2WKAA

Structure of plp_thr_decanoyl-coa aldimine form of vibrio cholerae cqsa
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
386
structure length
386
Chain Sequence
PQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into the Biosynthesis of the Vibrio Cholerae Major Autoinducer Cai-1 from the Crystal Structure of the Plp-Dependent Enzyme Cqsa.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
molecule keywords CAI-1 AUTOINDUCER SYNTHASE
total genus 144
structure length 386
sequence length 386
chains with identical sequence B
ec nomenclature ec 2.3.-.-:
pdb deposition date 2009-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2wkaA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2wkaA01
4LNLA 1GEYA 1AKAA 2EH6A 2CY8A 1EQBA 1YIZA 2XBNA 5JAYA 4WXGA 3GBXA 1I48A 2GB3A 4RKCA 4RLGA 1OATA 2VMXA 1GC3A 2FN6A 2VMVA 3RI6A 2ZY2A 1AHYA 3ZRRA 2WK8A 2G6WA 1JS3A 2JJEA 1MDOA 1AY5A 2QBTA 1BQDA 1ASNA 5EQCA 2JG2A 4IYOB 2CSTA 3NDNA 4F5GA 3G7QA 2X3LA 5IWQA 1ZOBA 1MDXA 1DJEA 2YRRA 1AX4A 4FL0A 2HZPA 1RVUA 2DR1A 3GZCA 2VGZA 3JWBA 4RAEA 2HOYA 5D5SA 1GBNA 1AMQA 3QGUA 2O1BA 4WXBA 2BYLA 1SZKA 5FT4A 1VP4A 2VMOA 2C81A 4MSOA 4EU1A 3II0A 2ORDA 1YJYA 1AIBA 2TPLA 2CANA 3LVMA 1W7NA 2ZY5A 2WK7A 1AHEA 1MLYA 3AELA 3ELPA 4WBTA 3NU8A 1YJSA 1TPLA 1B9HA 2V1PA 3RQ1A 2VMWA 3ZZJA 1WYUB 3DC1A 4RJYA 2X5DA 4F5FA 2BYJA 1TATA 1LS3A 1D7SA 2AY1A 3GWPA 1W7MA 2E54A 2EGYA 1IUGA 4WYEA 4TN4A 2VLHA 3ACZA 4N0BA 3FVXA 2OGEA 3G8MA 4UHOA 1LW4A 2AY7A 3PDXA 1G4VA 1CS1A 5DJ1A 1BJWA 1C0NA 3PDBA 2W7HA 2WKAA 2AY3A 1V2FA 3QN6A 3FZ8A 2OKJA 1TOIA 4U2HA 2VMTA 3OP7A 4P7YA 3ZRQA 3EZ1A 3A9YA 1AAWA 3L44A 3AEJA 1N8PA 2BI1A 1C7NA 1FC4A 2W7EA 2EZ2A 2VYCA 1OHYA 2BWOA 3Q8NA 3JZLA 1PMMA 4A00A 2JJHA 4XK1A 4AOAA 4MGRA 4MY5A 4KYOA 1ELQA 2AY9A 4ADBA 1LW5A 2DGLA 1C4KA 2D61A 5EUEA 1E5EA 1EJIA 1QJ3A 4DQ6A 3HVYA 4R2NA 2R5EA 1M6SA 2W8JA 3WX9A 3TQXA 1DJ9A 1GEWA 1W3UA 3CAIA 4KXKA 1KMJA 1WYTA 3BCXA 1J04A 4JE5A 1J32A 2W7GA 2EPJA 1ZC9A 1D7RA 3FDBA 2VGTA 4WP0A 3NUIA 2VMSA 1WYVA 2CTZA 3DZZA 4UOYA 1TOJA 2W7DA 4M2KA 1AHXA 4F4EA 5G2PA 4ZDOA 2BIAA 2C0RA 4CXQA 3DU4A 3MBBA 5EIGA 1GD9A 2D7YA 2R5CB 3FFHA 4UHMA 3VK4A 1GC2A 4Q76A 1BJNA 3LVKA 4J5UA 2Z61A 3L8AA 3COGA 4RKDA 2Q7WA 4ZSYA 5I92A 1N2TA 3H7FA 1C7GA 3VK3A 1V72A 1C9CA 2X8UA 2RFVA 3MKJA 2FYFA 1X0MA 2Z20A 4XQ2A 2Z1ZA 3GETA 2R5CA 2ZJGA 4W1VA 1D7UA 2F8JA 1O61A 3GR9A 3RBFA 4PVFA 4AZKA 3FKDA 2CJGA 2VGWA 1AMSA 3A2BA 1AJSA 2ZYJA 2FNUA 2O0RA 2R0TA 3ASAA 4WB0A 3I16A 1V2DA 3I5TA 2AY8A 1IX7A 2Z1YA 1IX6A 1LC7A 2Z9VA 3K7YA 1UU2A 4MKJA 1UU0A 4JEZA 1JS6A 5M4DA 4ZM4A 3TCMA 4U1TA 1G4XA 4F5KA 4WYDA 2W7MA 2D65A 3QBOA 4A0RA 1I29A 3DXVA 1M4NA 3FVUA 5F8VA 3N0LA 3QI6A 4A72A 1CZCA 3PIUA 4IYOA 2QB2A 1AHGA 1M0QA 1PG8A 4Q31A 4Y0DA 5DX5A 1ECXA 3FQ7A 4KAMA 1S06A 2YOBA 1ELUA 2YCTA 3K28A 3NYTA 4ZLVA 3CBFA 1KMKA 3W1IA 2DGMA 1MAPA 4ADEA 4DGTA 5LHAA 2VMNA 1BS0A 1SVVA 3HBXA 3E77A 4JF0A 2YCNA 1G7XA 1OHWA 1TOGA 3NU7A 5FT6A 4ZAHA 1C7OA 1BJOB 4XJLA 4P3MA 4JEYA 3N5MA 1CL2A 1B4XA 4WXFA 4EB7A 3JTXA 3DYDA 5E4ZA 3FDDA 3MC6C 4TV7A 3WCOA 4ZM3A 4F5LA 4ZASA 1B5PA 1YAAA 1AICA 3DR7A 3JW9A 4UQVA 4RJ0A 3KGXA 4RITA 1RV3A 2X5FA 3MAFB 2CB1A 2ZY4A 4R5FA 2BWNA 5EAAA 2JJFA 2FNIA 2EZ1A 1ASAA 1AAMA 2D63A 2DGKA 2Z9WA 1GEXA 2QA3A 2GMSA 2JISA 1SFFA 3BS8A 1CJ0A 1FG7A 1H0CA 3LV2A 3BCBA 1DFOA 3FD0A 1DTYA 3P1TA 4OCAA 1UU1A 3NUBA 1WSTA 1MDZA 3AEMA 4HVKA 3NRAA 4H51A 1EG5A 3EI6A 2BIEA 3KE3A 5K8BA 1SF2A 3B1EA 4BA4A 4M2JA 1XI9A 3F6TA 3GZDA 4Q75A 2DKJA 3BWOA 2Z9UA 3AEMC 3RUYA 5HHYA 1CQ6A 2Z9XA 4AZJA 1YNUA 4ZWVA 4XJPA 1S07A 2D5YA 2VMUA 4E1OA 1WKHA 1QZ9A 2D66A 2HUUA 3N75A 3H14A 5BJ3A 1E5FA 2HUIA 1P3WA 1Z7DA 1GCKA 2GSAA 2VIAA 3AEPA 5TF5A 2NMPA 2W8TA 4WYCA 1O69A 2W7LA 3WGBA 4ADDA 4AO9A 4CVQA 3HLMA 3OKSA 3BWNA 3DRDA 5HDMA 3LY1A 5EAVA 2O7CA 4IXSA 3FQ8A 4ADCA 2E7JA 1S09A 2PB2A 2VGUA 2VMZA 1IVRA 2W7FA 3AOVA 1OXOA 2HOXA 4XAUA 3VAXA 1AMRA 3EI5A 4ITGA 1W7LA 3IHJA 1ZODA 2AY4A 2YKVA 3AEOA 1GC4A 4LNJA 4XJOA 2CH1A 8AATA 5HXXA 1KL1A 4M2MA 1ASEA 3B1DA 4TMRA 4LW2A 1X2AA 4F5JA 4JEWA 4K2MA 3UAKA 1O4SA 2PB0A 3EI7A 1TASA 2CINA 4OC9A 3WKRA 5E3KA 1AJSB 4WB0B 3M5UA 1AY8A 4F5HA 2VI8A 3NYSA 4BQ0A 4GRXA 4R8DA 4F5MA 1N31A 5FT5A 4L0OA 1S0AA 4EB5A 2R2NA 1AJRA 5BJ4A 3CQ5A 2VMPA 3MADA 3RCHA 1JG8A 3UWCA 4MQPA 1GDEA 1YJZA 5AX8A 4JE5D 4W1WA 1V2EA 1SPAA 2VMRA 1CQ8A 4BHDA 5E5IA 1ASBA 4NOGA 2YRIA 3BB8A 4IW7A 1B5OA 3HL2A 3PJ0A 1M7YA 2GQNA 1M32A 3P6KA 3RCHB 3W1JA 1S08A 3EUCA 1IBJA 5G4IA 2CJHA 2DOUA 9AATA 1FG3A 1KKPA 3R4TA 1ASGA 1BJOA 3ECDA 1ARGA 3E2YA 2EO5A 3EI8A 3BCAA 4IX8A 4WLJA 4WLHA 5DB5A 3LVJA 1TOEA 2YKUA 1QITA 2D64A 3QPGA 1TOKA 1LKCA 1PFFA 2VLFA 3ISLA 1SZUA 3ELEA 4F5IA 3PPLA 4JEXA 4W1XA 4ISYA 2W7KA 3D6KA 4JF1A 5F9SA 4W5KA 3MC6A 2VGSA 3FSLA 2CFBA 4O6ZA 3WCNA 3MAFA 2W8UA 3R9AA 1ASDA 2QLRA 4WYFA 3KKIA 3GJUA 2VMQA 3QHXA 3F9TA 2YKYA 2FQ6A 3BV0A 4ZDPA 1ARIA 3AATA 3UE8A 1UKJA 4PFNA 2BWPA 3USFA 3A9XA 1XEYA 1OHVA 4UHNA 4ATPA 3E6GA 3WY7A 4B9BA 3B8XA 2AEVA 4A0FA 1T3IA 3DXWA 4IY7A 3E2ZA 2QB3A 2BI3A 3LG0A 2FM1A 4I8AA 4E77A 3IF2A 2PO3A 2CJDA 4BMKA 4ITXA 3ZZKA 3NNKA 2ZY3A 3DODA 1IJIA 3FZ7A 4CXRA 3FVSA 4W91A 4EMYA 1LC8A 1M0PA 4LNMA 4ZDLA 2HP2A 2HOZA 7AATA 3E2FA 3AEJC 1I43A 3WLXA 1SZSA 3HDOA 1MAQA 4IXOA 5J8QA 5C6UA 1ORDA 4QGRA 2V0YA 2ZSMA 1QISA 3CQ4A 1AIAA 3CQ6A 2VIBA 2W7IA 1ASLA 4GEBA 3PAAA 3LVLB 3GSBA 3BWNC 3VOMA 3EZSA 5LH9A 1AMAA 4PIWA 3VP6A 2BI9A 1B9IA 4Q6RA 4JEVA 4XEWA 2VI9A 4GE7A 1ARTA 1QJ5A 1Y4IA 1ASMA 2BHXA 3MEBA 4WYAA 3EIAA 4A0GA 3TFTA 5M46A 3BC8A 3HMUA 3I4JA 1LK9A 2ZSLA 1YOOA 3RBLA 1DGEA 4CBRA 1MGVA 1D2FA 1DGDA 1DJUA 1VJOA 1QIRA 4MQRA 3ATHA 2W7JA 4OYTA 3FTBA 3F0HA 2BI2A 2YCPA 4R5ZA 2W8WA 1W23A 4LW4A 4A6UA 3ASBA 1M0OA 1MLZA 2HORA 4OTLA 3WGCA 1BQAA 3TFUA 4W8IA 3HT4A 2C7TA 2D7ZA 3NX3A 5M4BA 2VMYA 2JGTA 3MAUA 4HF8A 3WKSA 4RM1A 1H1CA 2BIGA 3GZDC 3NTJA 4DBCA 1BKGA 1CL1A 5DJ9A 4MKKA 1WYUA 4WYGA 2W8VA 1RVYA 1LC5A 3KGWA 1ASCA 4AO4A 3B46A 3WZFA 3T32A 4B98A 2WK9A 