1ECXA

Nifs-like protein
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
376
structure length
364
Chain Sequence
MRVYFDNNATTRVDDRVLEEMIVFYREKYGNPNSAHGMGIEANLHMEKAREKVAKVLGVSPSEIFFTSCATESINWILKTVAETFEKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRGVVKLEELEKLVDEDTFLVSIMAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITYIRKGVPIRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLEISLPNTLSVSFPNIRGSTLQNLLSGYGIYVSTHVLDAMGVDRRIAQGAIRISLCKYNTEEEVDYFLKKIEEILSFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a NifS-like protein from Thermotoga maritima: implications for iron sulphur cluster assembly.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
molecule keywords AMINOTRANSFERASE
total genus 136
structure length 364
sequence length 376
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 1ecxA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 1ecxA01
1AAMA 4WP0A 3RBFA 5LH9A 1V2FA 2VMNA 3NYUA 4KYOA 5E3KA 3VOMA 1BJOB 2BWPA 4GRXA 4RAEA 2R2NA 2GMSA 3FDDA 1B4XA 4JEXA 1D7RA 4J8LA 3ATHA 1AMQA 3BB8A 2HP1A 4LNLA 1W7NA 3FQ7A 3JWAA 3COGA 1ARGA 2DGMA 3BWOA 3GWPA 3UWCA 3A9YA 1DJEA 2EGYA 3AENA 1N31A 9AATA 2G6WA 4MQQA 3KGXA 4WXGA 3II0A 3CAIA 3DZZA 4UHMA 3LVJA 3HT4A 5M49A 3BN1A 3FZ6A 3VK2A 3ZZKA 4NOGA 1N8PA 5G4JA 2BI1A 1CZCA 2AATA 2R5EA 3L8AA 4IYOA 4F5MA 1GC0A 1ASAA 1KKJA 4JF1A 3B1DA 3A2BA 4W1VA 4WLJA 2Z67A 1U08A 1JF9A 1AHFA 2EZ1A 1WYUA 3DU4A 2DGLA 4GE7A 1TOEA 3B1EA 3DRDA 3KE3A 2C44A 3JW9A 3TATA 3AENB 4LNMA 4ITXA 1IUGA 1N2TA 4H51A 4CVQA 2V1PA 3EZ1A 3RBLA 1T3IA 2BIAA 3F0HA 2AY6A 1GC2A 3FKDA 2ZP7A 3VP6A 1YIYA 3D6KA 2BIEA 4CBSA 2OKJA 4LC3A 4WYDA 3T32A 1IX7A 4DGTA 2O0RA 1WYVB 3F9TA 3GZCA 1ASMA 4B98A 1TATA 3A8UX 4AOAA 3FCRA 3AEJC 4JF0A 3B8XA 1VJOA 5EAAA 2W7HA 4ATPA 2X8UA 1M0PA 3EI8A 3EI5A 3FVXA 3EUCA 3ZRPA 1FG3A 2CANA 2HUUA 3MAFA 1AY4A 4EU1A 4M2KA 3FQAA 4RIZA 1SZKA 2QBTA 4HF8A 1IX6A 1LC5A 3BCXA 3GSBA 1V72A 1B9IA 4F5FA 4MKJA 4P7YA 1BJ4A 4ZDPA 1GC3A 2AY5A 2W7DA 3K7YA 4A6UA 1DTYA 1QJ3A 2FNUA 3WLXA 4RM1A 3ZRQA 3N75A 4R2NA 2VMYA 1AX4A 4ZDOA 2ZY2A 1SFFA 1SVVA 2AY2A 2CINA 3JZLA 2VGSA 1M7YA 3E2ZB 1AHXA 2Z9WA 3E6GA 5M4DA 3QBOA 4JEWA 2X3LA 3EIBA 1D2FA 3K40A 2DR1A 5HXXA 3QM2A 4WBTA 4MY5A 2V0YA 1G4XA 4AO9A 3GJUA 4ISYA 1LK9A 3NYSA 3PJ0A 1I41A 4E1OA 3FVSA 1QZ9A 2D64A 4WLHA 1S08A 4CXRA 5F8VA 1W7MA 3F6TA 2O1BA 3TFTA 3NU8A 4OTLA 2Z9VA 4GE4A 3RI6A 1MLYA 4IXOA 1WYVA 3OKSA 2WK7A 2JGTA 1KMKA 2D5YA 4W1WA 2CJDA 3CQ4A 3RQ1A 5D5SA 2YCTA 3AOWA 1OHWA 1C7NA 3PAAA 4JE5A 2YCPA 1IAYA 4M2MA 2XBNA 1ASBA 4XQ2A 2D66A 1QJ5A 3GZDC 5M4BA 1M0QA 1TPLA 1I48A 1XEYA 4K2MA 2VGTA 3NTJA 4PVFA 4WXFA 4ZM3A 3MADA 4M2JA 4WB0B 4EB5A 1QISA 1WKHA 1S06A 3NYTA 1SPAA 4Y0DA 1BT4A 2HOXA 4E3RA 2YRIA 3FZ8A 3QN6A 4IX8A 4F5IA 1AKBA 3NUIA 5EFSA 1AMRA 1MLZA 2R0TA 4MQRA 1MAPA 4ZLVA 3BCAA 4OYTA 2NMPA 5E5IA 5EUDA 4ATQA 1S07A 1M0OA 1QGNA 5D95A 2FM1A 4ZASA 2R5CB 2VMZA 3E2FA 3G0TA 8AATA 1AKAA 2W7EA 1LKCA 5IWQA 1QITA 2YKXA 2CY8A 1ASNA 1GC4A 1C9CA 3BCBA 4LW2A 4MGRA 7AATA 3LWSA 1FG7A 3I5TA 1SF2A 1XI9A 4ADCA 2EO5A 4DBCA 2HOZA 2QLRA 3AEOA 1AJSB 4FL0A 3KKIA 1KKPA 3PD6A 2E7IA 4B9BA 1TOGA 3FRKA 3CQ6A 1MAQA 5G2QA 5BJ4A 2VLFA 2BKWA 5G0AA 1OHYA 1MGVA 3ASBA 1KL2A 3LV2A 2EZ2A 2CB1A 3NNKA 3P6KA 1FC4A 2ZY3A 3E2YA 2O7CA 3ZZJA 1BQAA 5FT5A 1EG5A 4RITA 5E4ZA 3IHJA 3QGUA 2W7IA 4AH3A 1M6SA 2DGKA 2Z1ZA 4N0BA 2ZY5A 2D65A 5EUEA 1C0NA 1GBNA 1RV4A 2GMUA 1H1CA 1ASFA 2HP2A 4JEVA 3DYDA 4QGRA 3W1IA 4ZWVA 1BKGA 3PPLA 2X5DA 4WYAA 1YOOA 5G2PA 1E5EA 1ARHA 3N5MA 1ORDA 2YOBA 2D7YA 4RKDA 3E2ZA 2ZC0A 5FT6A 4ZSWA 4A0GA 2R5CA 4XAUA 4BQ0A 5C6UA 1S0AA 4A0HA 2CH2A 1AHYA 3HQTA 1GDEA 2AY7A 2PO3A 4BHDA 1MDZA 2HUFA 4KXKA 1GD9A 1DJ9A 3BV0A 4Q75A 4W5KA 4IYOB 4WXBA 5FT4A 4HVKA 5JAYA 1UU2A 4XJOA 3MKJA 4U1TA 4Q6RA 3LY1A 2DKBA 2AEUA 2HZPA 3AEMC 3L44A 3QI6A 3K28A 5F9SA 2XH1A 2Z61A 3PDBB 2CJGA 4F4EA 3ELPA 2W8UA 4E3QA 1AKCA 2AY8A 4ZM4A 3N0LA 4ZDLA 1TOIA 4PIWA 4IY7A 1B5OA 1S09A 3ASAA 2AY9A 3WGCA 3HDOA 3WY7A 5HHYA 2W7JA 4K2BA 4RJ0A 4XK1A 2ZY4A 4OCAA 3UAKA 1X2AA 4RLGA 1JS6A 3GETA 1V2DA 1OATA 1Y4IA 2ZSMA 3HBXA 4P3MA 1WYTA 1AHEA 3MAFB 2WK9A 1I29A 2EPJA 2ZUKA 2GQNA 1AHGA 3AEJA 2Z9UA 3MC6A 3UE8A 1D7SA 5HDMA 1BW0A 1SZUA 1H0CA 2AY3A 2W8VA 2VGWA 3PDBA 1W3UA 4L0OA 3WZFA 2AY1A 1J04A 2PB0A 2VYCA 3MEBA 3PIUA 2OGAA 1GEYA 1PFFA 3R9AA 1IBJA 1RV3A 2JJFA 3DR4A 3ECDA 4EB7A 1JG8A 1ARSA 4TV7A 1O4SA 4WYCA 4AZJA 1LS3A 2OQXA 1G4VA 4PFFA 1WKGA 2BWOA 2D63A 3BC8A 1YJSA 1QIRA 2ZYJA 1B5PA 2VMPA 3A9XA 3H7FA 3NU7A 4R5ZA 4WYGA 4XEWA 3VK4A 5EUNA 2ZJGA 1ASLA 3WGBA 1UKJA 3HMUA 4F5JA 4GSAA 2FNIA 4KAMA 1TOKA 2VMUA 3WKRA 4A72A 2VMWA 1AIBA 2DOUA 4A00A 4BA5A 1GCKA 1AY8A 1G7WA 1TASA 1VEFA 4U2HA 2OATA 4W91A 2BWNA 3QHXA 1AMSA 2VMXA 3WKSA 4A6TA 2FQ6A 3LVLB 4DQ6A 1SZSA 3GR9A 1ASDA 1VP4A 1YJYA 4UOYA 4MQPA 4UHOA 3CQ5A 2GSAA 4IXZA 2RFVA 2VGVA 1ZOBA 2Z20A 1KL1A 2VLHA 2PB2A 2VIAA 2VGZA 1AY5A 2C7TA 1MDOA 1PMOA 1IJIA 3ISLA 1IVRA 4ADEA 1CQ8A 1G7XA 2QB3A 3BWNC 1C7OA 2VMQA 1YAAA 1M0NA 1DJUA 2CFBA 1X0MA 3W1JA 1OHVA 1UU0A 2D7ZA 1CL2A 3AEMA 3G7QA 1UU1A 1PMMA 3GZDA 3WCOA 3LVMA 2YKYA 4AO4A 4FFCA 3EZSA 3MAUA 5EQCA 5EIGA 1DGDA 2AY4A 1ASCA 1X28A 4F5GA 2VMSA 3ACZA 3EIAA 1M4NA 3AOVA 1BJNA 4EFFA 2JJHA 3DC1A 1ASGA 1PG8A 4E77A 4GDYA 1AJRA 4UQVA 4MKKA 2W7LA 4CBRA 3FQ8A 4LW4A 5DJ1A 5G4IA 1O61A 4XJPA 1O62A 2BIGA 2TPLA 3KGWA 2ZSLA 3B1CA 3AATA 4RJYA 5EAVA 4Q31A 1AICA 3HL2A 1OXPA 2VI9A 3NRAA 2VMVA 5K8BA 1P3WA 1LW4A 1CZEA 2OGEA 2OKKA 3AEPA 3I16A 3FFHA 4WYEA 3RCHA 4A6RA 4K2IA 1MDXA 2E7JA 3FD0A 3AELA 3NDNA 3AV7A 1DKAA 1I43A 2EH6A 4AZKA 1BJOA 2BYJA 1EJIA 2Z1YA 3FDBA 1YIZA 3G8MA 