A;  2HUI A;  3FFH A;  3N0L A;  1B8G A;  1UKJ A;  1DFO A;  4IYO A;  3ELE A;  2O1B A;  3DRD A;  3F9T A;  1DJU A;  3FQA A;  1WYT B;  2HOR A;  2OKJ A;  1KMJ A;  4EB7 A;  1X28 A;  3GWP A;  4J5U A;  1C9C A;  3PGY A;  4ZWM A;  3AEL A;  4ITX A;  2HP1 A;  2FN6 A;  2JGT A;  3VP6 A;  1KKP A;  4IXO A;  3QHX A;  5EIG A;  1WKG A;  2VMT A;  2XH1 A;  3CQ4 A;  4WXF A;  5FT8 A;  4H63 Q;  2R5C A;  1M7Y A;  1LW4 A;  4W1W A;  2AY7 A;  3RQ1 A;  5BJ4 A;  3JWA A;  2V0Y A;  4LNL A;  2VMN A;  2BWP A;  1AY4 A;  1WST A;  4GE4 A;  3H7F A;  4IXZ A;  2FNI A;  1AHY A;  1LW5 A;  2YKX A;  3PAA A;  2VGS A;  2CH1 A;  3BCB A;  2ZJG A;  4GSA A;  2BWO A;  3OP7 A;  2X5F A;  3CQ5 A;  3EI6 A;  4F5H A;  3EZS A;  1AY8 A;  2YCT A;  2YRI A;  5KTB A;  2CIN A;  2VMW A;  2VMU A;  4WD2 A;  3ASB A;  3VK3 A;  1GEX A;  3E77 A;  1RV3 A;  1DKA A;  1ARG A;  1XEY A;  4RKD A;  4K05 A;  3HVY A;  1S08 A;  2VMP A;  3FCR A;  4RM1 A;  4B98 A;  4OMA A;  2W8J A;  3P6K A;  4Y0H A;  2VLH A;  1MAP A;  1O62 A;  2E54 A;  3EI8 A;  3N7N A;  1FG7 A;  5HHY A;  2BWN A;  2Z61 A;  5IWQ A;  2VMO A;  2Z67 A;  2W8U A;  3E9K A;  1DGE A;  1CL2 A;  4WXG A;  1UU0 A;  4XJP A;  4AO9 A;  4EFF A;  2KFP A;  1AKB A;  4AOA A;  3MAF B;  3BN1 A;  3F0H A;  2DKJ A;  1MLY A;  4GEB A;  3ACZ A;  2F8J A;  4AO4 A;  3LVK A;  5FT5 A;  3DZZ A;  1IVR A;  3EI5 A;  1PMO A;  3G8M A;  3JTX A;  4WB0 B;  4BQ0 A;  1KKJ A;  1GD9 A;  3MAD A;  3BV0 A;  1QGN A;  3KGW A;  3QGU A;  3HMU A; 
#chains in the Genus database with same CATH homology
 4R5Z A;  5EFS A;  1CZE A;  1AIA A;  1TAT A;  4XEW A;  1X0M A;  1AIB A;  1DTY A;  2RFV A;  2PB2 A;  3IHJ A;  1BJO A;  4R5F A;  1ZOB A;  2YKY A;  1H1C A;  3BB8 A;  4ITG A;  1CQ8 A;  1PMM A;  2W7J A;  2O7C A;  1ECX A;  4J8L A;  4LNJ A;  4F5F A;  3GBX A;  4MKJ A;  1CZC A;  2ZYJ A;  1D7U A;  4F4E A;  3ISL A;  3OKS A;  4F5M A;  5F9S A;  2OQX A;  3PD6 B;  4WYF A;  1LC8 A;  1AMA A;  1UU1 A;  4AZJ A;  1CJ0 A;  5G2P A;  1GDE A;  3HQT A;  4WLJ A;  3NRA A;  2DKB A;  2CAN A;  4A0G A;  3WKS A;  4HF8 A;  2AAT A;  4RIZ A;  1ASL A;  2D61 A;  2EZ2 A;  1WYU B;  4QGR A;  2VMZ A;  4EB5 A;  3D6K A;  4WLH A;  4MSO A;  1JF9 A;  