4K2BA 2AY2A 1G7WA 3AOWA 5G2QA 1AKCA 3W1HA 1GC0A 1I41A 3PDBB 3ZRPA 4E3QA 1IAYA 2GMUA 3DR4A 3G0TA 1D7VA 4GDYA 2AY6A 4RIZA 1ASFA 4FFCA 2ZC0A 1VEFA 3LWSA 1U08A 4ZWMA 4LC3A 2E7IA 4CBSA 4XJMA 4OBUA 1B8GA 3PGYA 2BI5A 5M49A 1O62A 1BJ4A 1AHFA 2AEUA 4MQQA 1AKBA 4K2IA 2OGAA 4EFFA 5FT8A 1PMOA 3AENA 1QGNA 1JF9A 2OQXA 1AY4A 2HP1A 4A6RA 5G0AA 1OXPA 3B1CA 4Y0IA 1WKGA 2Z67A 1YIYA 1Z3ZA 2YKXA 2CH2A 3BN1A 4OT8A 1WYTB 1BW0A 5G09A 4N0WA 2AY5A 3VK2A 3AENB 3E9KA 4OBVA 5G4JA 3EIBA 1DKAA 4A6TA 3NYUA 1WYVB 4BA5A 1CZEA 4AH3A 2VGVA 2HUFA 1KL2A 2XH1A 3EI9A 1BT4A 3FCRA 3PA9A 4WD2A 3FRKA 3A8UX 3JU7A 5D95A 5EIGB 4PFFA 2E7UA 2OATA 3QM2A 2DKBA 1RV4A 4J8LA 2OKKA 1IAXA 1ARSA 1ARHA 2BKWA 1M0NA 5EFSA 2ZUKA 3TATA 2AATA 2YHKA 3K40A 4E3RA 3E2ZB 1X28A 3FZ6A 3A9ZA 2JJGA 3HQTA 3PD6A 4GSAA 4OMAA 4Y0HA 4A0HA 2C44A 2ZP7A 1IX8A 4GE9A 1X29A 4IXZA 1KKJA 5EUNA 3FQAA 1TARA 2QMAA 3JWAA 4GE4A 3FFRA 4ZSWA 5EUDA 4ATQA 1CQ7A 3PD6B 3AV7A
chains in the Genus database with same CATH superfamily
4LNLA 1GEYA 1AKAA 2EH6A 2CY8A 1EQBA 1YIZA 2XBNA 5JAYA 2G7JA 4WXGA 3GBXA 1I48A 2GB3A 4RKCA 4RLGA 1OATA 2VMXA 1GC3A 2FN6A 2VMVA 3RI6A 2ZY2A 1AHYA 3ZRRA 2WK8A 2G6WA 1JS3A 2JJEA 1MDOA 1AY5A 2QBTA 1BQDA 1ASNA 5EQCA 2JG2A 4IYOB 2CSTA 3NDNA 4F5GA 3G7QA 2X3LA 5IWQA 1ZOBA 1MDXA 1DJEA 2YRRA 1AX4A 4FL0A 2HZPA 1RVUA 2DR1A 3GZCA 2QSRA 2VGZA 3JWBA 4RAEA 2HOYA 5D5SA 1GBNA 1AMQA 3QGUA 2O1BA 4WXBA 2BYLA 1SZKA 5FT4A 1VP4A 2VMOA 2C81A 4MSOA 4EU1A 3II0A 2ORDA 1YJYA 1AIBA 2TPLA 2CANA 3LVMA 1W7NA 2ZY5A 2WK7A 1AHEA 1MLYA 3AELA 3ELPA 4WBTA 2KFPA 3NU8A 1YJSA 1TPLA 1B9HA 2V1PA 3RQ1A 2VMWA 3ZZJA 1WYUB 3DC1A 4RJYA 2X5DA 4F5FA 2BYJA 1TATA 1LS3A 1D7SA 2AY1A 3GWPA 1W7MA 2E54A 2EGYA 1IUGA 4WYEA 4TN4A 2VLHA 1KAFA 3ACZA 4N0BA 3FVXA 2OGEA 3G8MA 4UHOA 1LW4A 2AY7A 3PDXA 1G4VA 1CS1A 5DJ1A 1BJWA 1C0NA 3PDBA 2W7HA 2WKAA 2AY3A 1V2FA 3QN6A 3FZ8A 2OKJA 1TOIA 4U2HA 2VMTA 3OP7A 4P7YA 3ZRQA 3EZ1A 3A9YA 1AAWA 3L44A 3AEJA 1N8PA 2BI1A 1C7NA 1FC4A 2W7EA 2EZ2A 2VYCA 1OHYA 2BWOA 3Q8NA 3JZLA 1PMMA 4A00A 2JJHA 4XK1A 4AOAA 4MGRA 4MY5A 4KYOA 1ELQA 2AY9A 4ADBA 1LW5A 2DGLA 1C4KA 2D61A 5EUEA 1E5EA 1EJIA 1QJ3A 4DQ6A 3HVYA 4R2NA 2R5EA 1M6SA 2W8JA 3WX9A 3TQXA 1DJ9A 1GEWA 1W3UA 3CAIA 4KXKA 1KMJA 1WYTA 3BCXA 1J04A 4JE5A 1J32A 2W7GA 2EPJA 1ZC9A 1D7RA 3FDBA 2VGTA 4WP0A 3NUIA 2VMSA 1WYVA 2CTZA 3DZZA 4UOYA 1TOJA 2W7DA 4M2KA 1AHXA 4F4EA 5G2PA 4ZDOA 2BIAA 2C0RA 4CXQA 3DU4A 3MBBA 5EIGA 1GD9A 2D7YA 5KTBA 2R5CB 3FFHA 4UHMA 3VK4A 1GC2A 4Q76A 1BJNA 3LVKA 4J5UA 2Z61A 3L8AA 3COGA 4RKDA 2Q7WA 4ZSYA 5I92A 1N2TA 3H7FA 1C7GA 3VK3A 1V72A 1C9CA 2X8UA 2RFVA 3MKJA 2FYFA 1X0MA 2Z20A 4XQ2A 2Z1ZA 3GETA 2R5CA 2ZJGA 4W1VA 1D7UA 2F8JA 1O61A 3GR9A 3RBFA 4PVFA 4AZKA 3FKDA 2CJGA 2VGWA 1AMSA 3A2BA 1AJSA 2ZYJA 2FNUA 2O0RA 2R0TA 3ASAA 4WB0A 3I16A 1V2DA 3I5TA 2AY8A 1IX7A 2Z1YA 1IX6A 1LC7A 2Z9VA 3K7YA 1UU2A 4MKJA 1UU0A 4JEZA 1JS6A 5M4DA 4ZM4A 3TCMA 4U1TA 1G4XA 4F5KA 4WYDA 2W7MA 2D65A 3QBOA 4A0RA 1I29A 3DXVA 1M4NA 3FVUA 5F8VA 3N0LA 3QI6A 4A72A 1CZCA 3PIUA 4IYOA 2QB2A 1AHGA 1M0QA 1PG8A 4Q31A 4Y0DA 5DX5A 1ECXA 3FQ7A 4KAMA 1S06A 2YOBA 1ELUA 2YCTA 3K28A 3NYTA 4ZLVA 3CBFA 1KMKA 3W1IA 2DGMA 1MAPA 4ADEA 4DGTA 5LHAA 2VMNA 1BS0A 1SVVA 3HBXA 3E77A 4JF0A 2YCNA 1G7XA 1OHWA 1TOGA 3NU7A 5FT6A 4ZAHA 1C7OA 1BJOB 4XJLA 4P3MA 4JEYA 3N4SA 3N5MA 1CL2A 1B4XA 4WXFA 4EB7A 3JTXA 3DYDA 5E4ZA 3FDDA 3MC6C 4TV7A 3WCOA 4ZM3A 4F5LA 4ZASA 1B5PA 1YAAA 1AICA 3DR7A 3JW9A 4UQVA 4RJ0A 3KGXA 4RITA 1RV3A 2X5FA 3MAFB 2CB1A 2ZY4A 4R5FA 2BWNA 5EAAA 2JJFA 2FNIA 2EZ1A 1ASAA 1AAMA 2D63A 2DGKA 2Z9WA 1GEXA 2QA3A 2GMSA 2JISA 1SFFA 3BS8A 1CJ0A 1FG7A 1H0CA 3LV2A 3BCBA 1DFOA 3FD0A 1DTYA 3P1TA 4OCAA 1UU1A 3NUBA 1WSTA 1MDZA 3AEMA 4HVKA 3NRAA 4H51A 1EG5A 3EI6A 2BIEA 3KE3A 5K8BA 1SF2A 3B1EA 4BA4A 4M2JA 1XI9A 3F6TA 3GZDA 4Q75A 2DKJA 3BWOA 2Z9UA 3AEMC 3RUYA 5HHYA 1CQ6A 2Z9XA 4AZJA 1YNUA 4ZWVA 4XJPA 1S07A 2D5YA 2VMUA 4E1OA 1WKHA 1QZ9A 2D66A 2HUUA 3N75A 3H14A 5BJ3A 1E5FA 2HUIA 1P3WA 1Z7DA 1GCKA 2GSAA 2VIAA 3AEPA 5TF5A 2NMPA 2W8TA 4WYCA 1O69A 2W7LA 3WGBA 4ADDA 4AO9A 4CVQA 3HLMA 3OKSA 3BWNA 3DRDA 5HDMA 3LY1A 5EAVA 2O7CA 4IXSA 3FQ8A 4ADCA 2E7JA 1S09A 2PB2A 2VGUA 2VMZA 1IVRA 2W7FA 3AOVA 1OXOA 2HOXA 4XAUA 3VAXA 1AMRA 3EI5A 4ITGA 1W7LA 3IHJA 1ZODA 2AY4A 2YKVA 3AEOA 1GC4A 4LNJA 4XJOA 2CH1A 8AATA 5HXXA 1KL1A 4M2MA 1ASEA 3B1DA 4TMRA 4LW2A 1X2AA 4F5JA 4JEWA 4K2MA 3UAKA 1O4SA 2PB0A 3EI7A 1TASA 2CINA 4OC9A 3WKRA 5E3KA 1AJSB 4WB0B 3M5UA 1AY8A 4F5HA 2VI8A 3NYSA 4BQ0A 4GRXA 4R8DA 4F5MA 1N31A 5FT5A 4L0OA 1S0AA 4EB5A 2R2NA 1AJRA 5BJ4A 3CQ5A 2VMPA 3MADA 3RCHA 1JG8A 3UWCA 4MQPA 1GDEA 1YJZA 5AX8A 4JE5D 4W1WA 1V2EA 1SPAA 2VMRA 1CQ8A 3H9XA 4BHDA 5E5IA 1ASBA 4NOGA 2YRIA 3BB8A 4IW7A 1B5OA 3HL2A 3PJ0A 1M7YA 2GQNA 1M32A 3P6KA 3RCHB 3W1JA 1S08A 3EUCA 1IBJA 5G4IA 2CJHA 2DOUA 9AATA 1FG3A 1KKPA 3R4TA 1ASGA 1BJOA 3ECDA 1ARGA 3E2YA 2EO5A 3EI8A 3BCAA 4IX8A 4WLJA 4WLHA 5DB5A 3LVJA 1TOEA 2YKUA 1QITA 2D64A 3QPGA 1TOKA 1LKCA 1PFFA 2VLFA 3ISLA 1SZUA 3ELEA 4F5IA 3PPLA 4JEXA 4W1XA 4ISYA 2W7KA 3D6KA 4JF1A 5F9SA 4W5KA 3N7NA 3MC6A 2VGSA 3FSLA 2CFBA 4O6ZA 3WCNA 3MAFA 2W8UA 3R9AA 1ASDA 2QLRA 4WYFA 3KKIA 3GJUA 2VMQA 3QHXA 3F9TA 2YKYA 2FQ6A 3BV0A 4ZDPA 1ARIA 3AATA 3UE8A 1UKJA 4PFNA 2BWPA 3USFA 3A9XA 1XEYA 1OHVA 4UHNA 4ATPA 3E6GA 3WY7A 4B9BA 3B8XA 2AEVA 4A0FA 1T3IA 3DXWA 4IY7A 3E2ZA 2QB3A 2BI3A 3LG0A 2FM1A 4I8AA 4E77A 3IF2A 2PO3A 2CJDA 4BMKA 4ITXA 3ZZKA 3NNKA 2ZY3A 3DODA 1IJIA 3FZ7A 4CXRA 3FVSA 4W91A 4EMYA 1LC8A 1M0PA 3N4RA 4LNMA 4ZDLA 2HP2A 2HOZA 7AATA 3E2FA 3AEJC 1I43A 3WLXA 1SZSA 3HDOA 1MAQA 4IXOA 5J8QA 5C6UA 1ORDA 4QGRA 2V0YA 2ZSMA 1QISA 3CQ4A 1AIAA 3CQ6A 2VIBA 2W7IA 1ASLA 4GEBA 3PAAA 3LVLB 3GSBA 3BWNC 3VOMA 3EZSA 5LH9A 1AMAA 4PIWA 3VP6A 2BI9A 1B9IA 4Q6RA 4JEVA 4XEWA 2VI9A 4GE7A 1ARTA 1QJ5A 1Y4IA 1ASMA 2BHXA 3MEBA 4WYAA 3EIAA 4A0GA 3TFTA 5M46A 3BC8A 3HMUA 3I4JA 1LK9A 2ZSLA 1YOOA 3RBLA 1DGEA 4CBRA 1MGVA 1D2FA 1DGDA 1DJUA 1VJOA 1QIRA 4MQRA 3ATHA 2W7JA 4OYTA 3FTBA 3F0HA 2BI2A 2YCPA 