3B46A 4F5LA 4XJLA 2W7FA 3E77A 1AJSA 4J5UA 1D7UA 2E7UA 2YKVA 3JWBA 3DODA 4IXSA 4R8DA 5M46A 1RVUA 1ARTA 1M32A 3WX9A 1X29A 1RVYA 4F5KA 1B9HA 2YRRA 3E9KA 2E54A 1AAWA 1C4KA 1ELUA 2VMTA 3DXWA 4LNJA 1AIAA 1LC8A 2JG2A 2YCNA 3PDXA 2C0RA 1O69A 2F8JA 3MC6C 3RCHB 2HUIA 3MBBA 3PD6B 1CQ7A 3M5UA 4I8AA 3HLMA 5FT8A 4PFNA 1DGEA 2BI5A 3LVKA 4ZWMA 1V2EA 4BMKA 1W7LA 4UHNA 3FVUA 2JJEA 2W7MA 3I4JA 1IX8A 5DX5A 4GE9A 3ELEA 4ZAHA 5DB5A 1JS3A 1LW5A 4OT8A 4TMRA 3USFA 5AX8A 2FYFA 1W23A 4ADBA 2CSTA 1WSTA 1WYTB 1Z7DA 3JU7A 3VK3A 3FTBA 3JTXA 4WD2A 2CH1A 2VGUA 4A0RA 3OP7A 4RKCA 5J8QA 3DR7A 1J32A 4W1XA 2BI2A 2FN6A 3FSLA 1EQBA 4TN4A 4BA4A 3QPGA 2WK8A 1ZODA 1C7GA 1YNUA 2CTZA 1CL1A 2Z9XA 3BWNA 1TOJA 4WB0A 3TFUA 2BHXA 5I92A 1CS1A 3FZ7A 2QB2A 1D7VA 1DFOA 1OXOA 3NUBA 3GBXA 4MSOA 3H14A 3IF2A 2Q7WA 4JEZA 1Z3ZA 2QA3A 3W1HA 3TCMA 1BJWA 2VMRA 1LC7A 2GB3A 4N0WA 3ZRRA 2ORDA 2W8TA 3DXVA 4OMAA 5LHAA 3PGYA 1KMJA 4Q76A 2W8JA 4GEBA 1ASEA 5TF5A 1CJ0A 4OC9A 2VIBA 1E5FA 1YJZA 1GEWA 2C81A 4R5FA 2D61A 1ELQA 2W7GA 4ZSYA 2WKAA 2DKJA 2VMOA 2QMAA 2JISA 3P1TA 1TARA 2W7KA 3NX3A 2JJGA 4Y0HA 5G09A 3RUYA 3HVYA 2BYLA 5EIGB 1WYUB 4EMYA 2BI3A 4JE5D 4OBVA 1IAXA 2HOYA 3TQXA 3EI6A 1CQ6A 2W8WA 1ECXA 3FFRA 4W8IA 1AMAA 4ADDA 4ITGA 3BS8A 1GEXA 3R4TA 2VI8A 3PA9A 3Q8NA 4O6ZA 1ZC9A 2YKUA 2AEVA 3A9ZA 3WCNA 4XJMA 1ARIA 4WYFA 2X5FA 1B8GA 4OBUA 3EI9A 2BI9A 3VAXA 2YHKA 4JEYA 1BS0A 5DJ9A 5BJ3A 2CJHA 3CBFA 4IW7A 4A0FA 4Y0IA 3LG0A 2HORA 1BQDA 3EI7A 4F5HA 4CXQA
chains in the Genus database with same CATH superfamily
1AAMA 4WP0A 3RBFA 5LH9A 1V2FA 2VMNA 3NYUA 4KYOA 5E3KA 3VOMA 1BJOB 2BWPA 4GRXA 4RAEA 2R2NA 2GMSA 3FDDA 1B4XA 4JEXA 1D7RA 4J8LA 3ATHA 1AMQA 3BB8A 2HP1A 4LNLA 1W7NA 3FQ7A 3JWAA 3COGA 1ARGA 2DGMA 3BWOA 3GWPA 3UWCA 3A9YA 1DJEA 2EGYA 3AENA 1N31A 9AATA 2G6WA 4MQQA 3KGXA 4WXGA 3II0A 3CAIA 3DZZA 4UHMA 3LVJA 3HT4A 5M49A 3BN1A 3FZ6A 3VK2A 3ZZKA 4NOGA 1N8PA 5G4JA 2BI1A 1CZCA 2AATA 2R5EA 3L8AA 4IYOA 4F5MA 1GC0A 1ASAA 1KKJA 4JF1A 3B1DA 3A2BA 4W1VA 4WLJA 2Z67A 1U08A 1JF9A 1AHFA 2EZ1A 1WYUA 3DU4A 2DGLA 4GE7A 1TOEA 3B1EA 3DRDA 3KE3A 2C44A 3JW9A 3TATA 3AENB 4LNMA 4ITXA 1IUGA 1N2TA 4H51A 4CVQA 2V1PA 3EZ1A 3RBLA 1T3IA 2BIAA 3F0HA 2AY6A 1GC2A 3FKDA 2ZP7A 3VP6A 1YIYA 3D6KA 2BIEA 4CBSA 2OKJA 4LC3A 4WYDA 3T32A 1IX7A 4DGTA 2O0RA 1WYVB 3F9TA 3GZCA 1ASMA 4B98A 1TATA 3A8UX 4AOAA 3FCRA 3AEJC 4JF0A 3B8XA 1VJOA 5EAAA 2W7HA 4ATPA 2X8UA 1M0PA 3EI8A 3EI5A 3FVXA 3EUCA 3ZRPA 1FG3A 2CANA 2HUUA 3MAFA 1AY4A 4EU1A 4M2KA 3FQAA 4RIZA 1SZKA 2QBTA 4HF8A 1IX6A 1LC5A 3BCXA 3GSBA 1V72A 1B9IA 4F5FA 4MKJA 4P7YA 1BJ4A 4ZDPA 1GC3A 2AY5A 2W7DA 3K7YA 4A6UA 1DTYA 1QJ3A 2FNUA 3WLXA 4RM1A 3ZRQA 3N75A 4R2NA 2VMYA 1AX4A 4ZDOA 2ZY2A 1SFFA 1SVVA 2AY2A 2CINA 3JZLA 2VGSA 1M7YA 3E2ZB 1AHXA 2Z9WA 3E6GA 5M4DA 3QBOA 4JEWA 2X3LA 3EIBA 1D2FA 3K40A 2DR1A 5HXXA 3QM2A 4WBTA 4MY5A 2V0YA 1G4XA 4AO9A 3GJUA 4ISYA 1LK9A 3NYSA 3PJ0A 1I41A 4E1OA 3FVSA 1QZ9A 2D64A 4WLHA 1S08A 4CXRA 5F8VA 1W7MA 3F6TA 2O1BA 3TFTA 3NU8A 4OTLA 2Z9VA 4GE4A 3RI6A 1MLYA 4IXOA 1WYVA 3OKSA 2WK7A 2JGTA 1KMKA 2D5YA 4W1WA 2CJDA 3CQ4A 3RQ1A 5D5SA 2YCTA 3AOWA 1OHWA 1C7NA 3PAAA 4JE5A 2YCPA 1IAYA 4M2MA 2XBNA 1ASBA 4XQ2A 2D66A 1QJ5A 3GZDC 5M4BA 1M0QA 1TPLA 1I48A 1XEYA 4K2MA 2VGTA 3NTJA 4PVFA 4WXFA 4ZM3A 3MADA 4M2JA 4WB0B 4EB5A 1QISA 1WKHA 1S06A 3NYTA 1SPAA 4Y0DA 1BT4A 2HOXA 4E3RA 2YRIA 3FZ8A 3QN6A 4IX8A 4F5IA 2G7JA 1AKBA 3NUIA 5EFSA 1AMRA 1MLZA 2R0TA 4MQRA 1MAPA 4ZLVA 3BCAA 4OYTA 2NMPA 5E5IA 5EUDA 4ATQA 1S07A 1M0OA 1QGNA 5D95A 2FM1A 4ZASA 2R5CB 2VMZA 3E2FA 3G0TA 8AATA 1AKAA 2W7EA 1LKCA 5IWQA 1QITA 2YKXA 2CY8A 1ASNA 1GC4A 1C9CA 3BCBA 4LW2A 4MGRA 7AATA 3LWSA 1FG7A 3I5TA 1SF2A 1XI9A 4ADCA 2EO5A 4DBCA 2HOZA 2A1VA 2QLRA 3AEOA 1AJSB 4FL0A 3KKIA 1KKPA 3PD6A 2E7IA 4B9BA 1TOGA 3FRKA 3CQ6A 1MAQA 5G2QA 5BJ4A 2VLFA 2BKWA 5G0AA 1OHYA 1MGVA 3ASBA 1KL2A 3LV2A 2EZ2A 2CB1A 3NNKA 3P6KA 1FC4A 2ZY3A 3E2YA 2O7CA 3ZZJA 1BQAA 5FT5A 1EG5A 4RITA 5E4ZA 3IHJA 3QGUA 2W7IA 4AH3A 1M6SA 2DGKA 2Z1ZA 4N0BA 2ZY5A 2D65A 5EUEA 1C0NA 1GBNA 1RV4A 2GMUA 1H1CA 1ASFA 2HP2A 4JEVA 3DYDA 4QGRA 3W1IA 4ZWVA 1BKGA 3PPLA 2X5DA 4WYAA 1YOOA 5G2PA 1E5EA 1ARHA 3N5MA 1ORDA 2YOBA 2D7YA 4RKDA 3E2ZA 2ZC0A 5FT6A 4ZSWA 4A0GA 2R5CA 4XAUA 4BQ0A 5C6UA 3N4XA 1S0AA 4A0HA 2CH2A 1AHYA 3HQTA 1GDEA 2AY7A 2PO3A 4BHDA 4H63Q 1MDZA 2HUFA 4KXKA 1GD9A 1DJ9A 3BV0A 4Q75A 4W5KA 4IYOB 4WXBA 5FT4A 4HVKA 5JAYA 1UU2A 4XJOA 3MKJA 4U1TA 4Q6RA 3LY1A 2DKBA 2AEUA 2HZPA 3AEMC 3L44A 3QI6A 3K28A 5F9SA 2XH1A 2Z61A 3PDBB 2CJGA 4F4EA 3ELPA 2W8UA 4E3QA 2WB6A 1AKCA 2AY8A 4ZM4A 3N0LA 4ZDLA 1TOIA 4PIWA 4IY7A 1B5OA 1S09A 3ASAA 2AY9A 3WGCA 3HDOA 3WY7A 5HHYA 2W7JA 4K2BA 4RJ0A 4XK1A 2ZY4A 3N4RA 4OCAA 3UAKA 1X2AA 4RLGA 1JS6A 3GETA 1V2DA 1OATA 1Y4IA 2ZSMA 3HBXA 4P3MA 1WYTA 1AHEA 3MAFB 2WK9A 1I29A 2EPJA 2ZUKA 2GQNA 1AHGA 3AEJA 2Z9UA 3MC6A 3UE8A 1D7SA 5HDMA 1BW0A 1SZUA 1H0CA 2AY3A 2W8VA 2VGWA 3PDBA 1W3UA 4L0OA 3WZFA 2AY1A 1J04A 2PB0A 2VYCA 3MEBA 3PIUA 2OGAA 1GEYA 1PFFA 3R9AA 1IBJA 1RV3A 2JJFA 3DR4A 3ECDA 4EB7A 2EYQA 1JG8A 1ARSA 4TV7A 1O4SA 4WYCA 4AZJA 1LS3A 2OQXA 1G4VA 4PFFA 1WKGA 2BWOA 2D63A 3BC8A 1YJSA 1QIRA 2ZYJA 1B5PA 2VMPA 3A9XA 3H7FA 3NU7A 4R5ZA 4WYGA 4XEWA 3VK4A 5EUNA 2ZJGA 1ASLA 3WGBA 1UKJA 3HMUA 4F5JA 4GSAA 2FNIA 4KAMA 1TOKA 2VMUA 3WKRA 4A72A 2VMWA 1AIBA 2DOUA 4A00A 4BA5A 1GCKA 1AY8A 1G7WA 1TASA 1VEFA 4U2HA 2OATA 4W91A 2BWNA 3QHXA 1AMSA 2VMXA 3WKSA 4A6TA 2FQ6A 3LVLB 5KTBA 4DQ6A 1SZSA 3GR9A 1ASDA 1VP4A 1YJYA 4UOYA 4MQPA 4UHOA 3CQ5A 2GSAA 4IXZA 2RFVA 2VGVA 1ZOBA 2Z20A 3H9XA 1KL1A 2VLHA 2PB2A 2VIAA 2VGZA 1AY5A 2C7TA 1MDOA 1PMOA 1IJIA 3ISLA 1IVRA 4ADEA 1CQ8A 1G7XA 2QB3A 