2YCP A;  3JU7 A;  3ZRR A;  4ZM3 A;  3HBX A;  3MBB A;  3AEO A;  4A6T A;  1BJW A;  3PDB A;  3AAT A;  1ASM A;  1CQ7 A;  3FVX A;  5HXX A;  1GEW A;  1O61 A;  1GCK A;  1YJS A;  3LG0 A;  4GDY A;  3A9Y A;  3RCH B;  5EAA A;  2YHK A;  3TFT A;  1MGV A;  2WB6 A;  4UQV A;  1WYV B;  2AEU A;  4ZAS A;  3ZZK A;  4BA5 A;  1W7N A;  2W7G A;  4OBU A;  4E77 A;  3DYD A;  4ISY A;  3L44 A;  2BIE A;  3AEP A;  1W23 A;  5EUE A;  3FVU A;  2VMR A;  3FQ8 A;  1FC4 A;  3QI6 A;  4JEV A;  2X3L A;  1M0N A;  1AAW A;  2ZC0 A;  5G09 A;  2AY2 A;  3E2Y A;  4R2N A;  2G7J A;  3NUB A;  5M46 A;  1JG8 A;  4EU1 A;  1FG3 A;  2W8V A;  4N0B A;  2QBT A;  1QJ5 A;  1AJS A;  3B1E A;  3KE3 A;  4FL0 A;  3WZF A;  1MLZ A;  1TOJ A;  2E7U A;  3N75 A;  1C0N A;  3NYU A;  2CH2 A;  3TCM A;  4JE5 D;  3GR9 A;  5DJ1 A;  3B8X A;  4A72 A;  2ZY5 A;  2OKK A;  5G2Q A;  2VI9 A;  3E2Z B;  2W7F A;  1X29 A;  3NNK A;  2W7D A;  3JWB A;  5D95 A;  3UAK A;  3R4T A;  1B4X A;  3GSB A;  3K40 A;  2CJH A;  3PDX A;  3RBL A;  5AX8 A;  4A0F A;  3E2F A;  1AHX A;  4W8I A;  3WLX A;  4JE5 A;  1UU2 A;  1B5O A;  2C81 A;  4DBC A;  2CB1 A;  3NUI A;  4XJL A;  4WYC A;  1JS3 A;  1OHW A;  2JJG A;  2VMQ A;  3FZ8 A;  4OYT A;  5G4J A;  5I92 A;  4F5I A;  1GBN A;  4MY5 A;  1XI9 A;  2JG2 A;  2Z9V A;  4WBT A;  2O0R A;  2BI1 A;  3FTB A;  3NDN A;  2CJG A;  4IX8 A;  3FRK A;  4A6R A;  1MDO A;  4KYO A;  1AHE A;  3F6T A;  3AEM A;  4TMR A;  1AKC A;  2D65 A;  1TPL A;  2Z9X A;  1TAS A;  2ZUK A;  3A2B A;  1AJR A;  2C7T A;  4W1V A;  3W1H A;  3COG A;  1OXO A;  1AHG A;  1SVV A;  3G7Q A;  4ZDL A;  3BCX A;  3MC6 A;  4MGR A;  4UHM A;  3DOD A;  3N4R A;  1YOO A;  4CXQ A;  2YCN A;  1B9I A;  3GET A;  1M6S A;  2FQ6 A;  1IX6 A;  2D66 A;  4OTL A;  3CBF A;  2AY1 A;  2AY4 A;  2JJF A;  4XJO A;  3TAT A;  1Z3Z A;  2DGK A;  1IAX A;  4E3Q A;  3FZ7 A;  4P3M A;  2WK8 A;  2JJE A;  5LHA A;  2YRR A;  3I5T A;  2W8T A;  4LW2 A;  3VAX A;  3DR4 A;  3GJU A;  3I4J A;  4H51 A;  1CQ6 A;  4Q6R A;  1VEF A;  1ASG A;  2QSR A;  1SZK A;  4BHD A;  2VMV A;  1BT4 A;  1X2A A;  4Y0I A;  2W7H A;  5D5S A;  5M4B A;  1BJN A;  3W1J A;  4B9B A;  2OGA A;  3LVM A;  1RVU A;  3N4S A;  4BMK A;  2X5D