4R5ZA 2W8WA 1W23A 4LW4A 4A6UA 3ASBA 1M0OA 1MLZA 2HORA 4OTLA 3WGCA 1BQAA 3TFUA 4W8IA 3HT4A 2C7TA 2D7ZA 3NX3A 5M4BA 2VMYA 2JGTA 3MAUA 4HF8A 3WKSA 4RM1A 1H1CA 2BIGA 3GZDC 3NTJA 4DBCA 1BKGA 1CL1A 5DJ9A 4MKKA 1WYUA 4WYGA 2W8VA 1RVYA 1LC5A 3KGWA 1ASCA 4AO4A 3B46A 3WZFA 3T32A 4B98A 2WK9A 4K2BA 2A1VA 2AY2A 1G7WA 3AOWA 5G2QA 2WB6A 1AKCA 3W1HA 1GC0A 1I41A 3PDBB 3ZRPA 4E3QA 1IAYA 2GMUA 3DR4A 3G0TA 1D7VA 4GDYA 2AY6A 4RIZA 1ASFA 4FFCA 2ZC0A 1VEFA 3LWSA 1U08A 4ZWMA 4LC3A 2E7IA 4CBSA 4XJMA 4OBUA 3N4XA 1B8GA 3PGYA 2BI5A 5M49A 1O62A 1BJ4A 1AHFA 2AEUA 4MQQA 1AKBA 4K2IA 4H63Q 2OGAA 4EFFA 5FT8A 1PMOA 3AENA 1QGNA 1JF9A 2OQXA 1AY4A 2HP1A 4A6RA 5G0AA 1OXPA 3B1CA 4Y0IA 1WKGA 2Z67A 1YIYA 1Z3ZA 2YKXA 2CH2A 3BN1A 4OT8A 1WYTB 1BW0A 5G09A 4N0WA 2AY5A 3VK2A 3AENB 3E9KA 4OBVA 5G4JA 3EIBA 4K05A 1DKAA 4A6TA 3NYUA 1WYVB 4BA5A 1CZEA 4AH3A 2VGVA 2HUFA 1KL2A 2XH1A 3EI9A 1BT4A 3FCRA 3PA9A 4WD2A 3FRKA 3A8UX 3JU7A 5D95A 5EIGB 4PFFA 2E7UA 2OATA 3QM2A 2DKBA 1RV4A 4J8LA 2OKKA 1IAXA 1ARSA 1ARHA 2BKWA 1M0NA 5EFSA 2ZUKA 3TATA 2AATA 2YHKA 3K40A 4E3RA 3E2ZB 1X28A 3FZ6A 3A9ZA 2JJGA 3HQTA 3PD6A 4GSAA 4OMAA 4Y0HA 4A0HA 2C44A 2ZP7A 1IX8A 4GE9A 1X29A 4IXZA 1KKJA 5EUNA 3FQAA 1TARA 2QMAA 3JWAA 2EYQA 4GE4A 3FFRA 2FKIA 4ZSWA 5EUDA 4ATQA 1CQ7A 3PD6B 3AV7A
chains in the Genus database with same CATH topology
4LNLA 1GEYA 1AKAA 2EH6A 2CY8A 1EQBA 1YIZA 2XBNA 5JAYA 2G7JA 4WXGA 3GBXA 1I48A 2GB3A 4RKCA 4RLGA 1OATA 2VMXA 1GC3A 2FN6A 2VMVA 3RI6A 2ZY2A 1AHYA 3ZRRA 2WK8A 2G6WA 1JS3A 2JJEA 1MDOA 1AY5A 2QBTA 1BQDA 1ASNA 5EQCA 2JG2A 4IYOB 2CSTA 3NDNA 4F5GA 3G7QA 2X3LA 5IWQA 1ZOBA 1MDXA 1DJEA 2YRRA 1AX4A 4FL0A 2HZPA 1RVUA 2DR1A 3GZCA 2QSRA 2VGZA 3JWBA 4RAEA 2HOYA 5D5SA 1GBNA 1AMQA 3QGUA 2O1BA 4WXBA 2BYLA 1SZKA 5FT4A 1VP4A 2VMOA 2C81A 4MSOA 4EU1A 3II0A 2ORDA 1YJYA 1AIBA 2TPLA 2CANA 3LVMA 1W7NA 2ZY5A 2WK7A 1AHEA 1MLYA 3AELA 3ELPA 4WBTA 2KFPA 3NU8A 1YJSA 1TPLA 1B9HA 2V1PA 3RQ1A 2VMWA 3ZZJA 1WYUB 3DC1A 4RJYA 2X5DA 4F5FA 2BYJA 1TATA 1LS3A 1D7SA 2AY1A 3GWPA 1W7MA 2E54A 2EGYA 1IUGA 4WYEA 4TN4A 2VLHA 3ACZA 4N0BA 3FVXA 2OGEA 3G8MA 4UHOA 1LW4A 2AY7A 3PDXA 1G4VA 1CS1A 5DJ1A 1BJWA 1C0NA 3PDBA 2W7HA 2WKAA 2AY3A 1V2FA 3QN6A 3FZ8A 2OKJA 1TOIA 4U2HA 2VMTA 3OP7A 4P7YA 3ZRQA 3EZ1A 3A9YA 1AAWA 3L44A 3AEJA 1N8PA 2BI1A 1C7NA 1FC4A 2W7EA 2EZ2A 2VYCA 1OHYA 2BWOA 3Q8NA 3JZLA 1PMMA 4A00A 2JJHA 4XK1A 4AOAA 4MGRA 4MY5A 4KYOA 1ELQA 2AY9A 4ADBA 1LW5A 2DGLA 1C4KA 2D61A 5EUEA 1E5EA 1EJIA 1QJ3A 4DQ6A 3HVYA 4R2NA 2R5EA 1M6SA 2W8JA 3WX9A 3TQXA 1DJ9A 1GEWA 1W3UA 3CAIA 4KXKA 1KMJA 1WYTA 3BCXA 1J04A 4JE5A 1J32A 2W7GA 2EPJA 1ZC9A 1D7RA 3FDBA 2VGTA 4WP0A 3NUIA 2VMSA 1WYVA 2CTZA 3DZZA 4UOYA 1TOJA 2W7DA 4M2KA 1AHXA 4F4EA 5G2PA 4ZDOA 2BIAA 2C0RA 4CXQA 3DU4A 3MBBA 5EIGA 1GD9A 2D7YA 5KTBA 2R5CB 3FFHA 4UHMA 3VK4A 1GC2A 4Q76A 1BJNA 3LVKA 4J5UA 2Z61A 3L8AA 3COGA 4RKDA 2Q7WA 4ZSYA 5I92A 1N2TA 3H7FA 1C7GA 3VK3A 1V72A 1C9CA 2X8UA 2RFVA 3MKJA 2FYFA 1X0MA 2Z20A 4XQ2A 2Z1ZA 3GETA 2R5CA 2ZJGA 4W1VA 1D7UA 2F8JA 1O61A 3GR9A 3RBFA 4PVFA 4AZKA 3FKDA 2CJGA 2VGWA 1AMSA 3A2BA 1AJSA 2ZYJA 2FNUA 2O0RA 2R0TA 3ASAA 4WB0A 3I16A 1V2DA 3I5TA 2AY8A 1IX7A 2Z1YA 1IX6A 1LC7A 2Z9VA 3K7YA 1UU2A 4MKJA 1UU0A 4JEZA 1JS6A 5M4DA 4ZM4A 3TCMA 4U1TA 1G4XA 4F5KA 4WYDA 2W7MA 2D65A 3QBOA 4A0RA 1I29A 3DXVA 1M4NA 3FVUA 5F8VA 3N0LA 3QI6A 4A72A 1CZCA 3PIUA 4IYOA 2QB2A 1AHGA 1M0QA 1PG8A 4Q31A 4Y0DA 5DX5A 1ECXA 3FQ7A 4KAMA 1S06A 2YOBA 1ELUA 2YCTA 3K28A 3NYTA 4ZLVA 3CBFA 1KMKA 3W1IA 2DGMA 1MAPA 4ADEA 4DGTA 5LHAA 2VMNA 1BS0A 1SVVA 3HBXA 3E77A 4JF0A 2YCNA 1G7XA 1OHWA 1TOGA 3NU7A 5FT6A 4ZAHA 1C7OA 1BJOB 4XJLA 4P3MA 4JEYA 3N4SA 3N5MA 1CL2A 1B4XA 4WXFA 4EB7A 3JTXA 3DYDA 5E4ZA 3FDDA 3MC6C 4TV7A 3WCOA 4ZM3A 4F5LA 4ZASA 1B5PA 1YAAA 1AICA 3DR7A 3JW9A 4UQVA 4RJ0A 3KGXA 4RITA 1RV3A 2X5FA 3MAFB 2CB1A 2ZY4A 4R5FA 2BWNA 5EAAA 2JJFA 2FNIA 2EZ1A 1ASAA 1AAMA 2D63A 2DGKA 2Z9WA 1GEXA 2QA3A 2GMSA 2JISA 1SFFA 3BS8A 1CJ0A 1FG7A 1H0CA 3LV2A 3BCBA 1DFOA 3FD0A 1DTYA 3P1TA 4OCAA 1UU1A 3NUBA 1WSTA 1MDZA 3AEMA 4HVKA 3NRAA 4H51A 1EG5A 3EI6A 2BIEA 3KE3A 5K8BA 1SF2A 3B1EA 4BA4A 4M2JA 1XI9A 3F6TA 3GZDA 4Q75A 2DKJA 3BWOA 2Z9UA 3AEMC 3RUYA 5HHYA 1CQ6A 2Z9XA 4AZJA 1YNUA 4ZWVA 4XJPA 1S07A 2D5YA 2VMUA 4E1OA 1WKHA 1QZ9A 2D66A 2HUUA 3N75A 3H14A 5BJ3A 1E5FA 2HUIA 1P3WA 1Z7DA 1GCKA 2GSAA 2VIAA 3AEPA 5TF5A 2NMPA 2W8TA 4WYCA 1O69A 2W7LA 3WGBA 4ADDA 4AO9A 4CVQA 3HLMA 3OKSA 3BWNA 3DRDA 5HDMA 3LY1A 5EAVA 2O7CA 4IXSA 3FQ8A 4ADCA 2E7JA 1S09A 2PB2A 2VGUA 2VMZA 1IVRA 2W7FA 3AOVA 1OXOA 2HOXA 4XAUA 3VAXA 1AMRA 3EI5A 4ITGA 1W7LA 3IHJA 1ZODA 2AY4A 2YKVA 3AEOA 1GC4A 4LNJA 4XJOA 2CH1A 8AATA 5HXXA 1KL1A 4M2MA 1ASEA 3B1DA 4TMRA 4LW2A 1X2AA 4F5JA 4JEWA 4K2MA 3UAKA 1O4SA 2PB0A 3EI7A 1TASA 2CINA 4OC9A 3WKRA 5E3KA 1AJSB 4WB0B 3M5UA 1AY8A 4F5HA 2VI8A 3NYSA 4BQ0A 4GRXA 4R8DA 4F5MA 1N31A 5FT5A 4L0OA 1S0AA 4EB5A 2R2NA 1AJRA 5BJ4A 3CQ5A 2VMPA 3MADA 3RCHA 1JG8A 3UWCA 4MQPA 1GDEA 1YJZA 5AX8A 4JE5D 4W1WA 1V2EA 1SPAA 2VMRA 1CQ8A 3H9XA 4BHDA 5E5IA 1ASBA 4NOGA 2YRIA 3BB8A 4IW7A 1B5OA 3HL2A 3PJ0A 1M7YA 2GQNA 1M32A 3P6KA 3RCHB 3W1JA 1S08A 3EUCA 1IBJA 5G4IA 2CJHA 2DOUA 9AATA 1FG3A 1KKPA 3R4TA 1ASGA 1BJOA 3ECDA 1ARGA 3E2YA 2EO5A 3EI8A 3BCAA 4IX8A 4WLJA 4WLHA 5DB5A 3LVJA 1TOEA 2YKUA 1QITA 2D64A 3QPGA 1TOKA 1LKCA 1PFFA 2VLFA 3ISLA 1SZUA 3ELEA 4F5IA 3PPLA 4JEXA 4W1XA 4ISYA 2W7KA 3D6KA 4JF1A 5F9SA 4W5KA 3N7NA 3MC6A 2VGSA 3FSLA 2CFBA 4O6ZA 3WCNA 3MAFA 2W8UA 3R9AA 1ASDA 2QLRA 4WYFA 3KKIA 3GJUA 2VMQA 3QHXA 3F9TA 2YKYA 2FQ6A 3BV0A 4ZDPA 1ARIA 3AATA 3UE8A 1UKJA 4PFNA 2BWPA 3USFA 3A9XA 1XEYA 1OHVA 4UHNA 4ATPA 3E6GA 3WY7A 4B9BA 3B8XA 2AEVA 4A0FA 1T3IA 3DXWA 4IY7A 3E2ZA 2QB3A 2BI3A 3LG0A 2FM1A 4I8AA 4E77A 3IF2A 2PO3A 2CJDA 4BMKA 4ITXA 3ZZKA 3NNKA 2ZY3A 3DODA 1IJIA 3FZ7A 4CXRA 3FVSA 4W91A 4EMYA 1LC8A 1M0PA 3N4RA 4LNMA 4ZDLA 2HP2A 2HOZA 7AATA 3E2FA 3AEJC 1I43A 3WLXA 1SZSA 3HDOA 1MAQA 4IXOA 5J8QA 5C6UA 1ORDA 4QGRA 2V0YA 2ZSMA 1QISA 3CQ4A 1AIAA 3CQ6A 2VIBA 2W7IA 