3BWNC 1C7OA 2VMQA 1YAAA 1M0NA 1DJUA 2CFBA 1X0MA 3W1JA 1OHVA 1UU0A 2D7ZA 1CL2A 3AEMA 3G7QA 2FKIA 1UU1A 1PMMA 3GZDA 3WCOA 3LVMA 2YKYA 4AO4A 4FFCA 3EZSA 3MAUA 5EQCA 5EIGA 1DGDA 2AY4A 1ASCA 1X28A 4F5GA 2VMSA 3ACZA 3EIAA 1M4NA 3AOVA 1BJNA 4EFFA 2JJHA 3DC1A 1ASGA 1PG8A 4E77A 4GDYA 1AJRA 4UQVA 4MKKA 2W7LA 4CBRA 3FQ8A 4LW4A 5DJ1A 5G4IA 1O61A 4XJPA 1O62A 2BIGA 2TPLA 3KGWA 2ZSLA 3B1CA 3AATA 4RJYA 5EAVA 4Q31A 1AICA 3HL2A 1OXPA 2VI9A 3NRAA 2VMVA 5K8BA 1P3WA 1LW4A 1CZEA 2OGEA 2OKKA 3AEPA 3I16A 3FFHA 4WYEA 3RCHA 4A6RA 4K2IA 1MDXA 2E7JA 3FD0A 3AELA 3NDNA 3AV7A 1DKAA 1I43A 2EH6A 4AZKA 1BJOA 2BYJA 1EJIA 2Z1YA 3FDBA 1YIZA 3G8MA 3B46A 4F5LA 3N7NA 4XJLA 2W7FA 3E77A 1AJSA 4J5UA 1D7UA 2E7UA 2YKVA 3JWBA 3DODA 4IXSA 4R8DA 5M46A 1RVUA 1ARTA 1M32A 3WX9A 1X29A 1RVYA 4F5KA 1B9HA 2YRRA 3E9KA 2E54A 1AAWA 1C4KA 1ELUA 2VMTA 3DXWA 4LNJA 1AIAA 1LC8A 2JG2A 2YCNA 3PDXA 2KFPA 2C0RA 1O69A 2F8JA 3MC6C 3RCHB 2HUIA 3MBBA 3PD6B 1CQ7A 3M5UA 4I8AA 3HLMA 5FT8A 4PFNA 1DGEA 2BI5A 3LVKA 4ZWMA 1V2EA 4BMKA 1W7LA 4UHNA 3FVUA 2JJEA 2W7MA 3I4JA 1IX8A 5DX5A 4GE9A 3ELEA 4ZAHA 5DB5A 1JS3A 1LW5A 4OT8A 4TMRA 3USFA 5AX8A 2FYFA 1W23A 4ADBA 2CSTA 1WSTA 1WYTB 1Z7DA 3JU7A 3VK3A 3FTBA 3JTXA 4WD2A 2CH1A 2VGUA 4A0RA 3OP7A 4RKCA 5J8QA 3DR7A 1J32A 4W1XA 2BI2A 2FN6A 3FSLA 1EQBA 4TN4A 4BA4A 3QPGA 2WK8A 1ZODA 1C7GA 1YNUA 2CTZA 2QSRA 1CL1A 2Z9XA 3BWNA 1TOJA 4WB0A 3TFUA 2BHXA 5I92A 1CS1A 3FZ7A 2QB2A 1D7VA 1DFOA 1OXOA 3NUBA 3GBXA 4MSOA 3H14A 3IF2A 2Q7WA 4JEZA 1Z3ZA 2QA3A 3W1HA 3TCMA 1BJWA 2VMRA 1LC7A 2GB3A 4N0WA 3ZRRA 2ORDA 2W8TA 3DXVA 4OMAA 5LHAA 3PGYA 1KMJA 1KAFA 4Q76A 2W8JA 4GEBA 1ASEA 5TF5A 1CJ0A 4OC9A 2VIBA 1E5FA 1YJZA 1GEWA 2C81A 4R5FA 2D61A 1ELQA 2W7GA 4ZSYA 2WKAA 2DKJA 2VMOA 2QMAA 2JISA 3P1TA 1TARA 2W7KA 3NX3A 2JJGA 4Y0HA 5G09A 3RUYA 3HVYA 2BYLA 5EIGB 1WYUB 4EMYA 2BI3A 4JE5D 4OBVA 1IAXA 2HOYA 3TQXA 3EI6A 1CQ6A 2W8WA 1ECXA 3FFRA 4W8IA 1AMAA 4ADDA 4ITGA 3BS8A 1GEXA 3R4TA 2VI8A 3PA9A 3Q8NA 4O6ZA 1ZC9A 2YKUA 2AEVA 3A9ZA 3WCNA 4XJMA 1ARIA 4WYFA 4K05A 2X5FA 1B8GA 4OBUA 3EI9A 2BI9A 3VAXA 2YHKA 4JEYA 1BS0A 5DJ9A 5BJ3A 2CJHA 3CBFA 4IW7A 4A0FA 4Y0IA 3LG0A 2HORA 1BQDA 3EI7A 4F5HA 3N4SA 4CXQA
chains in the Genus database with same CATH topology
1AAMA 4WP0A 3RBFA 5LH9A 1V2FA 2VMNA 3NYUA 4KYOA 5E3KA 3VOMA 1BJOB 2BWPA 4GRXA 4RAEA 2R2NA 2GMSA 3FDDA 1B4XA 4JEXA 1D7RA 4J8LA 3ATHA 1AMQA 3BB8A 2HP1A 4LNLA 1W7NA 3FQ7A 3JWAA 3COGA 1ARGA 2DGMA 3BWOA 3GWPA 3UWCA 3A9YA 1DJEA 2EGYA 3AENA 1N31A 9AATA 2G6WA 4MQQA 3KGXA 4WXGA 3II0A 3CAIA 3DZZA 4UHMA 3LVJA 3HT4A 5M49A 3BN1A 3FZ6A 3VK2A 3ZZKA 4NOGA 1N8PA 5G4JA 2BI1A 1CZCA 2AATA 2R5EA 3L8AA 4IYOA 4F5MA 1GC0A 1ASAA 1KKJA 4JF1A 3B1DA 3A2BA 4W1VA 4WLJA 2Z67A 1U08A 1JF9A 1AHFA 2EZ1A 1WYUA 3DU4A 2DGLA 4GE7A 1TOEA 3B1EA 3DRDA 3KE3A 2C44A 3JW9A 3TATA 3AENB 4LNMA 4ITXA 1IUGA 1N2TA 4H51A 4CVQA 2V1PA 3EZ1A 3RBLA 1T3IA 2BIAA 3F0HA 2AY6A 1GC2A 3FKDA 2ZP7A 3VP6A 1YIYA 3D6KA 2BIEA 4CBSA 2OKJA 4LC3A 4WYDA 3T32A 1IX7A 4DGTA 2O0RA 1WYVB 3F9TA 3GZCA 1ASMA 4B98A 1TATA 3A8UX 4AOAA 3FCRA 3AEJC 4JF0A 3B8XA 1VJOA 5EAAA 2W7HA 4ATPA 2X8UA 1M0PA 3EI8A 3EI5A 3FVXA 3EUCA 3ZRPA 1FG3A 2CANA 2HUUA 3MAFA 1AY4A 4EU1A 4M2KA 3FQAA 4RIZA 1SZKA 2QBTA 4HF8A 1IX6A 1LC5A 3BCXA 3GSBA 1V72A 1B9IA 4F5FA 4MKJA 4P7YA 1BJ4A 4ZDPA 1GC3A 2AY5A 2W7DA 3K7YA 4A6UA 1DTYA 1QJ3A 2FNUA 3WLXA 4RM1A 3ZRQA 3N75A 4R2NA 2VMYA 1AX4A 4ZDOA 2ZY2A 1SFFA 1SVVA 2AY2A 2CINA 3JZLA 2VGSA 1M7YA 3E2ZB 1AHXA 2Z9WA 3E6GA 5M4DA 3QBOA 4JEWA 2X3LA 3EIBA 1D2FA 3K40A 2DR1A 5HXXA 3QM2A 4WBTA 4MY5A 2V0YA 1G4XA 4AO9A 3GJUA 4ISYA 1LK9A 3NYSA 3PJ0A 1I41A 4E1OA 3FVSA 1QZ9A 2D64A 4WLHA 1S08A 4CXRA 5F8VA 1W7MA 3F6TA 2O1BA 3TFTA 3NU8A 4OTLA 2Z9VA 4GE4A 3RI6A 1MLYA 4IXOA 1WYVA 3OKSA 2WK7A 2JGTA 1KMKA 2D5YA 4W1WA 2CJDA 3CQ4A 3RQ1A 5D5SA 2YCTA 3AOWA 1OHWA 1C7NA 3PAAA 4JE5A 2YCPA 1IAYA 4M2MA 2XBNA 1ASBA 4XQ2A 2D66A 1QJ5A 3GZDC 5M4BA 1M0QA 1TPLA 1I48A 1XEYA 4K2MA 2VGTA 3NTJA 4PVFA 4WXFA 4ZM3A 3MADA 4M2JA 4WB0B 4EB5A 1QISA 1WKHA 1S06A 3NYTA 1SPAA 4Y0DA 1BT4A 2HOXA 4E3RA 2YRIA 3FZ8A 3QN6A 4IX8A 4F5IA 2G7JA 1AKBA 3NUIA 5EFSA 1AMRA 1MLZA 2R0TA 4MQRA 1MAPA 4ZLVA 3BCAA 4OYTA 2NMPA 5E5IA 5EUDA 4ATQA 1S07A 1M0OA 1QGNA 5D95A 2FM1A 4ZASA 2R5CB 2VMZA 3E2FA 3G0TA 8AATA 1AKAA 2W7EA 1LKCA 5IWQA 1QITA 2YKXA 2CY8A 1ASNA 1GC4A 1C9CA 3BCBA 4LW2A 4MGRA 7AATA 3LWSA 1FG7A 3I5TA 1SF2A 1XI9A 4ADCA 2EO5A 4DBCA 2HOZA 2A1VA 2QLRA 3AEOA 1AJSB 4FL0A 3KKIA 1KKPA 3PD6A 2E7IA 4B9BA 1TOGA 3FRKA 3CQ6A 1MAQA 5G2QA 5BJ4A 2VLFA 2BKWA 5G0AA 1OHYA 1MGVA 3ASBA 1KL2A 3LV2A 2EZ2A 2CB1A 3NNKA 3P6KA 1FC4A 2ZY3A 3E2YA 2O7CA 3ZZJA 1BQAA 5FT5A 1EG5A 4RITA 5E4ZA 3IHJA 3QGUA 2W7IA 4AH3A 1M6SA 2DGKA 2Z1ZA 4N0BA 2ZY5A 2D65A 5EUEA 1C0NA 1GBNA 1RV4A 2GMUA 1H1CA 1ASFA 2HP2A 4JEVA 3DYDA 4QGRA 3W1IA 4ZWVA 1BKGA 3PPLA 2X5DA 4WYAA 1YOOA 5G2PA 1E5EA 1ARHA 3N5MA 1ORDA 2YOBA 2D7YA 4RKDA 3E2ZA 2ZC0A 5FT6A 4ZSWA 4A0GA 2R5CA 4XAUA 4BQ0A 5C6UA 3N4XA 1S0AA 4A0HA 2CH2A 1AHYA 3HQTA 1GDEA 2AY7A 2PO3A 4BHDA 4H63Q 1MDZA 2HUFA 4KXKA 1GD9A 1DJ9A 3BV0A 4Q75A 4W5KA 4IYOB 4WXBA 5FT4A 4HVKA 5JAYA 1UU2A 4XJOA 3MKJA 4U1TA 4Q6RA 3LY1A 2DKBA 2AEUA 2HZPA 3AEMC 3L44A 3QI6A 3K28A 5F9SA 2XH1A 2Z61A 3PDBB 2CJGA 4F4EA 3ELPA 2W8UA 4E3QA 2WB6A 1AKCA 2AY8A 4ZM4A 3N0LA 4ZDLA 1TOIA 4PIWA 4IY7A 1B5OA 1S09A 3ASAA 2AY9A 3WGCA 3HDOA 3WY7A 5HHYA 2W7JA 4K2BA 4RJ0A 4XK1A 2ZY4A 3N4RA 4OCAA 3UAKA 1X2AA 4RLGA 1JS6A 3GETA 1V2DA 1OATA 1Y4IA 2ZSMA 3HBXA 4P3MA 1WYTA 1AHEA 3MAFB 2WK9A 1I29A 2EPJA 2ZUKA 2GQNA 1AHGA 3AEJA 2Z9UA 3MC6A 3UE8A 1D7SA 5HDMA 1BW0A 1SZUA 1H0CA 2AY3A 2W8VA 2VGWA 3PDBA 1W3UA 4L0OA 3WZFA 2AY1A 1J04A 2PB0A 