A;  1YIY A;  3BCA A;  4ADE A;  2QLR A;  4GE9 A;  1LC5 A;  1TOE A;  4OBV A;  1WYT A;  1C7G A;  2C44 A;  2D7Z A;  3FQ7 A;  1AAM A;  1CS1 A;  2VGW A;  3AEN A;  3EIA A;  3QBO A;  4WYG A;  4WXB A;  5DJ9 A;  4RAE A;  3B46 A;  1TOI A;  1YJY A;  2EO5 A;  3FDD A;  1ASE A;  1Y4I A;  4RLG A;  5JAY A;  4XK1 A;  1I29 A;  2EH6 A;  1LK9 A;  3CQ6 A;  4Q76 A;  4MQP A;  3AEM C;  3KGX A;  3ECD A;  4ZDP A;  1KMK A;  3ASA A;  4JF1 A;  3NYT A;  3VK4 A;  1QIT A;  1OHV A;  1ASB A;  1EJI A;  2OGE A;  3EZ1 A;  4M2J A;  1M0O A;  5FT4 A;  3UWC A;  2V1P A;  4UOY A;  2FM1 A;  4OT8 A;  1DJE A;  3N5M A;  1SZU A;  3JZL A;  1AMR A;  4JEW A;  2VLF A;  3MC6 C;  4WYA A;  5EUN A;  2HP2 A;  5M49 A;  3L8A A;  1IUG A;  2GMU A;  1EQB A;  3NU8 A;  4W5K A;  1YAA A;  4TV7 A;  1E5E A;  2EGY A;  1AMS A;  2AY8 A;  4O6Z A;  4F5K A;  5E3K A;  1S0A A;  3G0T A;  3W1I A;  2D63 A;  3WX9 A;  1KL1 A;  4UHO A;  4WP0 A;  4WYE A;  1I43 A;  1VP4 A;  4IW7 A;  1B9H A;  2HZP A;  1SFF A;  2ZSM A;  3VK2 A;  3H14 A;  4IYO B;  4N0W A;  2VGU A;  5C6U A;  1S06 A;  4ZLV A;  3DR7 A;  5G0A A;  2BYJ A;  1BKG A;  2OAT A;  1ASF A;  1GC2 A;  1ORD A;  3DXV A;  1I48 A;  3LWS A;  3JW9 A;  3FDB A;  1AHF A;  1D7V A;  1GC3 A;  1JS6 A;  3BWO A;  1PFF A;  1RV4 A;  1SF2 A;  2BIA A;  3FVS A;  3NTJ A;  3PIU A;  4EMY A;  1TAR A;  3MAF A;  1I41 A;  1V72 A;  2W7E A;  3E6G A;  2DGM A;  1AKA A;  2W7L A;  3AV7 A;  5EIG B;  2NMP A;  1OAT A;  3P1T A;  2QB3 A;  4WB0 A;  2CY8 A;  5EQC A;  2R5C B;  3NX3 A;  4ADB A;  3LV2 A;  1CL1 A;  3AOW A;  5E4Z A;  1AMQ A;  3NU7 A;  4ZSW A;  1G4X A;  3QPG A;  1V2E A;  4CVQ A;  4JEX A;  4LNM A;  3B1D A;  2QA3 A;  1AY5 A;  4OCA A;  4CBR A;  4Q75 A;  2FYF A;  3IF2 A;  3H9X A;  1B5P A;  4K2M A;  2EZ1 A;  3TQX A;  1RVY A;  3UE8 A;  8AAT A;  2R2N A;  3RUY A;  3M5U A;  2CST A;  3EI9 A;  1ZC9 A;  2GMS A;  1WKH A;  3PD6 A;  4LW4 A;  1TOK A;  3ZRP A;  1MDZ A;  5K8B A;  2BKW A;  4JF0 A;  2Z1Z A;  2HUU A;  1W7L A;  7AAT A;  4PFN A;  1BQD A;  2GB3 A;  3AEJ C;  1WYU A;  2YKU A;  4WYD A;  2DR1 A;  2WK7 A;  4FFC A;  2VMS A;  2CTZ A;  4RJ0 A;  3BS8 A;  4DQ6 A;  2YKV A;  4E1O A;  1IX8 A;  4W91 A;  3RCH