1ASLA 4GEBA 3PAAA 3LVLB 3GSBA 3BWNC 3VOMA 3EZSA 5LH9A 1AMAA 4PIWA 3VP6A 2BI9A 1B9IA 4Q6RA 4JEVA 4XEWA 2VI9A 4GE7A 1ARTA 1QJ5A 1Y4IA 1ASMA 2BHXA 3MEBA 4WYAA 3EIAA 4A0GA 3TFTA 5M46A 3BC8A 3HMUA 3I4JA 1LK9A 2ZSLA 1YOOA 3RBLA 1DGEA 4CBRA 1MGVA 1D2FA 1DGDA 1DJUA 1VJOA 1QIRA 4MQRA 3ATHA 2W7JA 4OYTA 3FTBA 3F0HA 2BI2A 2YCPA 4R5ZA 2W8WA 1W23A 4LW4A 4A6UA 3ASBA 1M0OA 1MLZA 2HORA 4OTLA 3WGCA 1BQAA 3TFUA 4W8IA 3HT4A 2C7TA 2D7ZA 3NX3A 5M4BA 2VMYA 2JGTA 3MAUA 4HF8A 3WKSA 4RM1A 1H1CA 2BIGA 3GZDC 3NTJA 4DBCA 1BKGA 1CL1A 5DJ9A 4MKKA 1WYUA 4WYGA 2W8VA 1RVYA 1LC5A 3KGWA 1ASCA 4AO4A 3B46A 3WZFA 3T32A 4B98A 2WK9A 4K2BA 2A1VA 2AY2A 1G7WA 3AOWA 5G2QA 2WB6A 1AKCA 3W1HA 1GC0A 1I41A 3PDBB 3ZRPA 4E3QA 1IAYA 2GMUA 3DR4A 3G0TA 1D7VA 4GDYA 2AY6A 4RIZA 1ASFA 4FFCA 2ZC0A 1VEFA 3LWSA 1U08A 4ZWMA 4LC3A 2E7IA 4CBSA 4XJMA 4OBUA 3N4XA 1B8GA 3PGYA 2BI5A 5M49A 1O62A 1BJ4A 1AHFA 2AEUA 4MQQA 1AKBA 4K2IA 4H63Q 2OGAA 4EFFA 5FT8A 1PMOA 3AENA 1QGNA 1JF9A 2OQXA 1AY4A 2HP1A 4A6RA 5G0AA 1OXPA 3B1CA 4Y0IA 1WKGA 2Z67A 1YIYA 1Z3ZA 2YKXA 2CH2A 3BN1A 4OT8A 1WYTB 1BW0A 5G09A 4N0WA 2AY5A 3VK2A 3AENB 3E9KA 4OBVA 5G4JA 3EIBA 4K05A 1DKAA 4A6TA 3NYUA 1WYVB 4BA5A 1CZEA 4AH3A 2VGVA 2HUFA 1KL2A 2XH1A 3EI9A 1BT4A 3FCRA 3PA9A 4WD2A 3FRKA 3A8UX 3JU7A 5D95A 5EIGB 4PFFA 2E7UA 2OATA 3QM2A 2DKBA 1RV4A 4J8LA 2OKKA 1IAXA 1ARSA 1ARHA 2BKWA 1M0NA 5EFSA 2ZUKA 3TATA 2AATA 2YHKA 3K40A 4E3RA 3E2ZB 1X28A 3FZ6A 3A9ZA 2JJGA 3HQTA 3PD6A 4GSAA 4OMAA 4Y0HA 4A0HA 2C44A 2ZP7A 1IX8A 4GE9A 1X29A 4IXZA 1KKJA 5EUNA 3FQAA 1TARA 2QMAA 3JWAA 2EYQA 4GE4A 3FFRA 2FKIA 4ZSWA 5EUDA 4ATQA 1CQ7A 3PD6B 3AV7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LNL A;  1GEY A;  1AKA A;  2EH6 A;  2CY8 A;  1EQB A;  1YIZ A;  2XBN A;  5JAY A;  4WXG A;  3GBX A;  1I48 A;  2GB3 A;  4RKC A;  4RLG A;  1OAT A;  2VMX A;  1GC3 A;  2FN6 A;  2VMV A;  3RI6 A;  2ZY2 A;  1AHY A;  3ZRR A;  2WK8 A;  2G6W A;  1JS3 A;  2JJE A;  1MDO A;  1AY5 A;  2QBT A;  1BQD A;  1ASN A;  5EQC A;  2JG2 A;  4IYO B;  2CST A;  3NDN A;  4F5G A;  3G7Q A;  2X3L A;  5IWQ A;  1ZOB A;  1MDX A;  1DJE A;  2YRR A;  1AX4 A;  4FL0 A;  2HZP A;  1RVU A;  2DR1 A;  3GZC A;  2VGZ A;  3JWB A;  4RAE A;  2HOY A;  5D5S A;  1GBN A;  1AMQ A;  3QGU A;  2O1B A;  4WXB A;  2BYL A;  1SZK A;  5FT4 A;  1VP4 A;  2VMO A;  2C81 A;  4MSO A;  4EU1 A;  3II0 A;  2ORD A;  1YJY A;  1AIB A;  2TPL A;  2CAN A;  3LVM A;  1W7N A;  2ZY5 A;  2WK7 A;  1AHE A;  1MLY A;  3AEL A;  3ELP A;  4WBT A;  3NU8 A;  1YJS A;  1TPL A;  1B9H A;  2V1P A;  3RQ1 A;  2VMW A;  3ZZJ A;  1WYU B;  3DC1 A;  4RJY A;  2X5D A;  4F5F A;  2BYJ A;  1TAT A;  1LS3 A;  1D7S A;  2AY1 A;  3GWP A;  1W7M A;  2E54 A;  2EGY A;  1IUG A;  4WYE A;  4TN4 A;  2VLH A;  3ACZ A;  4N0B A;  3FVX A;  2OGE A;  3G8M A;  4UHO A;  1LW4 A;  2AY7 A;  3PDX A;  1G4V A;  1CS1 A;  5DJ1 A;  1BJW A;  1C0N A;  3PDB A;  2W7H A;  2WKA A;  2AY3 A;  1V2F A;  3QN6 A;  3FZ8 A;  2OKJ A;  1TOI A;  4U2H A;  2VMT A;  3OP7 A;  4P7Y A;  3ZRQ A;  3EZ1 A;  3A9Y A;  1AAW A;  3L44 A;  3AEJ A;  1N8P A;  2BI1 A;  1C7N A;  1FC4 A;  2W7E A;  2EZ2 A;  2VYC A;  1OHY A;  2BWO A;  3Q8N A;  3JZL A;  1PMM A;  4A00 A;  2JJH A;  4XK1 A;  4AOA A;  4MGR A;  4MY5 A;  4KYO A;  1ELQ A;  2AY9 A;  4ADB A;  1LW5 A;  2DGL A;  1C4K A;  2D61 A;  5EUE A;  1E5E A;  1EJI A;  1QJ3 A;  4DQ6 A;  3HVY A;  4R2N A;  2R5E A;  1M6S A;  2W8J A;  3WX9 A;  3TQX A;  1DJ9 A;  1GEW A;  1W3U A;  3CAI A;  4KXK A;  1KMJ A;  1WYT A;  3BCX A;  1J04 A;  4JE5 A;  1J32 A;  2W7G A;  2EPJ A;  1ZC9 A;  1D7R A;  3FDB A;  2VGT A;  4WP0 A;  3NUI A;  2VMS A;  1WYV A;  2CTZ A;  3DZZ A;  4UOY A;  1TOJ A;  2W7D A;  4M2K A;  1AHX A;  4F4E A;  5G2P A;  4ZDO A;  2BIA A;  2C0R A;  4CXQ A;  3DU4 A;  3MBB A;  5EIG A;  1GD9 A;  2D7Y A;  2R5C B;  3FFH A;  4UHM A;  3VK4 A;  1GC2 A;  4Q76 A;  1BJN A;  3LVK A;  4J5U A;  2Z61 A;  3L8A A;  3COG A;  4RKD A;  2Q7W A;  4ZSY A;  5I92 A;  1N2T A;  3H7F A;  1C7G A;  3VK3 A;  1V72 A;  1C9C A;  2X8U A;  2RFV A;  3MKJ A;  2FYF A;  1X0M A;  2Z20 A;  4XQ2 A;  2Z1Z A;  3GET A;  2R5C A;  2ZJG A;  4W1V A;  1D7U A;  2F8J A;  1O61 A;  3GR9 A;  3RBF A;  4PVF A;  4AZK A;  3FKD A;  2CJG A;  2VGW A;  1AMS A;  3A2B A;  1AJS A;  2ZYJ A;  2FNU A;  2O0R A;  2R0T A;  3ASA A;  4WB0 A;  3I16 A;  1V2D A;  3I5T A;  2AY8 A;  1IX7 A;  2Z1Y A;  1IX6 A;  1LC7 A;  2Z9V A;  3K7Y A;  1UU2 A;  4MKJ A;  1UU0 A;  4JEZ A;  1JS6 A;  5M4D A;  4ZM4 A;  3TCM A;  4U1T A;  1G4X A;  4F5K A;  4WYD A;  2W7M A;  2D65 A;  3QBO A;  4A0R A;  1I29 A;  3DXV A;  1M4N A;  3FVU A;  5F8V A;  3N0L A;  3QI6 A;  4A72 A;  1CZC A;  3PIU A;  4IYO A;  2QB2 A;  1AHG A;  1M0Q A;  1PG8 A;  4Q31 A;  4Y0D A;  5DX5 A;  1ECX A;  3FQ7 A;  4KAM A;  1S06 A;  2YOB A;  1ELU A;  2YCT A;  3K28 A;  3NYT A;  4ZLV A;  3CBF A;  1KMK A;  3W1I A;  2DGM A;  1MAP A;  4ADE A;  4DGT A;  5LHA A;  2VMN A;  1BS0 A;  1SVV A;  3HBX A;  3E77 A;  4JF0 A;  2YCN A;  1G7X A;  1OHW A;  1TOG A;  3NU7 A;  5FT6 A;  4ZAH A;  1C7O A;  1BJO B;  4XJL A;  4P3M A;  4JEY A;  3N5M A;  1CL2 A;  1B4X A;  4WXF A;  4EB7 A;  3JTX A;  3DYD A;  5E4Z A;  3FDD A;  3MC6 C;  4TV7 A;  3WCO A;  4ZM3 A;  4F5L A;  4ZAS A;  1B5P A;  1YAA A;  1AIC A;  3DR7 A;  3JW9 A;  4UQV A;  4RJ0 A;  3KGX A;  4RIT A;  1RV3 A;  2X5F A;  3MAF B;  2CB1 A;  2ZY4 A;  4R5F A;  2BWN A;  5EAA A;  2JJF A;  2FNI A;  2EZ1 A;  1ASA A;  1AAM A;  2D63 A;  2DGK A;  2Z9W A;  1GEX A;  2QA3 A;  2GMS A;  2JIS A;  1SFF A;  3BS8 A;  1CJ0 A;  1FG7 A;  1H0C A;  3LV2 A;  3BCB A;  1DFO A;  3FD0 A;  1DTY A;  3P1T A;  4OCA A;  1UU1 A;  3NUB A;  1WST A;  1MDZ A;  3AEM A;  4HVK A;  3NRA A;  4H51 A;  1EG5 A;  3EI6 A;  2BIE A;  3KE3 A;  5K8B A;  1SF2 A;  3B1E A;  4BA4 A;  4M2J A;  1XI9 A;  3F6T A;  3GZD A;  4Q75 A;  2DKJ A;  3BWO A;  2Z9U A;  3AEM C;  3RUY A;  5HHY A;  1CQ6 A;  2Z9X A;  4AZJ A;  1YNU A;  4ZWV A;  4XJP A;  1S07 A;  2D5Y A;  2VMU A;  4E1O A;  1WKH A;  