2VYCA 3MEBA 3PIUA 2OGAA 1GEYA 1PFFA 3R9AA 1IBJA 1RV3A 2JJFA 3DR4A 3ECDA 4EB7A 2EYQA 1JG8A 1ARSA 4TV7A 1O4SA 4WYCA 4AZJA 1LS3A 2OQXA 1G4VA 4PFFA 1WKGA 2BWOA 2D63A 3BC8A 1YJSA 1QIRA 2ZYJA 1B5PA 2VMPA 3A9XA 3H7FA 3NU7A 4R5ZA 4WYGA 4XEWA 3VK4A 5EUNA 2ZJGA 1ASLA 3WGBA 1UKJA 3HMUA 4F5JA 4GSAA 2FNIA 4KAMA 1TOKA 2VMUA 3WKRA 4A72A 2VMWA 1AIBA 2DOUA 4A00A 4BA5A 1GCKA 1AY8A 1G7WA 1TASA 1VEFA 4U2HA 2OATA 4W91A 2BWNA 3QHXA 1AMSA 2VMXA 3WKSA 4A6TA 2FQ6A 3LVLB 5KTBA 4DQ6A 1SZSA 3GR9A 1ASDA 1VP4A 1YJYA 4UOYA 4MQPA 4UHOA 3CQ5A 2GSAA 4IXZA 2RFVA 2VGVA 1ZOBA 2Z20A 3H9XA 1KL1A 2VLHA 2PB2A 2VIAA 2VGZA 1AY5A 2C7TA 1MDOA 1PMOA 1IJIA 3ISLA 1IVRA 4ADEA 1CQ8A 1G7XA 2QB3A 3BWNC 1C7OA 2VMQA 1YAAA 1M0NA 1DJUA 2CFBA 1X0MA 3W1JA 1OHVA 1UU0A 2D7ZA 1CL2A 3AEMA 3G7QA 2FKIA 1UU1A 1PMMA 3GZDA 3WCOA 3LVMA 2YKYA 4AO4A 4FFCA 3EZSA 3MAUA 5EQCA 5EIGA 1DGDA 2AY4A 1ASCA 1X28A 4F5GA 2VMSA 3ACZA 3EIAA 1M4NA 3AOVA 1BJNA 4EFFA 2JJHA 3DC1A 1ASGA 1PG8A 4E77A 4GDYA 1AJRA 4UQVA 4MKKA 2W7LA 4CBRA 3FQ8A 4LW4A 5DJ1A 5G4IA 1O61A 4XJPA 1O62A 2BIGA 2TPLA 3KGWA 2ZSLA 3B1CA 3AATA 4RJYA 5EAVA 4Q31A 1AICA 3HL2A 1OXPA 2VI9A 3NRAA 2VMVA 5K8BA 1P3WA 1LW4A 1CZEA 2OGEA 2OKKA 3AEPA 3I16A 3FFHA 4WYEA 3RCHA 4A6RA 4K2IA 1MDXA 2E7JA 3FD0A 3AELA 3NDNA 3AV7A 1DKAA 1I43A 2EH6A 4AZKA 1BJOA 2BYJA 1EJIA 2Z1YA 3FDBA 1YIZA 3G8MA 3B46A 4F5LA 3N7NA 4XJLA 2W7FA 3E77A 1AJSA 4J5UA 1D7UA 2E7UA 2YKVA 3JWBA 3DODA 4IXSA 4R8DA 5M46A 1RVUA 1ARTA 1M32A 3WX9A 1X29A 1RVYA 4F5KA 1B9HA 2YRRA 3E9KA 2E54A 1AAWA 1C4KA 1ELUA 2VMTA 3DXWA 4LNJA 1AIAA 1LC8A 2JG2A 2YCNA 3PDXA 2KFPA 2C0RA 1O69A 2F8JA 3MC6C 3RCHB 2HUIA 3MBBA 3PD6B 1CQ7A 3M5UA 4I8AA 3HLMA 5FT8A 4PFNA 1DGEA 2BI5A 3LVKA 4ZWMA 1V2EA 4BMKA 1W7LA 4UHNA 3FVUA 2JJEA 2W7MA 3I4JA 1IX8A 5DX5A 4GE9A 3ELEA 4ZAHA 5DB5A 1JS3A 1LW5A 4OT8A 4TMRA 3USFA 5AX8A 2FYFA 1W23A 4ADBA 2CSTA 1WSTA 1WYTB 1Z7DA 3JU7A 3VK3A 3FTBA 3JTXA 4WD2A 2CH1A 2VGUA 4A0RA 3OP7A 4RKCA 5J8QA 3DR7A 1J32A 4W1XA 2BI2A 2FN6A 3FSLA 1EQBA 4TN4A 4BA4A 3QPGA 2WK8A 1ZODA 1C7GA 1YNUA 2CTZA 2QSRA 1CL1A 2Z9XA 3BWNA 1TOJA 4WB0A 3TFUA 2BHXA 5I92A 1CS1A 3FZ7A 2QB2A 1D7VA 1DFOA 1OXOA 3NUBA 3GBXA 4MSOA 3H14A 3IF2A 2Q7WA 4JEZA 1Z3ZA 2QA3A 3W1HA 3TCMA 1BJWA 2VMRA 1LC7A 2GB3A 4N0WA 3ZRRA 2ORDA 2W8TA 3DXVA 4OMAA 5LHAA 3PGYA 1KMJA 4Q76A 2W8JA 4GEBA 1ASEA 5TF5A 1CJ0A 4OC9A 2VIBA 1E5FA 1YJZA 1GEWA 2C81A 4R5FA 2D61A 1ELQA 2W7GA 4ZSYA 2WKAA 2DKJA 2VMOA 2QMAA 2JISA 3P1TA 1TARA 2W7KA 3NX3A 2JJGA 4Y0HA 5G09A 3RUYA 3HVYA 2BYLA 5EIGB 1WYUB 4EMYA 2BI3A 4JE5D 4OBVA 1IAXA 2HOYA 3TQXA 3EI6A 1CQ6A 2W8WA 1ECXA 3FFRA 4W8IA 1AMAA 4ADDA 4ITGA 3BS8A 1GEXA 3R4TA 2VI8A 3PA9A 3Q8NA 4O6ZA 1ZC9A 2YKUA 2AEVA 3A9ZA 3WCNA 4XJMA 1ARIA 4WYFA 4K05A 2X5FA 1B8GA 4OBUA 3EI9A 2BI9A 3VAXA 2YHKA 4JEYA 1BS0A 5DJ9A 5BJ3A 2CJHA 3CBFA 4IW7A 4A0FA 4Y0IA 3LG0A 2HORA 1BQDA 3EI7A 4F5HA 3N4SA 4CXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AAM A;  4WP0 A;  3RBF A;  5LH9 A;  1V2F A;  2VMN A;  3NYU A;  4KYO A;  5E3K A;  3VOM A;  1BJO B;  2BWP A;  4GRX A;  4RAE A;  2R2N A;  2GMS A;  3FDD A;  1B4X A;  4JEX A;  1D7R A;  4J8L A;  3ATH A;  1AMQ A;  3BB8 A;  2HP1 A;  4LNL A;  1W7N A;  3FQ7 A;  3JWA A;  3COG A;  1ARG A;  2DGM A;  3BWO A;  3GWP A;  3UWC A;  3A9Y A;  1DJE A;  2EGY A;  3AEN A;  1N31 A;  9AAT A;  2G6W A;  4MQQ A;  3KGX A;  4WXG A;  3II0 A;  3CAI A;  3DZZ A;  4UHM A;  3LVJ A;  3HT4 A;  5M49 A;  3BN1 A;  3FZ6 A;  3VK2 A;  3ZZK A;  4NOG A;  1N8P A;  5G4J A;  2BI1 A;  1CZC A;  2AAT A;  2R5E A;  3L8A A;  4IYO A;  4F5M A;  1GC0 A;  1ASA A;  1KKJ A;  4JF1 A;  3B1D A;  3A2B A;  4W1V A;  4WLJ A;  2Z67 A;  1U08 A;  1JF9 A;  1AHF A;  2EZ1 A;  1WYU A;  3DU4 A;  2DGL A;  4GE7 A;  1TOE A;  3B1E A;  3DRD A;  3KE3 A;  2C44 A;  3JW9 A;  3TAT A;  3AEN B;  4LNM A;  4ITX A;  1IUG A;  1N2T A;  4H51 A;  4CVQ A;  2V1P A;  3EZ1 A;  3RBL A;  1T3I A;  2BIA A;  3F0H A;  2AY6 A;  1GC2 A;  3FKD A;  2ZP7 A;  3VP6 A;  1YIY A;  3D6K A;  2BIE A;  4CBS A;  2OKJ A;  4LC3 A;  4WYD A;  3T32 A;  1IX7 A;  4DGT A;  2O0R A;  1WYV B;  3F9T A;  3GZC A;  1ASM A;  4B98 A;  1TAT A;  3A8U X;  4AOA A;  3FCR A;  3AEJ C;  4JF0 A;  3B8X A;  1VJO A;  5EAA A;  2W7H A;  4ATP A;  2X8U A;  1M0P A;  3EI8 A;  3EI5 A;  3FVX A;  3EUC A;  3ZRP A;  1FG3 A;  2CAN A;  2HUU A;  3MAF A;  1AY4 A;  4EU1 A;  4M2K A;  3FQA A;  4RIZ A;  1SZK A;  2QBT A;  4HF8 A;  1IX6 A;  1LC5 A;  3BCX A;  3GSB A;  1V72 A;  1B9I A;  4F5F A;  4MKJ A;  4P7Y A;  1BJ4 A;  4ZDP A;  1GC3 A;  2AY5 A;  2W7D A;  3K7Y A;  4A6U A;  1DTY A;  1QJ3 A;  2FNU A;  3WLX A;  4RM1 A;  3ZRQ A;  3N75 A;  4R2N A;  2VMY A;  1AX4 A;  4ZDO A;  2ZY2 A;  1SFF A;  1SVV A;  2AY2 A;  2CIN A;  3JZL A;  2VGS A;  1M7Y A;  3E2Z B;  1AHX A;  2Z9W A;  3E6G A;  5M4D A;  3QBO A;  4JEW A;  2X3L A;  3EIB A;  1D2F A;  3K40 A;  2DR1 A;  5HXX A;  3QM2 A;  4WBT A;  4MY5 A;  2V0Y A;  1G4X A;  4AO9 A;  3GJU A;  4ISY A;  1LK9 A;  3NYS A;  3PJ0 A;  1I41 A;  4E1O A;  3FVS A;  1QZ9 A;  2D64 A;  4WLH A;  1S08 A;  4CXR A;  5F8V A;  1W7M A;  3F6T A;  2O1B A;  3TFT A;  3NU8 A;  4OTL A;  2Z9V A;  4GE4 A;  3RI6 A;  1MLY A;  4IXO A;  1WYV A;  3OKS A;  2WK7 A;  2JGT A;  1KMK A;  2D5Y A;  4W1W A;  2CJD A;  3CQ4 A;  3RQ1 A;  5D5S A;  2YCT A;  3AOW A;  1OHW A;  1C7N A;  3PAA A;  4JE5 A;  2YCP A;  1IAY A;  4M2M A;  2XBN A;  1ASB A;  4XQ2 A;  2D66 A;  1QJ5 A;  3GZD C;  5M4B A;  1M0Q A;  1TPL A;  1I48 A;  1XEY A;  4K2M A;  2VGT A;  3NTJ A;  4PVF A;  4WXF A;  4ZM3 A;  3MAD A;  4M2J A;  4WB0 B;  4EB5 A;  1QIS A;  1WKH A;  1S06 A;  3NYT A;  1SPA A;  4Y0D A;  1BT4 A;  2HOX