A;  3AOV A;  3CAI A;  2VYC A;  3A9X A;  1ASA A;  1YNU A;  3AEN B;  3FSL A;  3VOM A;  1WYV A;  1BJO B;  1VJO A;  1E5F A;  2VMX A;  4RJY A;  1C4K A;  1J32 A;  1D7S A;  3GZD A;  4P7Y A;  1V2D A;  4PFF A;  2R0T A;  2AY5 A;  1ASD A;  2Z9W A;  1LS3 A;  2CJD A;  3USF A;  2W7M A;  1QJ3 A;  3LVL B;  3EI7 A;  2R5E A;  4KXK A;  3BWN A;  2XBN A;  2X8U A;  3HL2 A;  4ZDO A;  1D2F A;  1AX4 A;  1Z7D A;  3T32 A;  3WGB A;  1P3W A;  1LC7 A;  4A0R A;  4HVK A;  3LY1 A;  5TF5 A;  2WKA A;  4Q31 A;  3ATH A;  1S09 A;  3BC8 A;  3A9Z A;  1BW0 A;  2FNU A;  4K2B A;  9AAT A;  1EG5 A;  1BQA A;  1QIR A;  1M0Q A;  3E2Z A;  3GZC A;  1GEY A;  4XQ2 A;  1IBJ A;  3PDB B;  4ADD A;  3NYS A;  2JIS A;  3PA9 A;  2BYL A;  4UHN A;  2PB0 A;  1N2T A;  1SZS A;  2TPL A;  4RKC A;  2BI9 A;  2BHX A;  1G7W A;  4IY7 A;  2ZY4 A;  4M2K A;  3DC1 A;  4MQQ A;  5LH9 A;  1KL2 A;  5DB5 A;  3II0 A;  4U2H A;  1ART A;  4GE7 A;  1ASN A;  2D7Y A;  3FFR A;  2HOY A;  4E3R A;  5G4I A;  2CFB A;  4ZAH A;  4ADC A;  4A0H A;  3LVJ A;  2GQN A;  4RIT A;  1J04 A;  2Z20 A;  2E7I A;  4M2M A;  3DU4 A;  1YIZ A;  1MAQ A;  3ZZJ A;  1GC0 A;  1C7N A;  1LKC A;  5HDM A;  3WCN A;  1N31 A;  3EUC A;  4ATP A;  2QB2 A;  4F5G A;  2HOZ A;  3WGC A;  4A00 A;  1D7R A;  3QN6 A;  2ZY2 A;  1M32 A;  4W1X A;  1U08 A;  2VI8 A;  3HLM A;  2HUF A;  3GZD C;  5J8Q A;  3RI6 A;  3HT4 A;  1BJ4 A;  2FKI A;  4XJM A;  2D64 A;  2EYQ A;  2D5Y A;  1AJS B;  1IJI A;  4TN4 A;  1ARH A;  4IXS A;  5DX5 A;  1ARI A;  4DGT A;  4OC9 A;  4KAM A;  5BJ3 A;  3BWN C;  4U1T A;  4CBS A;  2BIG A;  1QIS A;  2G6W A;  3AEJ A;  4LC3 A;  4BA4 A;  1S07 A;  3HDO A;  1ELU A;  3MAU A;  4PVF A;  4NOG A;  1QZ9 A;  3MEB A;  3N4X A;  2DGL A;  4AH3 A;  1PG8 A;  4F5J A;  1V2F A;  1ARS A;  1N8P A;  3MKJ A;  2PO3 A;  4ATQ A;  5E5I A;  4PIW A;  1H0C A;  4ZWV A;  3R9A A;  1OHY A;  1OXP A;  1C7O A;  3DXW A;  1SPA A;  2BI3 A;  2JJH A;  3A8U X;  1IX7 A;  1M0P A;  3QM2 A;  4CXR A;  1W7M A;  4JEY A;  4MKK A;  3FKD A;  2VIB A;  2VGZ A;  2BI5 A;  1G4V A;  5EAV A;  2ZP7 A;  3K7Y A;  1TOG A;  5M4D A;  3PJ0 A;  1T3I A;  2GSA A;  5EUD A;  5FT6 A;  4K2I A;  2BI2 A;  2VMY A;  3WKR A;  2E7J A;  