1QZ9 A;  2D66 A;  2HUU A;  3N75 A;  3H14 A;  5BJ3 A;  1E5F A;  2HUI A;  1P3W A;  1Z7D A;  1GCK A;  2GSA A;  2VIA A;  3AEP A;  5TF5 A;  2NMP A;  2W8T A;  4WYC A;  1O69 A;  2W7L A;  3WGB A;  4ADD A;  4AO9 A;  4CVQ A;  3HLM A;  3OKS A;  3BWN A;  3DRD A;  5HDM A;  3LY1 A;  5EAV A;  2O7C A;  4IXS A;  3FQ8 A;  4ADC A;  2E7J A;  1S09 A;  2PB2 A;  2VGU A;  2VMZ A;  1IVR A;  2W7F A;  3AOV A;  1OXO A;  2HOX A;  4XAU A;  3VAX A;  1AMR A;  3EI5 A;  4ITG A;  1W7L A;  3IHJ A;  1ZOD A;  2AY4 A;  2YKV A;  3AEO A;  1GC4 A;  4LNJ A;  4XJO A;  2CH1 A;  8AAT A;  5HXX A;  1KL1 A;  4M2M A;  1ASE A;  3B1D A;  4TMR A;  4LW2 A;  1X2A A;  4F5J A;  4JEW A;  4K2M A;  3UAK A;  1O4S A;  2PB0 A;  3EI7 A;  1TAS A;  2CIN A;  4OC9 A;  3WKR A;  5E3K A;  1AJS B;  4WB0 B;  3M5U A;  1AY8 A;  4F5H A;  2VI8 A;  3NYS A;  4BQ0 A;  4GRX A;  4R8D A;  4F5M A;  1N31 A;  5FT5 A;  4L0O A;  1S0A A;  4EB5 A;  2R2N A;  1AJR A;  5BJ4 A;  3CQ5 A;  2VMP A;  3MAD A;  3RCH A;  1JG8 A;  3UWC A;  4MQP A;  1GDE A;  1YJZ A;  5AX8 A;  4JE5 D;  4W1W A;  1V2E A;  1SPA A;  2VMR A;  1CQ8 A;  4BHD A;  5E5I A;  1ASB A;  4NOG A;  2YRI A;  3BB8 A;  4IW7 A;  1B5O A;  3HL2 A;  3PJ0 A;  1M7Y A;  2GQN A;  1M32 A;  3P6K A;  3RCH B;  3W1J A;  1S08 A;  3EUC A;  1IBJ A;  5G4I A;  2CJH A;  2DOU A;  9AAT A;  1FG3 A;  1KKP A;  3R4T A;  1ASG A;  1BJO A;  3ECD A;  1ARG A;  3E2Y A;  2EO5 A;  3EI8 A;  3BCA A;  4IX8 A;  4WLJ A;  4WLH A;  5DB5 A;  3LVJ A;  1TOE A;  2YKU A;  1QIT A;  2D64 A;  3QPG A;  1TOK A;  1LKC A;  1PFF A;  2VLF A;  3ISL A;  1SZU A;  3ELE A;  4F5I A;  3PPL A;  4JEX A;  4W1X A;  4ISY A;  2W7K A;  3D6K A;  4JF1 A;  5F9S A;  4W5K A;  3MC6 A;  2VGS A;  3FSL A;  2CFB A;  4O6Z A;  3WCN A;  3MAF A;  2W8U A;  3R9A A;  1ASD A;  2QLR A;  4WYF A;  3KKI A;  3GJU A;  2VMQ A;  3QHX A;  3F9T A;  2YKY A;  2FQ6 A;  3BV0 A;  4ZDP A;  1ARI A;  3AAT A;  3UE8 A;  1UKJ A;  4PFN A;  2BWP A;  3USF A;  3A9X A;  1XEY A;  1OHV A;  4UHN A;  4ATP A;  3E6G A;  3WY7 A;  4B9B A;  3B8X A;  2AEV A;  4A0F A;  1T3I A;  3DXW A;  4IY7 A;  3E2Z A;  2QB3 A;  2BI3 A;  3LG0 A;  2FM1 A;  4I8A A;  4E77 A;  3IF2 A;  2PO3 A;  2CJD A;  4BMK A;  4ITX A;  3ZZK A;  3NNK A;  2ZY3 A;  3DOD A;  1IJI A;  3FZ7 A;  4CXR A;  3FVS A;  4W91 A;  4EMY A;  1LC8 A;  1M0P A;  4LNM A;  4ZDL A;  2HP2 A;  2HOZ A;  7AAT A;  3E2F A;  3AEJ C;  1I43 A;  3WLX A;  1SZS A;  3HDO A;  1MAQ A;  4IXO A;  5J8Q A;  5C6U A;  1ORD A;  4QGR A;  2V0Y A;  2ZSM A;  1QIS A;  3CQ4 A;  1AIA A;  3CQ6 A;  2VIB A;  2W7I A;  1ASL A;  4GEB A;  3PAA A;  3LVL B;  3GSB A;  3BWN C;  3VOM A;  3EZS A;  5LH9 A;  1AMA A;  4PIW A;  3VP6 A;  2BI9 A;  1B9I A;  4Q6R A;  4JEV A;  4XEW A;  2VI9 A;  4GE7 A;  1ART A;  1QJ5 A;  1Y4I A;  1ASM A;  2BHX A;  3MEB A;  4WYA A;  3EIA A;  4A0G A;  3TFT A;  5M46 A;  3BC8 A;  3HMU A;  3I4J A;  1LK9 A;  2ZSL A;  1YOO A;  3RBL A;  1DGE A;  4CBR A;  1MGV A;  1D2F A;  1DGD A;  1DJU A;  1VJO A;  1QIR A;  4MQR A;  3ATH A;  2W7J A;  4OYT A;  3FTB A;  3F0H A;  2BI2 A;  2YCP A;  4R5Z A;  2W8W A;  1W23 A;  4LW4 A;  4A6U A;  3ASB A;  1M0O A;  1MLZ A;  2HOR A;  4OTL A;  3WGC A;  1BQA A;  3TFU A;  4W8I A;  3HT4 A;  2C7T A;  2D7Z A;  3NX3 A;  5M4B A;  2VMY A;  2JGT A;  3MAU A;  4HF8 A;  3WKS A;  4RM1 A;  1H1C A;  2BIG A;  3GZD C;  3NTJ A;  4DBC A;  1BKG A;  1CL1 A;  5DJ9 A;  4MKK A;  1WYU A;  4WYG A;  2W8V A;  1RVY A;  1LC5 A;  3KGW A;  1ASC A;  4AO4 A;  3B46 A;  3WZF A;  3T32 A;  4B98 A;  2WK9 A;  4K2B A;  2AY2 A;  1G7W A;  3AOW A;  5G2Q A;  1AKC A;  3W1H A;  1GC0 A;  1I41 A;  3PDB B;  3ZRP A;  4E3Q A;  1IAY A;  2GMU A;  3DR4 A;  3G0T A;  1D7V A;  4GDY A;  2AY6 A;  4RIZ A;  1ASF A;  4FFC A;  2ZC0 A;  1VEF A;  3LWS A;  1U08 A;  4ZWM A;  4LC3 A;  2E7I A;  4CBS A;  4XJM A;  4OBU A;  1B8G A;  3PGY A;  2BI5 A;  5M49 A;  1O62 A;  1BJ4 A;  1AHF A;  2AEU A;  4MQQ A;  1AKB A;  4K2I A;  2OGA A;  4EFF A;  5FT8 A;  1PMO A;  3AEN A;  1QGN A;  1JF9 A;  2OQX A;  1AY4 A;  2HP1 A;  4A6R A;  5G0A A;  1OXP A;  3B1C A;  4Y0I A;  1WKG A;  2Z67 A;  1YIY A;  1Z3Z A;  2YKX A;  2CH2 A;  3BN1 A;  4OT8 A;  1WYT B;  1BW0 A;  5G09 A;  4N0W A;  2AY5 A;  3VK2 A;  3AEN B;  3E9K A;  4OBV A;  5G4J A;  3EIB A;  1DKA A;  4A6T A;  3NYU A;  1WYV B;  4BA5 A;  1CZE A;  4AH3 A;  2VGV A;  2HUF A;  1KL2 A;  2XH1 A;  3EI9 A;  1BT4 A;  3FCR A;  3PA9 A;  4WD2 A;  3FRK A;  3A8U X;  3JU7 A;  5D95 A;  5EIG B;  4PFF A;  2E7U A;  2OAT A;  3QM2 A;  2DKB A;  1RV4 A;  4J8L A;  2OKK A;  1IAX A;  1ARS A;  1ARH A;  2BKW A;  1M0N A;  5EFS A;  2ZUK A;  3TAT A;  2AAT A;  2YHK A;  3K40 A;  4E3R A;  3E2Z B;  1X28 A;  3FZ6 A;  3A9Z A;  2JJG A;  3HQT A;  3PD6 A;  4GSA A;  4OMA A;  4Y0H A;  4A0H A;  2C44 A;  2ZP7 A;  1IX8 A;  4GE9 A;  1X29 A;  4IXZ A;  1KKJ A;  5EUN A;  3FQA A;  1TAR A;  2QMA A;  3JWA A;  4GE4 A;  3FFR A;  4ZSW A;  5EUD A;  4ATQ A;  1CQ7 A;  3PD6 B;  3AV7 A; 
#chains in the Genus database with same CATH topology
 4LNL A;  1GEY A;  1AKA A;  2EH6 A;  2CY8 A;  1EQB A;  1YIZ A;  2XBN A;  5JAY A;  2G7J A;  4WXG A;  3GBX A;  1I48 A;  2GB3 A;  4RKC A;  4RLG A;  1OAT A;  2VMX A;  1GC3 A;  2FN6 A;  2VMV A;  3RI6 A;  2ZY2 A;  1AHY A;  3ZRR A;  2WK8 A;  2G6W A;  1JS3 A;  2JJE A;  1MDO A;  1AY5 A;  2QBT A;  1BQD A;  1ASN A;  5EQC A;  2JG2 A;  4IYO B;  2CST A;  3NDN A;  4F5G A;  3G7Q A;  2X3L A;  5IWQ A;  1ZOB A;  1MDX A;  1DJE A;  2YRR A;  1AX4 A;  4FL0 A;  2HZP A;  1RVU A;  2DR1 A;  3GZC A;  2QSR A;  2VGZ A;  3JWB A;  4RAE A;  2HOY A;  5D5S A;  1GBN A;  1AMQ A;  3QGU A;  2O1B A;  4WXB A;  2BYL A;  1SZK A;  5FT4 A;  1VP4 A;  2VMO A;  2C81 A;  4MSO A;  4EU1 A;  3II0 A;  2ORD A;  1YJY A;  1AIB A;  2TPL A;  2CAN A;  3LVM A;  1W7N A;  2ZY5 A;  2WK7 A;  1AHE A;  1MLY A;  3AEL A;  3ELP A;  4WBT A;  2KFP A;  3NU8 A;  1YJS A;  1TPL A;  1B9H A;  2V1P A;  3RQ1 A;  2VMW A;  3ZZJ A;  1WYU B;  3DC1 A;  4RJY A;  2X5D A;  4F5F