A;  4E3R A;  2YRI A;  3FZ8 A;  3QN6 A;  4IX8 A;  4F5I A;  1AKB A;  3NUI A;  5EFS A;  1AMR A;  1MLZ A;  2R0T A;  4MQR A;  1MAP A;  4ZLV A;  3BCA A;  4OYT A;  2NMP A;  5E5I A;  5EUD A;  4ATQ A;  1S07 A;  1M0O A;  1QGN A;  5D95 A;  2FM1 A;  4ZAS A;  2R5C B;  2VMZ A;  3E2F A;  3G0T A;  8AAT A;  1AKA A;  2W7E A;  1LKC A;  5IWQ A;  1QIT A;  2YKX A;  2CY8 A;  1ASN A;  1GC4 A;  1C9C A;  3BCB A;  4LW2 A;  4MGR A;  7AAT A;  3LWS A;  1FG7 A;  3I5T A;  1SF2 A;  1XI9 A;  4ADC A;  2EO5 A;  4DBC A;  2HOZ A;  2QLR A;  3AEO A;  1AJS B;  4FL0 A;  3KKI A;  1KKP A;  3PD6 A;  2E7I A;  4B9B A;  1TOG A;  3FRK A;  3CQ6 A;  1MAQ A;  5G2Q A;  5BJ4 A;  2VLF A;  2BKW A;  5G0A A;  1OHY A;  1MGV A;  3ASB A;  1KL2 A;  3LV2 A;  2EZ2 A;  2CB1 A;  3NNK A;  3P6K A;  1FC4 A;  2ZY3 A;  3E2Y A;  2O7C A;  3ZZJ A;  1BQA A;  5FT5 A;  1EG5 A;  4RIT A;  5E4Z A;  3IHJ A;  3QGU A;  2W7I A;  4AH3 A;  1M6S A;  2DGK A;  2Z1Z A;  4N0B A;  2ZY5 A;  2D65 A;  5EUE A;  1C0N A;  1GBN A;  1RV4 A;  2GMU A;  1H1C A;  1ASF A;  2HP2 A;  4JEV A;  3DYD A;  4QGR A;  3W1I A;  4ZWV A;  1BKG A;  3PPL A;  2X5D A;  4WYA A;  1YOO A;  5G2P A;  1E5E A;  1ARH A;  3N5M A;  1ORD A;  2YOB A;  2D7Y A;  4RKD A;  3E2Z A;  2ZC0 A;  5FT6 A;  4ZSW A;  4A0G A;  2R5C A;  4XAU A;  4BQ0 A;  5C6U A;  1S0A A;  4A0H A;  2CH2 A;  1AHY A;  3HQT A;  1GDE A;  2AY7 A;  2PO3 A;  4BHD A;  1MDZ A;  2HUF A;  4KXK A;  1GD9 A;  1DJ9 A;  3BV0 A;  4Q75 A;  4W5K A;  4IYO B;  4WXB A;  5FT4 A;  4HVK A;  5JAY A;  1UU2 A;  4XJO A;  3MKJ A;  4U1T A;  4Q6R A;  3LY1 A;  2DKB A;  2AEU A;  2HZP A;  3AEM C;  3L44 A;  3QI6 A;  3K28 A;  5F9S A;  2XH1 A;  2Z61 A;  3PDB B;  2CJG A;  4F4E A;  3ELP A;  2W8U A;  4E3Q A;  1AKC A;  2AY8 A;  4ZM4 A;  3N0L A;  4ZDL A;  1TOI A;  4PIW A;  4IY7 A;  1B5O A;  1S09 A;  3ASA A;  2AY9 A;  3WGC A;  3HDO A;  3WY7 A;  5HHY A;  2W7J A;  4K2B A;  4RJ0 A;  4XK1 A;  2ZY4 A;  4OCA A;  3UAK A;  1X2A A;  4RLG A;  1JS6 A;  3GET A;  1V2D A;  1OAT A;  1Y4I A;  2ZSM A;  3HBX A;  4P3M A;  1WYT A;  1AHE A;  3MAF B;  2WK9 A;  1I29 A;  2EPJ A;  2ZUK A;  2GQN A;  1AHG A;  3AEJ A;  2Z9U A;  3MC6 A;  3UE8 A;  1D7S A;  5HDM A;  1BW0 A;  1SZU A;  1H0C A;  2AY3 A;  2W8V A;  2VGW A;  3PDB A;  1W3U A;  4L0O A;  3WZF A;  2AY1 A;  1J04 A;  2PB0 A;  2VYC A;  3MEB A;  3PIU A;  2OGA A;  1GEY A;  1PFF A;  3R9A A;  1IBJ A;  1RV3 A;  2JJF A;  3DR4 A;  3ECD A;  4EB7 A;  1JG8 A;  1ARS A;  4TV7 A;  1O4S A;  4WYC A;  4AZJ A;  1LS3 A;  2OQX A;  1G4V A;  4PFF A;  1WKG A;  2BWO A;  2D63 A;  3BC8 A;  1YJS A;  1QIR A;  2ZYJ A;  1B5P A;  2VMP A;  3A9X A;  3H7F A;  3NU7 A;  4R5Z A;  4WYG A;  4XEW A;  3VK4 A;  5EUN A;  2ZJG A;  1ASL A;  3WGB A;  1UKJ A;  3HMU A;  4F5J A;  4GSA A;  2FNI A;  4KAM A;  1TOK A;  2VMU A;  3WKR A;  4A72 A;  2VMW A;  1AIB A;  2DOU A;  4A00 A;  4BA5 A;  1GCK A;  1AY8 A;  1G7W A;  1TAS A;  1VEF A;  4U2H A;  2OAT A;  4W91 A;  2BWN A;  3QHX A;  1AMS A;  2VMX A;  3WKS A;  4A6T A;  2FQ6 A;  3LVL B;  4DQ6 A;  1SZS A;  3GR9 A;  1ASD A;  1VP4 A;  1YJY A;  4UOY A;  4MQP A;  4UHO A;  3CQ5 A;  2GSA A;  4IXZ A;  2RFV A;  2VGV A;  1ZOB A;  2Z20 A;  1KL1 A;  2VLH A;  2PB2 A;  2VIA A;  2VGZ A;  1AY5 A;  2C7T A;  1MDO A;  1PMO A;  1IJI A;  3ISL A;  1IVR A;  4ADE A;  1CQ8 A;  1G7X A;  2QB3 A;  3BWN C;  1C7O A;  2VMQ A;  1YAA A;  1M0N A;  1DJU A;  2CFB A;  1X0M A;  3W1J A;  1OHV A;  1UU0 A;  2D7Z A;  1CL2 A;  3AEM A;  3G7Q A;  1UU1 A;  1PMM A;  3GZD A;  3WCO A;  3LVM A;  2YKY A;  4AO4 A;  4FFC A;  3EZS A;  3MAU A;  5EQC A;  5EIG A;  1DGD A;  2AY4 A;  1ASC A;  1X28 A;  4F5G A;  2VMS A;  3ACZ A;  3EIA A;  1M4N A;  3AOV A;  1BJN A;  4EFF A;  2JJH A;  3DC1 A;  1ASG A;  1PG8 A;  4E77 A;  4GDY A;  1AJR A;  4UQV A;  4MKK A;  2W7L A;  4CBR A;  3FQ8 A;  4LW4 A;  5DJ1 A;  5G4I A;  1O61 A;  4XJP A;  1O62 A;  2BIG A;  2TPL A;  3KGW A;  2ZSL A;  3B1C A;  3AAT A;  4RJY A;  5EAV A;  4Q31 A;  1AIC A;  3HL2 A;  1OXP A;  2VI9 A;  3NRA A;  2VMV A;  5K8B A;  1P3W A;  1LW4 A;  1CZE A;  2OGE A;  2OKK A;  3AEP A;  3I16 A;  3FFH A;  4WYE A;  3RCH A;  4A6R A;  4K2I A;  1MDX A;  2E7J A;  3FD0 A;  3AEL A;  3NDN A;  3AV7 A;  1DKA A;  1I43 A;  2EH6 A;  4AZK A;  1BJO A;  2BYJ A;  1EJI A;  2Z1Y A;  3FDB A;  1YIZ A;  3G8M A;  3B46 A;  4F5L A;  4XJL A;  2W7F A;  3E77 A;  1AJS A;  4J5U A;  1D7U A;  2E7U A;  2YKV A;  3JWB A;  3DOD A;  4IXS A;  4R8D A;  5M46 A;  1RVU A;  1ART A;  1M32 A;  3WX9 A;  1X29 A;  1RVY A;  4F5K A;  1B9H A;  2YRR A;  3E9K A;  2E54 A;  1AAW A;  1C4K A;  1ELU A;  2VMT A;  3DXW A;  4LNJ A;  1AIA A;  1LC8 A;  2JG2 A;  2YCN A;  3PDX A;  2C0R A;  1O69 A;  2F8J A;  3MC6 C;  3RCH B;  2HUI A;  3MBB A;  3PD6 B;  1CQ7 A;  3M5U A;  4I8A A;  3HLM A;  5FT8 A;  4PFN A;  1DGE A;  2BI5 A;  3LVK A;  4ZWM A;  1V2E A;  4BMK A;  1W7L A;  4UHN A;  3FVU A;  2JJE A;  2W7M A;  3I4J A;  1IX8 A;  5DX5 A;  4GE9 A;  3ELE A;  4ZAH A;  5DB5 A;  1JS3 A;  1LW5 A;  4OT8 A;  4TMR A;  3USF A;  5AX8 A;  2FYF A;  1W23 A;  4ADB A;  2CST A;  1WST A;  1WYT B;  1Z7D A;  3JU7 A;  3VK3 A;  3FTB A;  3JTX A;  4WD2 A;  2CH1 A;  2VGU A;  4A0R A;  3OP7 A;  4RKC A;  5J8Q A;  3DR7 A;  1J32 A;  4W1X A;  2BI2 A;  2FN6 A;  3FSL A;  1EQB A;  4TN4 A;  4BA4 A;  3QPG A;  2WK8 A;  1ZOD A;  1C7G A;  1YNU A;  2CTZ A;  1CL1 A;  2Z9X A;  3BWN A;  1TOJ A;  4WB0 A;  3TFU A;  2BHX A;  5I92 A;  1CS1 A;  3FZ7 A;  2QB2 A;  1D7V A;  1DFO A;  1OXO A;  3NUB A;  3GBX A;  4MSO A;  3H14 A;  3IF2 A;  2Q7W A;  4JEZ A;  1Z3Z A;  2QA3 A;  3W1H A;  3TCM A;  1BJW A;  2VMR A;  1LC7 A;  2GB3 