4L0O A;  4XAU A;  1W3U A;  2ORD A;  1GC4 A;  1ELQ A;  2HOX A;  2W7K A;  2YOB A;  3Q8N A;  4JEZ A;  4R8D A;  3I16 A;  4A6U A;  2W8W A;  3KKI A;  5F8V A;  2Q7W A;  2VGV A;  3ZRQ A;  4I8A A;  2VIA A;  1M4N A;  1YJZ A;  3B1C A;  3EIB A;  2DOU A;  2AEV A;  1O69 A;  1DJ9 A;  2WK9 A;  2QMA A;  4MQR A;  4GRX A;  3RBF A;  3PPL A;  2AY6 A;  3K28 A;  2C0R A;  2VGT A;  3ELP A;  2EPJ A;  3FD0 A;  3WCO A;  2AY9 A;  1MDX A;  3WY7 A;  4Y0D A;  1ZOD A;  3FZ6 A;  3TFU A;  2Z1Y A;  2Z9U A;  2W7I A;  2ZY3 A;  4ZM4 A;  1IAY A;  4AZK A;  4ZSY A;  1BS0 A;  1O4S A;  1G7X A;  2ZSL A;  1AIC A;  1DGD A;  2A1V A;  1ASC A;  2AY3 A;  4F5L A;  2HUI A;  3FFH A;  3N0L A;  1B8G A;  1UKJ A;  1DFO A;  4IYO A;  3ELE A;  2O1B A;  3DRD A;  3F9T A;  1DJU A;  3FQA A;  1WYT B;  2HOR A;  2OKJ A;  1KMJ A;  4EB7 A;  1X28 A;  3GWP A;  4J5U A;  1C9C A;  3PGY A;  4ZWM A;  3AEL A;  4ITX A;  2HP1 A;  2FN6 A;  2JGT A;  3VP6 A;  1KKP A;  4IXO A;  3QHX A;  5EIG A;  1WKG A;  2VMT A;  2XH1 A;  3CQ4 A;  4WXF A;  5FT8 A;  4H63 Q;  2R5C A;  1M7Y A;  1LW4 A;  4W1W A;  2AY7 A;  3RQ1 A;  5BJ4 A;  3JWA A;  2V0Y A;  4LNL A;  2VMN A;  2BWP A;  1AY4 A;  1WST A;  4GE4 A;  3H7F A;  4IXZ A;  2FNI A;  1AHY A;  1LW5 A;  2YKX A;  3PAA A;  2VGS A;  2CH1 A;  3BCB A;  2ZJG A;  4GSA A;  2BWO A;  3OP7 A;  2X5F A;  3CQ5 A;  3EI6 A;  4F5H A;  3EZS A;  1AY8 A;  2YCT A;  2YRI A;  5KTB A;  2CIN A;  2VMW A;  2VMU A;  4WD2 A;  3ASB A;  3VK3 A;  1GEX A;  3E77 A;  1RV3 A;  1DKA A;  1ARG A;  1XEY A;  4RKD A;  4K05 A;  3HVY A;  1S08 A;  2VMP A;  3FCR A;  4RM1 A;  4B98 A;  4OMA A;  2W8J A;  3P6K A;  4Y0H A;  2VLH A;  1MAP A;  1O62 A;  2E54 A;  3EI8 A;  3N7N A;  1FG7 A;  5HHY A;  2BWN A;  2Z61 A;  5IWQ A;  2VMO A;  2Z67 A;  2W8U A;  3E9K A;  1DGE A;  1CL2 A;  4WXG A;  1UU0 A;  4XJP A;  4AO9 A;  4EFF A;  2KFP A;  1AKB A;  4AOA A;  3MAF B;  3BN1 A;  3F0H A;  2DKJ A;  1MLY A;  4GEB A;  3ACZ A;  2F8J A;  4AO4 A;  3LVK A;  5FT5 A;  3DZZ A;  1IVR A;  3EI5 A;  1PMO A;  3G8M A;  3JTX A;  4WB0 B;  4BQ0 A;  1KKJ A;  1GD9 A;  3MAD A;  3BV0 A;  1QGN A;  3KGW A;  3QGU A;  3HMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...