A;  2BYJ A;  1TAT A;  1LS3 A;  1D7S A;  2AY1 A;  3GWP A;  1W7M A;  2E54 A;  2EGY A;  1IUG A;  4WYE A;  4TN4 A;  2VLH A;  1KAF A;  3ACZ A;  4N0B A;  3FVX A;  2OGE A;  3G8M A;  4UHO A;  1LW4 A;  2AY7 A;  3PDX A;  1G4V A;  1CS1 A;  5DJ1 A;  1BJW A;  1C0N A;  3PDB A;  2W7H A;  2WKA A;  2AY3 A;  1V2F A;  3QN6 A;  3FZ8 A;  2OKJ A;  1TOI A;  4U2H A;  2VMT A;  3OP7 A;  4P7Y A;  3ZRQ A;  3EZ1 A;  3A9Y A;  1AAW A;  3L44 A;  3AEJ A;  1N8P A;  2BI1 A;  1C7N A;  1FC4 A;  2W7E A;  2EZ2 A;  2VYC A;  1OHY A;  2BWO A;  3Q8N A;  3JZL A;  1PMM A;  4A00 A;  2JJH A;  4XK1 A;  4AOA A;  4MGR A;  4MY5 A;  4KYO A;  1ELQ A;  2AY9 A;  4ADB A;  1LW5 A;  2DGL A;  1C4K A;  2D61 A;  5EUE A;  1E5E A;  1EJI A;  1QJ3 A;  4DQ6 A;  3HVY A;  4R2N A;  2R5E A;  1M6S A;  2W8J A;  3WX9 A;  3TQX A;  1DJ9 A;  1GEW A;  1W3U A;  3CAI A;  4KXK A;  1KMJ A;  1WYT A;  3BCX A;  1J04 A;  4JE5 A;  1J32 A;  2W7G A;  2EPJ A;  1ZC9 A;  1D7R A;  3FDB A;  2VGT A;  4WP0 A;  3NUI A;  2VMS A;  1WYV A;  2CTZ A;  3DZZ A;  4UOY A;  1TOJ A;  2W7D A;  4M2K A;  1AHX A;  4F4E A;  5G2P A;  4ZDO A;  2BIA A;  2C0R A;  4CXQ A;  3DU4 A;  3MBB A;  5EIG A;  1GD9 A;  2D7Y A;  5KTB A;  2R5C B;  3FFH A;  4UHM A;  3VK4 A;  1GC2 A;  4Q76 A;  1BJN A;  3LVK A;  4J5U A;  2Z61 A;  3L8A A;  3COG A;  4RKD A;  2Q7W A;  4ZSY A;  5I92 A;  1N2T A;  3H7F A;  1C7G A;  3VK3 A;  1V72 A;  1C9C A;  2X8U A;  2RFV A;  3MKJ A;  2FYF A;  1X0M A;  2Z20 A;  4XQ2 A;  2Z1Z A;  3GET A;  2R5C A;  2ZJG A;  4W1V A;  1D7U A;  2F8J A;  1O61 A;  3GR9 A;  3RBF A;  4PVF A;  4AZK A;  3FKD A;  2CJG A;  2VGW A;  1AMS A;  3A2B A;  1AJS A;  2ZYJ A;  2FNU A;  2O0R A;  2R0T A;  3ASA A;  4WB0 A;  3I16 A;  1V2D A;  3I5T A;  2AY8 A;  1IX7 A;  2Z1Y A;  1IX6 A;  1LC7 A;  2Z9V A;  3K7Y A;  1UU2 A;  4MKJ A;  1UU0 A;  4JEZ A;  1JS6 A;  5M4D A;  4ZM4 A;  3TCM A;  4U1T A;  1G4X A;  4F5K A;  4WYD A;  2W7M A;  2D65 A;  3QBO A;  4A0R A;  1I29 A;  3DXV A;  1M4N A;  3FVU A;  5F8V A;  3N0L A;  3QI6 A;  4A72 A;  1CZC A;  3PIU A;  4IYO A;  2QB2 A;  1AHG A;  1M0Q A;  1PG8 A;  4Q31 A;  4Y0D A;  5DX5 A;  1ECX A;  3FQ7 A;  4KAM A;  1S06 A;  2YOB A;  1ELU A;  2YCT A;  3K28 A;  3NYT A;  4ZLV A;  3CBF A;  1KMK A;  3W1I A;  2DGM A;  1MAP A;  4ADE A;  4DGT A;  5LHA A;  2VMN A;  1BS0 A;  1SVV A;  3HBX A;  3E77 A;  4JF0 A;  2YCN A;  1G7X A;  1OHW A;  1TOG A;  3NU7 A;  5FT6 A;  4ZAH A;  1C7O A;  1BJO B;  4XJL A;  4P3M A;  4JEY A;  3N4S A;  3N5M A;  1CL2 A;  1B4X A;  4WXF A;  4EB7 A;  3JTX A;  3DYD A;  5E4Z A;  3FDD A;  3MC6 C;  4TV7 A;  3WCO A;  4ZM3 A;  4F5L A;  4ZAS A;  1B5P A;  1YAA A;  1AIC A;  3DR7 A;  3JW9 A;  4UQV A;  4RJ0 A;  3KGX A;  4RIT A;  1RV3 A;  2X5F A;  3MAF B;  2CB1 A;  2ZY4 A;  4R5F A;  2BWN A;  5EAA A;  2JJF A;  2FNI A;  2EZ1 A;  1ASA A;  1AAM A;  2D63 A;  2DGK A;  2Z9W A;  1GEX A;  2QA3 A;  2GMS A;  2JIS A;  1SFF A;  3BS8 A;  1CJ0 A;  1FG7 A;  1H0C A;  3LV2 A;  3BCB A;  1DFO A;  3FD0 A;  1DTY A;  3P1T A;  4OCA A;  1UU1 A;  3NUB A;  1WST A;  1MDZ A;  3AEM A;  4HVK A;  3NRA A;  4H51 A;  1EG5 A;  3EI6 A;  2BIE A;  3KE3 A;  5K8B A;  1SF2 A;  3B1E A;  4BA4 A;  4M2J A;  1XI9 A;  3F6T A;  3GZD A;  4Q75 A;  2DKJ A;  3BWO A;  2Z9U A;  3AEM C;  3RUY A;  5HHY A;  1CQ6 A;  2Z9X A;  4AZJ A;  1YNU A;  4ZWV A;  4XJP A;  1S07 A;  2D5Y A;  2VMU A;  4E1O A;  1WKH A;  1QZ9 A;  2D66 A;  2HUU A;  3N75 A;  3H14 A;  5BJ3 A;  1E5F A;  2HUI A;  1P3W A;  1Z7D A;  1GCK A;  2GSA A;  2VIA A;  3AEP A;  5TF5 A;  2NMP A;  2W8T A;  4WYC A;  1O69 A;  2W7L A;  3WGB A;  4ADD A;  4AO9 A;  4CVQ A;  3HLM A;  3OKS A;  3BWN A;  3DRD A;  5HDM A;  3LY1 A;  5EAV A;  2O7C A;  4IXS A;  3FQ8 A;  4ADC A;  2E7J A;  1S09 A;  2PB2 A;  2VGU A;  2VMZ A;  1IVR A;  2W7F A;  3AOV A;  1OXO A;  2HOX A;  4XAU A;  3VAX A;  1AMR A;  3EI5 A;  4ITG A;  1W7L A;  3IHJ A;  1ZOD A;  2AY4 A;  2YKV A;  3AEO A;  1GC4 A;  4LNJ A;  4XJO A;  2CH1 A;  8AAT A;  5HXX A;  1KL1 A;  4M2M A;  1ASE A;  3B1D A;  4TMR A;  4LW2 A;  1X2A A;  4F5J A;  4JEW A;  4K2M A;  3UAK A;  1O4S A;  2PB0 A;  3EI7 A;  1TAS A;  2CIN A;  4OC9 A;  3WKR A;  5E3K A;  1AJS B;  4WB0 B;  3M5U A;  1AY8 A;  4F5H A;  2VI8 A;  3NYS A;  4BQ0 A;  4GRX A;  4R8D A;  4F5M A;  1N31 A;  5FT5 A;  4L0O A;  1S0A A;  4EB5 A;  2R2N A;  1AJR A;  5BJ4 A;  3CQ5 A;  2VMP A;  3MAD A;  3RCH A;  1JG8 A;  3UWC A;  4MQP A;  1GDE A;  1YJZ A;  5AX8 A;  4JE5 D;  4W1W A;  1V2E A;  1SPA A;  2VMR A;  1CQ8 A;  3H9X A;  4BHD A;  5E5I A;  1ASB A;  4NOG A;  2YRI A;  3BB8 A;  4IW7 A;  1B5O A;  3HL2 A;  3PJ0 A;  1M7Y A;  2GQN A;  1M32 A;  3P6K A;  3RCH B;  3W1J A;  1S08 A;  3EUC A;  1IBJ A;  5G4I A;  2CJH A;  2DOU A;  9AAT A;  1FG3 A;  1KKP A;  3R4T A;  1ASG A;  1BJO A;  3ECD A;  1ARG A;  3E2Y A;  2EO5 A;  3EI8 A;  3BCA A;  4IX8 A;  4WLJ A;  4WLH A;  5DB5 A;  3LVJ A;  1TOE A;  2YKU A;  1QIT A;  2D64 A;  3QPG A;  1TOK A;  1LKC A;  1PFF A;  2VLF A;  3ISL A;  1SZU A;  3ELE A;  4F5I A;  3PPL A;  4JEX A;  4W1X A;  4ISY A;  2W7K A;  3D6K A;  4JF1 A;  5F9S A;  4W5K A;  3N7N A;  3MC6 A;  2VGS A;  3FSL A;  2CFB A;  4O6Z A;  3WCN A;  3MAF A;  2W8U A;  3R9A A;  1ASD A;  2QLR A;  4WYF A;  3KKI A;  3GJU A;  2VMQ A;  3QHX A;  3F9T A;  2YKY A;  2FQ6 A;  3BV0 A;  4ZDP A;  1ARI A;  3AAT A;  3UE8 A;  1UKJ A;  4PFN A;  2BWP A;  3USF A;  3A9X A;  1XEY A;  1OHV A;  4UHN A;  4ATP A;  3E6G A;  3WY7 A;  4B9B A;  3B8X A;  2AEV A;  4A0F A;  1T3I A;  3DXW A;  4IY7 A;  3E2Z A;  2QB3 A;  2BI3 A;  3LG0 A;  2FM1 A;  4I8A A;  4E77 A;  3IF2 A;  2PO3 A;  2CJD A;  4BMK A;  4ITX A;  3ZZK A;  3NNK A;  2ZY3 A;  3DOD A;  1IJI A;  3FZ7 A;  4CXR A;  3FVS A;  4W91 A;  4EMY A;  1LC8 A;  1M0P A;  3N4R A;  4LNM A;  4ZDL A;  2HP2 A;  2HOZ A;  7AAT A;  3E2F A;  3AEJ C;  1I43 A;  3WLX A;  1SZS A;  3HDO A;  1MAQ A;  4IXO A;  5J8Q A;  5C6U A;  1ORD A;  4QGR A;  2V0Y A;  2ZSM A;  1QIS A;  3CQ4 A;  1AIA A;  3CQ6 A;  2VIB A;  2W7I