A;  4N0W A;  3ZRR A;  2ORD A;  2W8T A;  3DXV A;  4OMA A;  5LHA A;  3PGY A;  1KMJ A;  4Q76 A;  2W8J A;  4GEB A;  1ASE A;  5TF5 A;  1CJ0 A;  4OC9 A;  2VIB A;  1E5F A;  1YJZ A;  1GEW A;  2C81 A;  4R5F A;  2D61 A;  1ELQ A;  2W7G A;  4ZSY A;  2WKA A;  2DKJ A;  2VMO A;  2QMA A;  2JIS A;  3P1T A;  1TAR A;  2W7K A;  3NX3 A;  2JJG A;  4Y0H A;  5G09 A;  3RUY A;  3HVY A;  2BYL A;  5EIG B;  1WYU B;  4EMY A;  2BI3 A;  4JE5 D;  4OBV A;  1IAX A;  2HOY A;  3TQX A;  3EI6 A;  1CQ6 A;  2W8W A;  1ECX A;  3FFR A;  4W8I A;  1AMA A;  4ADD A;  4ITG A;  3BS8 A;  1GEX A;  3R4T A;  2VI8 A;  3PA9 A;  3Q8N A;  4O6Z A;  1ZC9 A;  2YKU A;  2AEV A;  3A9Z A;  3WCN A;  4XJM A;  1ARI A;  4WYF A;  2X5F A;  1B8G A;  4OBU A;  3EI9 A;  2BI9 A;  3VAX A;  2YHK A;  4JEY A;  1BS0 A;  5DJ9 A;  5BJ3 A;  2CJH A;  3CBF A;  4IW7 A;  4A0F A;  4Y0I A;  3LG0 A;  2HOR A;  1BQD A;  3EI7 A;  4F5H A;  4CXQ A; 
#chains in the Genus database with same CATH topology
 1AAM A;  4WP0 A;  3RBF A;  5LH9 A;  1V2F A;  2VMN A;  3NYU A;  4KYO A;  5E3K A;  3VOM A;  1BJO B;  2BWP A;  4GRX A;  4RAE A;  2R2N A;  2GMS A;  3FDD A;  1B4X A;  4JEX A;  1D7R A;  4J8L A;  3ATH A;  1AMQ A;  3BB8 A;  2HP1 A;  4LNL A;  1W7N A;  3FQ7 A;  3JWA A;  3COG A;  1ARG A;  2DGM A;  3BWO A;  3GWP A;  3UWC A;  3A9Y A;  1DJE A;  2EGY A;  3AEN A;  1N31 A;  9AAT A;  2G6W A;  4MQQ A;  3KGX A;  4WXG A;  3II0 A;  3CAI A;  3DZZ A;  4UHM A;  3LVJ A;  3HT4 A;  5M49 A;  3BN1 A;  3FZ6 A;  3VK2 A;  3ZZK A;  4NOG A;  1N8P A;  5G4J A;  2BI1 A;  1CZC A;  2AAT A;  2R5E A;  3L8A A;  4IYO A;  4F5M A;  1GC0 A;  1ASA A;  1KKJ A;  4JF1 A;  3B1D A;  3A2B A;  4W1V A;  4WLJ A;  2Z67 A;  1U08 A;  1JF9 A;  1AHF A;  2EZ1 A;  1WYU A;  3DU4 A;  2DGL A;  4GE7 A;  1TOE A;  3B1E A;  3DRD A;  3KE3 A;  2C44 A;  3JW9 A;  3TAT A;  3AEN B;  4LNM A;  4ITX A;  1IUG A;  1N2T A;  4H51 A;  4CVQ A;  2V1P A;  3EZ1 A;  3RBL A;  1T3I A;  2BIA A;  3F0H A;  2AY6 A;  1GC2 A;  3FKD A;  2ZP7 A;  3VP6 A;  1YIY A;  3D6K A;  2BIE A;  4CBS A;  2OKJ A;  4LC3 A;  4WYD A;  3T32 A;  1IX7 A;  4DGT A;  2O0R A;  1WYV B;  3F9T A;  3GZC A;  1ASM A;  4B98 A;  1TAT A;  3A8U X;  4AOA A;  3FCR A;  3AEJ C;  4JF0 A;  3B8X A;  1VJO A;  5EAA A;  2W7H A;  4ATP A;  2X8U A;  1M0P A;  3EI8 A;  3EI5 A;  3FVX A;  3EUC A;  3ZRP A;  1FG3 A;  2CAN A;  2HUU A;  3MAF A;  1AY4 A;  4EU1 A;  4M2K A;  3FQA A;  4RIZ A;  1SZK A;  2QBT A;  4HF8 A;  1IX6 A;  1LC5 A;  3BCX A;  3GSB A;  1V72 A;  1B9I A;  4F5F A;  4MKJ A;  4P7Y A;  1BJ4 A;  4ZDP A;  1GC3 A;  2AY5 A;  2W7D A;  3K7Y A;  4A6U A;  1DTY A;  1QJ3 A;  2FNU A;  3WLX A;  4RM1 A;  3ZRQ A;  3N75 A;  4R2N A;  2VMY A;  1AX4 A;  4ZDO A;  2ZY2 A;  1SFF A;  1SVV A;  2AY2 A;  2CIN A;  3JZL A;  2VGS A;  1M7Y A;  3E2Z B;  1AHX A;  2Z9W A;  3E6G A;  5M4D A;  3QBO A;  4JEW A;  2X3L A;  3EIB A;  1D2F A;  3K40 A;  2DR1 A;  5HXX A;  3QM2 A;  4WBT A;  4MY5 A;  2V0Y A;  1G4X A;  4AO9 A;  3GJU A;  4ISY A;  1LK9 A;  3NYS A;  3PJ0 A;  1I41 A;  4E1O A;  3FVS A;  1QZ9 A;  2D64 A;  4WLH A;  1S08 A;  4CXR A;  5F8V A;  1W7M A;  3F6T A;  2O1B A;  3TFT A;  3NU8 A;  4OTL A;  2Z9V A;  4GE4 A;  3RI6 A;  1MLY A;  4IXO A;  1WYV A;  3OKS A;  2WK7 A;  2JGT A;  1KMK A;  2D5Y A;  4W1W A;  2CJD A;  3CQ4 A;  3RQ1 A;  5D5S A;  2YCT A;  3AOW A;  1OHW A;  1C7N A;  3PAA A;  4JE5 A;  2YCP A;  1IAY A;  4M2M A;  2XBN A;  1ASB A;  4XQ2 A;  2D66 A;  1QJ5 A;  3GZD C;  5M4B A;  1M0Q A;  1TPL A;  1I48 A;  1XEY A;  4K2M A;  2VGT A;  3NTJ A;  4PVF A;  4WXF A;  4ZM3 A;  3MAD A;  4M2J A;  4WB0 B;  4EB5 A;  1QIS A;  1WKH A;  1S06 A;  3NYT A;  1SPA A;  4Y0D A;  1BT4 A;  2HOX A;  4E3R A;  2YRI A;  3FZ8 A;  3QN6 A;  4IX8 A;  4F5I A;  2G7J A;  1AKB A;  3NUI A;  5EFS A;  1AMR A;  1MLZ A;  2R0T A;  4MQR A;  1MAP A;  4ZLV A;  3BCA A;  4OYT A;  2NMP A;  5E5I A;  5EUD A;  4ATQ A;  1S07 A;  1M0O A;  1QGN A;  5D95 A;  2FM1 A;  4ZAS A;  2R5C B;  2VMZ A;  3E2F A;  3G0T A;  8AAT A;  1AKA A;  2W7E A;  1LKC A;  5IWQ A;  1QIT A;  2YKX A;  2CY8 A;  1ASN A;  1GC4 A;  1C9C A;  3BCB A;  4LW2 A;  4MGR A;  7AAT A;  3LWS A;  1FG7 A;  3I5T A;  1SF2 A;  1XI9 A;  4ADC A;  2EO5 A;  4DBC A;  2HOZ A;  2A1V A;  2QLR A;  3AEO A;  1AJS B;  4FL0 A;  3KKI A;  1KKP A;  3PD6 A;  2E7I A;  4B9B A;  1TOG A;  3FRK A;  3CQ6 A;  1MAQ A;  5G2Q A;  5BJ4 A;  2VLF A;  2BKW A;  5G0A A;  1OHY A;  1MGV A;  3ASB A;  1KL2 A;  3LV2 A;  2EZ2 A;  2CB1 A;  3NNK A;  3P6K A;  1FC4 A;  2ZY3 A;  3E2Y A;  2O7C A;  3ZZJ A;  1BQA A;  5FT5 A;  1EG5 A;  4RIT A;  5E4Z A;  3IHJ A;  3QGU A;  2W7I A;  4AH3 A;  1M6S A;  2DGK A;  2Z1Z A;  4N0B A;  2ZY5 A;  2D65 A;  5EUE A;  1C0N A;  1GBN A;  1RV4 A;  2GMU A;  1H1C A;  1ASF A;  2HP2 A;  4JEV A;  3DYD A;  4QGR A;  3W1I A;  4ZWV A;  1BKG A;  3PPL A;  2X5D A;  4WYA A;  1YOO A;  5G2P A;  1E5E A;  1ARH A;  3N5M A;  1ORD A;  2YOB A;  2D7Y A;  4RKD A;  3E2Z A;  2ZC0 A;  5FT6 A;  4ZSW A;  4A0G A;  2R5C A;  4XAU A;  4BQ0 A;  5C6U A;  3N4X A;  1S0A A;  4A0H A;  2CH2 A;  1AHY A;  3HQT A;  1GDE A;  2AY7 A;  2PO3 A;  4BHD A;  4H63 Q;  1MDZ A;  2HUF A;  4KXK A;  1GD9 A;  1DJ9 A;  3BV0 A;  4Q75 A;  4W5K A;  4IYO B;  4WXB A;  5FT4 A;  4HVK A;  5JAY A;  1UU2 A;  4XJO A;  3MKJ A;  4U1T A;  4Q6R A;  3LY1 A;  2DKB A;  2AEU A;  2HZP A;  3AEM C;  3L44 A;  3QI6 A;  3K28 A;  5F9S A;  2XH1 A;  2Z61 A;  3PDB B;  2CJG A;  4F4E A;  3ELP A;  2W8U A;  4E3Q A;  2WB6 A;  1AKC A;  2AY8 A;  4ZM4 A;  3N0L A;  4ZDL A;  1TOI A;  4PIW A;  4IY7 A;  1B5O A;  1S09 A;  3ASA A;  2AY9 A;  3WGC A;  3HDO A;  3WY7 A;  5HHY A;  2W7J A;  4K2B A;  4RJ0 A;  4XK1 A;  2ZY4 A;  3N4R A;  4OCA A;  3UAK A;  1X2A A;  4RLG A;  1JS6 A;  3GET A;  1V2D A;  1OAT A;  1Y4I A;  2ZSM A;  3HBX A;  4P3M A;  1WYT A;  1AHE A;  3MAF B;  2WK9 A;  1I29 A;  2EPJ A;  2ZUK A;  2GQN A;  1AHG A;  3AEJ A;  2Z9U A;  3MC6 A;  3UE8 A;  1D7S A;  5HDM A;  1BW0 A;  1SZU A;  1H0C A;  2AY3 A;  2W8V A;  2VGW A;  3PDB A;  1W3U A;  4L0O A;  3WZF A;  2AY1 A;  1J04 A;  2PB0 A;  2VYC A;  3MEB A;  3PIU A;  2OGA A;  1GEY A;  1PFF A;  3R9A A;  1IBJ A;  1RV3 A;  2JJF A;  3DR4 A;  3ECD A;  4EB7 A;  2EYQ A;  1JG8 A;  1ARS A;  4TV7 A;  1O4S A;  4WYC A;  4AZJ A;  1LS3 A;  2OQX A;  1G4V A;  4PFF A;  1WKG A;  2BWO A;  2D63 A;  3BC8 A;  1YJS A;  1QIR A;  2ZYJ A;  1B5P A;  2VMP A;  3A9X A;  3H7F A;  3NU7 A;  4R5Z A;  4WYG A;  4XEW A;  3VK4 A;  5EUN A;  2ZJG A;  1ASL A;  3WGB A;  1UKJ A;  3HMU A;  4F5J A;  4GSA A;  2FNI A;  4KAM A;  1TOK A;  2VMU A;  3WKR A;  4A72 A;  2VMW A;  1AIB A;  2DOU A;  4A00 A;  4BA5 A;  1GCK A;  1AY8 A;  1G7W A;  1TAS A;  1VEF A;  4U2H A;  2OAT A;  4W91 A;  2BWN A;  3QHX A;  1AMS A;  2VMX A;  3WKS A;  4A6T A;  2FQ6 A;  3LVL B;  5KTB A;  4DQ6 A;  1SZS A;  3GR9 A;  1ASD A;  1VP4 A;  1YJY A;  4UOY A;  4MQP A;  4UHO A;  3CQ5 A;  2GSA A;  4IXZ A;  2RFV A;  2VGV A;  1ZOB A;  2Z20 A;  3H9X A;  1KL1 A;  2VLH A;  2PB2 A;  2VIA A;  2VGZ A;  1AY5 A;  2C7T A;  1MDO A;  1PMO A;  1IJI A;  3ISL A;  1IVR A;  4ADE A;  1CQ8 A;  1G7X A;  2QB3 A;  3BWN C;  1C7O A;  2VMQ A;  1YAA A;  1M0N A;  1DJU A;  2CFB A;  1X0M A;  3W1J A;  1OHV A;  1UU0 A;  2D7Z A;  1CL2 A;  3AEM A;  3G7Q A;  2FKI A;  1UU1 A;  1PMM A;  3GZD A;  3WCO A;  3LVM A;  2YKY A;  4AO4 A;  4FFC A;  3EZS A;  3MAU A;  5EQC A;  5EIG A;  1DGD A;  2AY4 A;  1ASC A;  1X28 A;  4F5G A;  2VMS A;  3ACZ A;  3EIA A;  1M4N A;  3AOV A;  1BJN A;  4EFF A;  2JJH A;  3DC1 A;  1ASG A;  1PG8 A;  4E77 A;  4GDY A;  1AJR A;  4UQV A;  4MKK A;  2W7L A;  4CBR A;  3FQ8 A;  4LW4 A;  5DJ1 A;  5G4I A;  1O61 A;  4XJP A;  1O62 A;  2BIG A;  2TPL A;  3KGW A;  2ZSL A;  3B1C A;  3AAT A;  4RJY A;  5EAV A;  4Q31 A;  1AIC A;  3HL2 A;  1OXP A;  2VI9 A;  3NRA A;  2VMV A;  5K8B A;  1P3W A;  1LW4 A;  1CZE A;  2OGE A;  2OKK A;  3AEP A;  3I16 A;  3FFH A;  4WYE A;  3RCH A;  4A6R A;  4K2I A;  1MDX A;  2E7J A;  3FD0 A;  3AEL A;  3NDN A;  3AV7 A;  1DKA A;  1I43 A;  2EH6 A;  4AZK A;  1BJO A;  2BYJ A;  1EJI A;  2Z1Y A;  3FDB A;  1YIZ A;  3G8M A;  3B46 A;  4F5L A;  3N7N A;  4XJL A;  2W7F A;  3E77 A;  1AJS A;  4J5U A;  1D7U A;  2E7U A;  2YKV A;  3JWB A;  3DOD A;  4IXS A;  4R8D A;  5M46 A;  1RVU A;  1ART A;  1M32 A;  3WX9 A;  1X29 A;  1RVY A;  4F5K A;  1B9H A;  2YRR A;  3E9K A;  2E54 A;  1AAW A;  1C4K A;  1ELU A;  2VMT A;  3DXW A;  4LNJ A;  1AIA A;  1LC8 A;  2JG2 A;  2YCN A;  3PDX A;  2KFP A;  2C0R A;  1O69 A;  2F8J A;  3MC6 C;  3RCH B;  2HUI A;  3MBB A;  3PD6 B;  1CQ7 A;  3M5U A;  4I8A A;  3HLM A;  5FT8 A;  4PFN A;  1DGE A;  2BI5 A;  3LVK A;  4ZWM A;  1V2E A;  4BMK A;  1W7L A;  4UHN A;  3FVU A;  2JJE A;  2W7M A;  3I4J A;  1IX8 A;  5DX5 A;  4GE9 A;  3ELE A;  4ZAH A;  5DB5 A;  1JS3 A;  1LW5 A;  4OT8 A;  4TMR A;  3USF A;  5AX8 A;  2FYF A;  1W23 A;  4ADB A;  2CST A;  1WST A;  1WYT B;  1Z7D A;  3JU7 A;  3VK3 A;  3FTB A;  3JTX A;  4WD2 A;  2CH1 A;  2VGU A;  4A0R A;  3OP7 A;  4RKC A;  5J8Q A;  3DR7 A;  1J32 A;  4W1X A;  2BI2 A;  2FN6 A;  3FSL A;  1EQB A;  4TN4 A;  4BA4 A;  3QPG A;  2WK8 A;  1ZOD A;  1C7G A;  1YNU A;  2CTZ A;  2QSR A;  1CL1 A;  2Z9X A;  3BWN A;  1TOJ A;  4WB0 A;  3TFU A;  2BHX A;  5I92 A;  1CS1 A;  3FZ7 A;  2QB2 A;  1D7V A;  1DFO A;  1OXO A;  3NUB A;  3GBX A;  4MSO A;  3H14 A;  3IF2 A;  2Q7W A;  4JEZ A;  1Z3Z A;  2QA3 A;  3W1H A;  3TCM A;  1BJW A;  2VMR A;  1LC7 A;  2GB3 A;  4N0W A;  3ZRR A;  2ORD A;  2W8T A;  3DXV A;  4OMA A;  5LHA A;  3PGY A;  1KMJ A;  1KAF A;  4Q76 A;  2W8J A;  4GEB A;  1ASE A;  5TF5 A;  1CJ0 A;  4OC9 A;  2VIB A;  1E5F A;  1YJZ A;  1GEW A;  2C81 A;  4R5F A;  2D61 A;  1ELQ A;  2W7G A;  4ZSY A;  2WKA A;  2DKJ A;  2VMO A;  2QMA A;  2JIS A;  3P1T A;  1TAR A;  2W7K A;  3NX3 A;  2JJG A;  4Y0H A;  5G09 A;  3RUY A;  3HVY A;  2BYL A;  5EIG B;  1WYU B;  4EMY A;  2BI3 A;  4JE5 D;  4OBV A;  1IAX A;  2HOY A;  3TQX A;  3EI6 A;  1CQ6 A;  2W8W A;  1ECX A;  3FFR A;  4W8I A;  1AMA A;  4ADD A;  4ITG A;  3BS8 A;  1GEX A;  3R4T A;  2VI8 A;  3PA9 A;  3Q8N A;  4O6Z A;  1ZC9 A;  2YKU A;  2AEV A;  3A9Z A;  3WCN A;  4XJM A;  1ARI A;  4WYF A;  4K05 A;  2X5F A;  1B8G A;  4OBU A;  3EI9 A;  2BI9 A;  3VAX A;  2YHK A;  4JEY A;  1BS0 A;  5DJ9 A;  5BJ3 A;  2CJH A;  3CBF A;  4IW7 A;  4A0F A;  4Y0I A;  3LG0 A;  2HOR A;  1BQD A;  3EI7 A;  4F5H A;  3N4S A;  4CXQ A; 
#chains in the Genus database with same CATH homology