A;  1ASL A;  4GEB A;  3PAA A;  3LVL B;  3GSB A;  3BWN C;  3VOM A;  3EZS A;  5LH9 A;  1AMA A;  4PIW A;  3VP6 A;  2BI9 A;  1B9I A;  4Q6R A;  4JEV A;  4XEW A;  2VI9 A;  4GE7 A;  1ART A;  1QJ5 A;  1Y4I A;  1ASM A;  2BHX A;  3MEB A;  4WYA A;  3EIA A;  4A0G A;  3TFT A;  5M46 A;  3BC8 A;  3HMU A;  3I4J A;  1LK9 A;  2ZSL A;  1YOO A;  3RBL A;  1DGE A;  4CBR A;  1MGV A;  1D2F A;  1DGD A;  1DJU A;  1VJO A;  1QIR A;  4MQR A;  3ATH A;  2W7J A;  4OYT A;  3FTB A;  3F0H A;  2BI2 A;  2YCP A;  4R5Z A;  2W8W A;  1W23 A;  4LW4 A;  4A6U A;  3ASB A;  1M0O A;  1MLZ A;  2HOR A;  4OTL A;  3WGC A;  1BQA A;  3TFU A;  4W8I A;  3HT4 A;  2C7T A;  2D7Z A;  3NX3 A;  5M4B A;  2VMY A;  2JGT A;  3MAU A;  4HF8 A;  3WKS A;  4RM1 A;  1H1C A;  2BIG A;  3GZD C;  3NTJ A;  4DBC A;  1BKG A;  1CL1 A;  5DJ9 A;  4MKK A;  1WYU A;  4WYG A;  2W8V A;  1RVY A;  1LC5 A;  3KGW A;  1ASC A;  4AO4 A;  3B46 A;  3WZF A;  3T32 A;  4B98 A;  2WK9 A;  4K2B A;  2A1V A;  2AY2 A;  1G7W A;  3AOW A;  5G2Q A;  2WB6 A;  1AKC A;  3W1H A;  1GC0 A;  1I41 A;  3PDB B;  3ZRP A;  4E3Q A;  1IAY A;  2GMU A;  3DR4 A;  3G0T A;  1D7V A;  4GDY A;  2AY6 A;  4RIZ A;  1ASF A;  4FFC A;  2ZC0 A;  1VEF A;  3LWS A;  1U08 A;  4ZWM A;  4LC3 A;  2E7I A;  4CBS A;  4XJM A;  4OBU A;  3N4X A;  1B8G A;  3PGY A;  2BI5 A;  5M49 A;  1O62 A;  1BJ4 A;  1AHF A;  2AEU A;  4MQQ A;  1AKB A;  4K2I A;  4H63 Q;  2OGA A;  4EFF A;  5FT8 A;  1PMO A;  3AEN A;  1QGN A;  1JF9 A;  2OQX A;  1AY4 A;  2HP1 A;  4A6R A;  5G0A A;  1OXP A;  3B1C A;  4Y0I A;  1WKG A;  2Z67 A;  1YIY A;  1Z3Z A;  2YKX A;  2CH2 A;  3BN1 A;  4OT8 A;  1WYT B;  1BW0 A;  5G09 A;  4N0W A;  2AY5 A;  3VK2 A;  3AEN B;  3E9K A;  4OBV A;  5G4J A;  3EIB A;  4K05 A;  1DKA A;  4A6T A;  3NYU A;  1WYV B;  4BA5 A;  1CZE A;  4AH3 A;  2VGV A;  2HUF A;  1KL2 A;  2XH1 A;  3EI9 A;  1BT4 A;  3FCR A;  3PA9 A;  4WD2 A;  3FRK A;  3A8U X;  3JU7 A;  5D95 A;  5EIG B;  4PFF A;  2E7U A;  2OAT A;  3QM2 A;  2DKB A;  1RV4 A;  4J8L A;  2OKK A;  1IAX A;  1ARS A;  1ARH A;  2BKW A;  1M0N A;  5EFS A;  2ZUK A;  3TAT A;  2AAT A;  2YHK A;  3K40 A;  4E3R A;  3E2Z B;  1X28 A;  3FZ6 A;  3A9Z A;  2JJG A;  3HQT A;  3PD6 A;  4GSA A;  4OMA A;  4Y0H A;  4A0H A;  2C44 A;  2ZP7 A;  1IX8 A;  4GE9 A;  1X29 A;  4IXZ A;  1KKJ A;  5EUN A;  3FQA A;  1TAR A;  2QMA A;  3JWA A;  2EYQ A;  4GE4 A;  3FFR A;  2FKI A;  4ZSW A;  5EUD A;  4ATQ A;  1CQ7 A;  3PD6 B;  3AV7 A; 
#chains in the Genus database with same CATH homology
 4LNL A;  1GEY A;  1AKA A;  2EH6 A;  2CY8 A;  1EQB A;  1YIZ A;  2XBN A;  5JAY A;  2G7J A;  4WXG A;  3GBX A;  1I48 A;  2GB3 A;  4RKC A;  4RLG A;  1OAT A;  2VMX A;  1GC3 A;  2FN6 A;  2VMV A;  3RI6 A;  2ZY2 A;  1AHY A;  3ZRR A;  2WK8 A;  2G6W A;  1JS3 A;  2JJE A;  1MDO A;  1AY5 A;  2QBT A;  1BQD A;  1ASN A;  5EQC A;  2JG2 A;  4IYO B;  2CST A;  3NDN A;  4F5G A;  3G7Q A;  2X3L A;  5IWQ A;  1ZOB A;  1MDX A;  1DJE A;  2YRR A;  1AX4 A;  4FL0 A;  2HZP A;  1RVU A;  2DR1 A;  3GZC A;  2QSR A;  2VGZ A;  3JWB A;  4RAE A;  2HOY A;  5D5S A;  1GBN A;  1AMQ A;  3QGU A;  2O1B A;  4WXB A;  2BYL A;  1SZK A;  5FT4 A;  1VP4 A;  2VMO A;  2C81 A;  4MSO A;  4EU1 A;  3II0 A;  2ORD A;  1YJY A;  1AIB A;  2TPL A;  2CAN A;  3LVM A;  1W7N A;  2ZY5 A;  2WK7 A;  1AHE A;  1MLY A;  3AEL A;  3ELP A;  4WBT A;  2KFP A;  3NU8 A;  1YJS A;  1TPL A;  1B9H A;  2V1P A;  3RQ1 A;  2VMW A;  3ZZJ A;  1WYU B;  3DC1 A;  4RJY A;  2X5D A;  4F5F A;  2BYJ A;  1TAT A;  1LS3 A;  1D7S A;  2AY1 A;  3GWP A;  1W7M A;  2E54 A;  2EGY A;  1IUG A;  4WYE A;  4TN4 A;  2VLH A;  3ACZ A;  4N0B A;  3FVX A;  2OGE A;  3G8M A;  4UHO A;  1LW4 A;  2AY7 A;  3PDX A;  1G4V A;  1CS1 A;  5DJ1 A;  1BJW A;  1C0N A;  3PDB A;  2W7H A;  2WKA A;  2AY3 A;  1V2F A;  3QN6 A;  3FZ8 A;  2OKJ A;  1TOI A;  4U2H A;  2VMT A;  3OP7 A;  4P7Y A;  3ZRQ A;  3EZ1 A;  3A9Y A;  1AAW A;  3L44 A;  3AEJ A;  1N8P A;  2BI1 A;  1C7N A;  1FC4 A;  2W7E A;  2EZ2 A;  2VYC A;  1OHY A;  2BWO A;  3Q8N A;  3JZL A;  1PMM A;  4A00 A;  2JJH A;  4XK1 A;  4AOA A;  4MGR A;  4MY5 A;  4KYO A;  1ELQ A;  2AY9 A;  4ADB A;  1LW5 A;  2DGL A;  1C4K A;  2D61 A;  5EUE A;  1E5E A;  1EJI A;  1QJ3 A;  4DQ6 A;  3HVY A;  4R2N A;  2R5E A;  1M6S A;  2W8J A;  3WX9 A;  3TQX A;  1DJ9 A;  1GEW A;  1W3U A;  3CAI A;  4KXK A;  1KMJ A;  1WYT A;  3BCX A;  1J04 A;  4JE5 A;  1J32 A;  2W7G A;  2EPJ A;  1ZC9 A;  1D7R A;  3FDB A;  2VGT A;  4WP0 A;  3NUI A;  2VMS A;  1WYV A;  2CTZ A;  3DZZ A;  4UOY A;  1TOJ A;  2W7D A;  4M2K A;  1AHX A;  4F4E A;  5G2P A;  4ZDO A;  2BIA A;  2C0R A;  4CXQ A;  3DU4 A;  3MBB A;  5EIG A;  1GD9 A;  2D7Y A;  5KTB A;  2R5C B;  3FFH A;  4UHM A;  3VK4 A;  1GC2 A;  4Q76 A;  1BJN A;  3LVK A;  4J5U A;  2Z61 A;  3L8A A;  3COG A;  4RKD A;  2Q7W A;  4ZSY A;  5I92 A;  1N2T A;  3H7F A;  1C7G A;  3VK3 A;  1V72 A;  1C9C A;  2X8U A;  2RFV A;  3MKJ A;  2FYF A;  1X0M A;  2Z20 A;  4XQ2 A;  2Z1Z A;  3GET A;  2R5C A;  2ZJG A;  4W1V A;  1D7U A;  2F8J A;  1O61 A;  3GR9 A;  3RBF A;  4PVF A;  4AZK A;  3FKD A;  2CJG A;  2VGW A;  1AMS A;  3A2B A;  1AJS A;  2ZYJ A;  2FNU A;  2O0R A;  2R0T A;  3ASA A;  4WB0 A;  3I16 A;  1V2D A;  3I5T A;  2AY8 A;  1IX7 A;  2Z1Y A;  1IX6 A;  1LC7 A;  2Z9V A;  3K7Y A;  1UU2 A;  4MKJ A;  1UU0 A;  4JEZ A;  1JS6 A;  5M4D A;  4ZM4 A;  3TCM A;  4U1T A;  1G4X A;  4F5K A;  4WYD A;  2W7M A;  2D65 A;  3QBO A;  4A0R A;  1I29 A;  3DXV A;  1M4N A;  3FVU A;  5F8V A;  3N0L A;  3QI6 A;  4A72 A;  1CZC A;  3PIU A;  4IYO A;  2QB2 A;  1AHG A;  1M0Q A;  1PG8 A;  4Q31 A;  4Y0D A;  5DX5 A;  1ECX A;  3FQ7 A;  4KAM A;  1S06 A;  2YOB A;  1ELU A;  2YCT A;  3K28 A;  3NYT A;  4ZLV A;  3CBF A;  1KMK A;  3W1I A;  2DGM A;  1MAP A;  4ADE A;  4DGT A;  5LHA A;  2VMN A;  1BS0 A;  1SVV A;  3HBX A;  3E77 A;  4JF0 A;  2YCN A;  1G7X A;  1OHW A;  1TOG A;  3NU7 A;  5FT6 A;  4ZAH A;  1C7O A;  1BJO B;  4XJL A;  4P3M A;  4JEY A;  3N4S A;  3N5M A;  1CL2 A;  1B4X A;  4WXF A;  4EB7 A;  3JTX A;  3DYD A;  5E4Z A;  3FDD A;  3MC6 C;  4TV7 A;  3WCO A;  4ZM3 A;  4F5L A;  4ZAS A;  1B5P A;  1YAA A;  1AIC A;  3DR7 A;  3JW9 A;  4UQV A;  4RJ0 A;  3KGX A;  4RIT A;  1RV3 A;  2X5F A;  3MAF B;  2CB1 A;  2ZY4 A;  4R5F A;  2BWN A;  5EAA A;  2JJF A;  2FNI A;  2EZ1 A;  1ASA A;  1AAM A;  2D63 A;  2DGK A;  2Z9W A;  1GEX A;  2QA3 A;  2GMS A;  2JIS A;  1SFF A;  3BS8 A;  1CJ0 A;  1FG7 A;  1H0C A;  3LV2 A;  3BCB A;  1DFO A;  3FD0 A;  1DTY A;  3P1T A;  4OCA A;  1UU1 A;  3NUB A;  1WST A;  1MDZ A;  3AEM A;  4HVK A;  3NRA A;  4H51 A;  1EG5 A;  3EI6 A;  2BIE A;  3KE3 A;  5K8B A;  1SF2 A;  3B1E A;  4BA4 A;  4M2J A;  1XI9 A;  3F6T A;  3GZD A;  4Q75 A;  2DKJ A;  3BWO A;  2Z9U A;  3AEM C;  3RUY A;  5HHY A;  1CQ6 A;  2Z9X A;  4AZJ A;  1YNU A;  4ZWV A;  4XJP A;  1S07 A;  2D5Y A;  2VMU A;  4E1O A;  1WKH A;  1QZ9 A;  2D66 A;  2HUU A;  3N75 A;  3H14 A;  5BJ3 A;  1E5F A;  2HUI A;  1P3W A;  1Z7D A;  1GCK A;  2GSA A;  2VIA A;  3AEP A;  5TF5 A;  2NMP A;  2W8T A;  4WYC A;  1O69 A;  2W7L A;  3WGB A;  4ADD A;  4AO9 A;  4CVQ A;  3HLM A;  3OKS A;  3BWN A;  3DRD A;  5HDM A;  3LY1 A;  5EAV A;  2O7C A;  4IXS A;  3FQ8 A;  4ADC A;  2E7J A;  1S09 A;  2PB2 A;  2VGU A;  2VMZ A;  1IVR A;  2W7F A;  3AOV A;  1OXO A;  2HOX A;  4XAU A;  3VAX A;  1AMR A;  3EI5 A;  4ITG A;  1W7L A;  3IHJ A;  1ZOD A;  2AY4 A;  2YKV A;  3AEO A;  1GC4 A;  4LNJ A;  4XJO A;  2CH1 A;  8AAT A;  5HXX A;  1KL1 A;  4M2M A;  1ASE A;  3B1D A;  4TMR A;  4LW2 A;  1X2A A;  4F5J A;  4JEW A;  4K2M A;  3UAK A;  1O4S A;  2PB0 A;  3EI7 A;  1TAS A;  2CIN A;  4OC9 A;  3WKR A;  5E3K A;  1AJS B;  4WB0 B;  3M5U A;  1AY8 A;  4F5H A;  2VI8 A;  3NYS A;  4BQ0 A;  4GRX A;  4R8D A;  4F5M A;  1N31 A;  5FT5 A;  4L0O A;  1S0A A;  4EB5 A;  2R2N A;  1AJR A;  5BJ4 A;  3CQ5 A;  2VMP A;  3MAD A;  3RCH A;  1JG8 A;  3UWC A;  4MQP A;  1GDE A;  1YJZ A;  5AX8 A;  4JE5 D;  4W1W A;  1V2E A;  1SPA A;  2VMR A;  1CQ8 A;  3H9X A;  4BHD A;  5E5I A;  1ASB A;  4NOG A;  2YRI A;  3BB8 A;  4IW7 A;  1B5O A;  3HL2 A;  3PJ0 A;  1M7Y A;  2GQN A;  1M32 A;  3P6K A;  3RCH B;  3W1J A;  1S08 A;  3EUC A;  1IBJ A;  5G4I A;  2CJH A;  2DOU A;  9AAT A;  1FG3 A;  1KKP A;  3R4T A;  1ASG A;  1BJO A;  3ECD A;  1ARG A;  3E2Y A;  2EO5 A;  3EI8 A;  3BCA A;  4IX8 A;  4WLJ A;  4WLH A;  5DB5 A;  3LVJ A;  1TOE A;  2YKU A;  1QIT A;  2D64 A;  3QPG A;  1TOK A;  1LKC A;  1PFF A;  2VLF A;  3ISL A;  1SZU A;  3ELE A;  4F5I A;  3PPL A;  4JEX A;  4W1X A;  4ISY A;  2W7K A;  3D6K A;  4JF1 A;  5F9S A;  4W5K A;  3N7N A;  3MC6 A;  2VGS A;  3FSL A;  2CFB A;  4O6Z A;  3WCN A;  3MAF A;  2W8U A;  3R9A A;  1ASD A;  2QLR A;  4WYF A;  3KKI A;  3GJU A;  2VMQ A;  3QHX A;  3F9T A;  2YKY A;  2FQ6 A;  3BV0 A;  4ZDP A;  1ARI A;  3AAT A;  3UE8 A;  1UKJ A;  4PFN A;  2BWP A;  3USF A;  3A9X A;  1XEY A;  1OHV A;  4UHN A;  4ATP A;  3E6G A;  3WY7 A;  4B9B A;  3B8X A;  2AEV A;  4A0F A;  1T3I A;  3DXW A;  4IY7 A;  3E2Z A;  2QB3 A;  2BI3 A;  3LG0 A;  2FM1 A;  4I8A A;  4E77 A;  3IF2 A;  2PO3 A;  2CJD A;  4BMK A;  4ITX A;  3ZZK A;  3NNK A;  2ZY3 A;  3DOD A;  1IJI A;  3FZ7 A;  4CXR A;  3FVS A;  4W91 A;  4EMY A;  1LC8 A;  1M0P A;  3N4R A;  4LNM A;  4ZDL A;  2HP2 A;  2HOZ A;  7AAT A;  3E2F A;  3AEJ C;  1I43 A;  3WLX A;  1SZS A;  3HDO A;  1MAQ A;  4IXO A;  5J8Q A;  5C6U A;  1ORD A;  4QGR A;  2V0Y A;  2ZSM A;  1QIS A;  3CQ4 A;  1AIA A;  3CQ6 A;  2VIB A;  2W7I A;  1ASL A;  4GEB A;  3PAA A;  3LVL B;  3GSB A;  3BWN C;  3VOM A;  3EZS A;  5LH9 A;  1AMA A;  4PIW A;  3VP6 A;  2BI9 A;  1B9I A;  4Q6R A;  4JEV A;  4XEW A;  2VI9 A;  4GE7 A;  1ART A;  1QJ5 A;  1Y4I A;  1ASM A;  2BHX A;  3MEB A;  4WYA A;  3EIA A;  4A0G A;  3TFT A;  5M46 A;  3BC8 A;  3HMU A;  3I4J A;  1LK9 A;  2ZSL A;  1YOO A;  3RBL A;  1DGE A;  4CBR A;  1MGV A;  1D2F A;  1DGD A;  1DJU A;  1VJO A;  1QIR A;  4MQR A;  3ATH A;  2W7J A;  4OYT A;  3FTB A;  3F0H A;  2BI2 A;  2YCP A;  4R5Z A;  2W8W A;  1W23 A;  4LW4 A;  4A6U A;  3ASB A;  1M0O A;  1MLZ A;  2HOR A;  4OTL A;  3WGC A;  1BQA A;  3TFU A;  4W8I A;  3HT4 A;  2C7T A;  2D7Z A;  3NX3 A;  5M4B A;  2VMY A;  2JGT A;  3MAU A;  4HF8 A;  3WKS A;  4RM1 A;  1H1C A;  2BIG A;  3GZD C;  3NTJ A;  4DBC A;  1BKG A;  1CL1 A;  5DJ9 A;  4MKK A;  1WYU A;  4WYG A;  2W8V A;  1RVY A;  1LC5 A;  3KGW A;  1ASC A;  4AO4 A;  3B46 A;  3WZF A;  3T32 A;  4B98 A;  2WK9 A;  4K2B A;  2A1V A;  2AY2 A;  1G7W A;  3AOW A;  5G2Q A;  2WB6 A;  1AKC A;  3W1H A;  1GC0 A;  1I41 A;  3PDB B;  3ZRP A;  4E3Q A;  1IAY A;  2GMU A;  3DR4 A;  3G0T A;  1D7V A;  4GDY A;  2AY6 A;  4RIZ A;  1ASF A;  4FFC A;  2ZC0 A;  1VEF A;  3LWS A;  1U08 A;  4ZWM A;  4LC3 A;  2E7I A;  4CBS A;  4XJM A;  4OBU A;  3N4X A;  1B8G A;  3PGY A;  2BI5 A;  5M49 A;  1O62 A;  1BJ4 A;  1AHF A;  2AEU A;  4MQQ A;  1AKB A;  4K2I A;  4H63 Q;  2OGA A;  4EFF A;  5FT8 A;  1PMO A;  3AEN A;  1QGN A;  1JF9 A;  2OQX A;  1AY4 A;  2HP1 A;  4A6R A;  5G0A A;  1OXP A;  3B1C A;  4Y0I A;  1WKG A;  2Z67 A;  1YIY A;  1Z3Z A;  2YKX A;  2CH2 A;  3BN1 A;  4OT8 A;  1WYT B;  1BW0 A;  5G09 A;  4N0W A;  2AY5 A;  3VK2 A;  3AEN B;  3E9K A;  4OBV A;  5G4J A;  3EIB A;  4K05 A;  1DKA A;  4A6T A;  3NYU A;  1WYV B;  4BA5 A;  1CZE A;  4AH3 A;  2VGV A;  2HUF A;  1KL2 A;  2XH1 A;  3EI9 A;  1BT4 A;  3FCR A;  3PA9 A;  4WD2 A;  3FRK A;  3A8U X;  3JU7 A;  5D95 A;  5EIG B;  4PFF A;  2E7U A;  2OAT A;  3QM2 A;  2DKB A;  1RV4 A;  4J8L A;  2OKK A;  1IAX A;  1ARS A;  1ARH A;  2BKW A;  1M0N A;  5EFS A;  2ZUK A;  3TAT A;  2AAT A;  2YHK A;  3K40 A;  4E3R A;  3E2Z B;  1X28 A;  3FZ6 A;  3A9Z A;  2JJG A;  3HQT A;  3PD6 A;  4GSA A;  4OMA A;  4Y0H A;  4A0H A;  2C44 A;  2ZP7 A;  1IX8 A;  4GE9 A;  1X29 A;  4IXZ A;  1KKJ A;  5EUN A;  3FQA A;  1TAR A;  2QMA A;  3JWA A;  2EYQ A;  4GE4 A;  3FFR A;  2FKI A;  4ZSW A;  5EUD A;  4ATQ A;  1CQ7 A;  3PD6 B;  3AV7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...