 1AAM A;  4WP0 A;  3RBF A;  5LH9 A;  1V2F A;  2VMN A;  3NYU A;  4KYO A;  5E3K A;  3VOM A;  1BJO B;  2BWP A;  4GRX A;  4RAE A;  2R2N A;  2GMS A;  3FDD A;  1B4X A;  4JEX A;  1D7R A;  4J8L A;  3ATH A;  1AMQ A;  3BB8 A;  2HP1 A;  4LNL A;  1W7N A;  3FQ7 A;  3JWA A;  3COG A;  1ARG A;  2DGM A;  3BWO A;  3GWP A;  3UWC A;  3A9Y A;  1DJE A;  2EGY A;  3AEN A;  1N31 A;  9AAT A;  2G6W A;  4MQQ A;  3KGX A;  4WXG A;  3II0 A;  3CAI A;  3DZZ A;  4UHM A;  3LVJ A;  3HT4 A;  5M49 A;  3BN1 A;  3FZ6 A;  3VK2 A;  3ZZK A;  4NOG A;  1N8P A;  5G4J A;  2BI1 A;  1CZC A;  2AAT A;  2R5E A;  3L8A A;  4IYO A;  4F5M A;  1GC0 A;  1ASA A;  1KKJ A;  4JF1 A;  3B1D A;  3A2B A;  4W1V A;  4WLJ A;  2Z67 A;  1U08 A;  1JF9 A;  1AHF A;  2EZ1 A;  1WYU A;  3DU4 A;  2DGL A;  4GE7 A;  1TOE A;  3B1E A;  3DRD A;  3KE3 A;  2C44 A;  3JW9 A;  3TAT A;  3AEN B;  4LNM A;  4ITX A;  1IUG A;  1N2T A;  4H51 A;  4CVQ A;  2V1P A;  3EZ1 A;  3RBL A;  1T3I A;  2BIA A;  3F0H A;  2AY6 A;  1GC2 A;  3FKD A;  2ZP7 A;  3VP6 A;  1YIY A;  3D6K A;  2BIE A;  4CBS A;  2OKJ A;  4LC3 A;  4WYD A;  3T32 A;  1IX7 A;  4DGT A;  2O0R A;  1WYV B;  3F9T A;  3GZC A;  1ASM A;  4B98 A;  1TAT A;  3A8U X;  4AOA A;  3FCR A;  3AEJ C;  4JF0 A;  3B8X A;  1VJO A;  5EAA A;  2W7H A;  4ATP A;  2X8U A;  1M0P A;  3EI8 A;  3EI5 A;  3FVX A;  3EUC A;  3ZRP A;  1FG3 A;  2CAN A;  2HUU A;  3MAF A;  1AY4 A;  4EU1 A;  4M2K A;  3FQA A;  4RIZ A;  1SZK A;  2QBT A;  4HF8 A;  1IX6 A;  1LC5 A;  3BCX A;  3GSB A;  1V72 A;  1B9I A;  4F5F A;  4MKJ A;  4P7Y A;  1BJ4 A;  4ZDP A;  1GC3 A;  2AY5 A;  2W7D A;  3K7Y A;  4A6U A;  1DTY A;  1QJ3 A;  2FNU A;  3WLX A;  4RM1 A;  3ZRQ A;  3N75 A;  4R2N A;  2VMY A;  1AX4 A;  4ZDO A;  2ZY2 A;  1SFF A;  1SVV A;  2AY2 A;  2CIN A;  3JZL A;  2VGS A;  1M7Y A;  3E2Z B;  1AHX A;  2Z9W A;  3E6G A;  5M4D A;  3QBO A;  4JEW A;  2X3L A;  3EIB A;  1D2F A;  3K40 A;  2DR1 A;  5HXX A;  3QM2 A;  4WBT A;  4MY5 A;  2V0Y A;  1G4X A;  4AO9 A;  3GJU A;  4ISY A;  1LK9 A;  3NYS A;  3PJ0 A;  1I41 A;  4E1O A;  3FVS A;  1QZ9 A;  2D64 A;  4WLH A;  1S08 A;  4CXR A;  5F8V A;  1W7M A;  3F6T A;  2O1B A;  3TFT A;  3NU8 A;  4OTL A;  2Z9V A;  4GE4 A;  3RI6 A;  1MLY A;  4IXO A;  1WYV A;  3OKS A;  2WK7 A;  2JGT A;  1KMK A;  2D5Y A;  4W1W A;  2CJD A;  3CQ4 A;  3RQ1 A;  5D5S A;  2YCT A;  3AOW A;  1OHW A;  1C7N A;  3PAA A;  4JE5 A;  2YCP A;  1IAY A;  4M2M A;  2XBN A;  1ASB A;  4XQ2 A;  2D66 A;  1QJ5 A;  3GZD C;  5M4B A;  1M0Q A;  1TPL A;  1I48 A;  1XEY A;  4K2M A;  2VGT A;  3NTJ A;  4PVF A;  4WXF A;  4ZM3 A;  3MAD A;  4M2J A;  4WB0 B;  4EB5 A;  1QIS A;  1WKH A;  1S06 A;  3NYT A;  1SPA A;  4Y0D A;  1BT4 A;  2HOX A;  4E3R A;  2YRI A;  3FZ8 A;  3QN6 A;  4IX8 A;  4F5I A;  2G7J A;  1AKB A;  3NUI A;  5EFS A;  1AMR A;  1MLZ A;  2R0T A;  4MQR A;  1MAP A;  4ZLV A;  3BCA A;  4OYT A;  2NMP A;  5E5I A;  5EUD A;  4ATQ A;  1S07 A;  1M0O A;  1QGN A;  5D95 A;  2FM1 A;  4ZAS A;  2R5C B;  2VMZ A;  3E2F A;  3G0T A;  8AAT A;  1AKA A;  2W7E A;  1LKC A;  5IWQ A;  1QIT A;  2YKX A;  2CY8 A;  1ASN A;  1GC4 A;  1C9C A;  3BCB A;  4LW2 A;  4MGR A;  7AAT A;  3LWS A;  1FG7 A;  3I5T A;  1SF2 A;  1XI9 A;  4ADC A;  2EO5 A;  4DBC A;  2HOZ A;  2A1V A;  2QLR A;  3AEO A;  1AJS B;  4FL0 A;  3KKI A;  1KKP A;  3PD6 A;  2E7I A;  4B9B A;  1TOG A;  3FRK A;  3CQ6 A;  1MAQ A;  5G2Q A;  5BJ4 A;  2VLF A;  2BKW A;  5G0A A;  1OHY A;  1MGV A;  3ASB A;  1KL2 A;  3LV2 A;  2EZ2 A;  2CB1 A;  3NNK A;  3P6K A;  1FC4 A;  2ZY3 A;  3E2Y A;  2O7C A;  3ZZJ A;  1BQA A;  5FT5 A;  1EG5 A;  4RIT A;  5E4Z A;  3IHJ A;  3QGU A;  2W7I A;  4AH3 A;  1M6S A;  2DGK A;  2Z1Z A;  4N0B A;  2ZY5 A;  2D65 A;  5EUE A;  1C0N A;  1GBN A;  1RV4 A;  2GMU A;  1H1C A;  1ASF A;  2HP2 A;  4JEV A;  3DYD A;  4QGR A;  3W1I A;  4ZWV A;  1BKG A;  3PPL A;  2X5D A;  4WYA A;  1YOO A;  5G2P A;  1E5E A;  1ARH A;  3N5M A;  1ORD A;  2YOB A;  2D7Y A;  4RKD A;  3E2Z A;  2ZC0 A;  5FT6 A;  4ZSW A;  4A0G A;  2R5C A;  4XAU A;  4BQ0 A;  5C6U A;  3N4X A;  1S0A A;  4A0H A;  2CH2 A;  1AHY A;  3HQT A;  1GDE A;  2AY7 A;  2PO3 A;  4BHD A;  4H63 Q;  1MDZ A;  2HUF A;  4KXK A;  1GD9 A;  1DJ9 A;  3BV0 A;  4Q75 A;  4W5K A;  4IYO B;  4WXB A;  5FT4 A;  4HVK A;  5JAY A;  1UU2 A;  4XJO A;  3MKJ A;  4U1T A;  4Q6R A;  3LY1 A;  2DKB A;  2AEU A;  2HZP A;  3AEM C;  3L44 A;  3QI6 A;  3K28 A;  5F9S A;  2XH1 A;  2Z61 A;  3PDB B;  2CJG A;  4F4E A;  3ELP A;  2W8U A;  4E3Q A;  2WB6 A;  1AKC A;  2AY8 A;  4ZM4 A;  3N0L A;  4ZDL A;  1TOI A;  4PIW A;  4IY7 A;  1B5O A;  1S09 A;  3ASA A;  2AY9 A;  3WGC A;  3HDO A;  3WY7 A;  5HHY A;  2W7J A;  4K2B A;  4RJ0 A;  4XK1 A;  2ZY4 A;  3N4R A;  4OCA A;  3UAK A;  1X2A A;  4RLG A;  1JS6 A;  3GET A;  1V2D A;  1OAT A;  1Y4I A;  2ZSM A;  3HBX A;  4P3M A;  1WYT A;  1AHE A;  3MAF B;  2WK9 A;  1I29 A;  2EPJ A;  2ZUK A;  2GQN A;  1AHG A;  3AEJ A;  2Z9U A;  3MC6 A;  3UE8 A;  1D7S A;  5HDM A;  1BW0 A;  1SZU A;  1H0C A;  2AY3 A;  2W8V A;  2VGW A;  3PDB A;  1W3U A;  4L0O A;  3WZF A;  2AY1 A;  1J04 A;  2PB0 A;  2VYC A;  3MEB A;  3PIU A;  2OGA A;  1GEY A;  1PFF A;  3R9A A;  1IBJ A;  1RV3 A;  2JJF A;  3DR4 A;  3ECD A;  4EB7 A;  2EYQ A;  1JG8 A;  1ARS A;  4TV7 A;  1O4S A;  4WYC A;  4AZJ A;  1LS3 A;  2OQX A;  1G4V A;  4PFF A;  1WKG A;  2BWO A;  2D63 A;  3BC8 A;  1YJS A;  1QIR A;  2ZYJ A;  1B5P A;  2VMP A;  3A9X A;  3H7F A;  3NU7 A;  4R5Z A;  4WYG A;  4XEW A;  3VK4 A;  5EUN A;  2ZJG A;  1ASL A;  3WGB A;  1UKJ A;  3HMU A;  4F5J A;  4GSA A;  2FNI A;  4KAM A;  1TOK A;  2VMU A;  3WKR A;  4A72 A;  2VMW A;  1AIB A;  2DOU A;  4A00 A;  4BA5 A;  1GCK A;  1AY8 A;  1G7W A;  1TAS A;  1VEF A;  4U2H A;  2OAT A;  4W91 A;  2BWN A;  3QHX A;  1AMS A;  2VMX A;  3WKS A;  4A6T A;  2FQ6 A;  3LVL B;  5KTB A;  4DQ6 A;  1SZS A;  3GR9 A;  1ASD A;  1VP4 A;  1YJY A;  4UOY A;  4MQP A;  4UHO A;  3CQ5 A;  2GSA A;  4IXZ A;  2RFV A;  2VGV A;  1ZOB A;  2Z20 A;  3H9X A;  1KL1 A;  2VLH A;  2PB2 A;  2VIA A;  2VGZ A;  1AY5 A;  2C7T A;  1MDO A;  1PMO A;  1IJI A;  3ISL A;  1IVR A;  4ADE A;  1CQ8 A;  1G7X A;  2QB3 A;  3BWN C;  1C7O A;  2VMQ A;  1YAA A;  1M0N A;  1DJU A;  2CFB A;  1X0M A;  3W1J A;  1OHV A;  1UU0 A;  2D7Z A;  1CL2 A;  3AEM A;  3G7Q A;  2FKI A;  1UU1 A;  1PMM A;  3GZD A;  3WCO A;  3LVM A;  2YKY A;  4AO4 A;  4FFC A;  3EZS A;  3MAU A;  5EQC A;  5EIG A;  1DGD A;  2AY4 A;  1ASC A;  1X28 A;  4F5G A;  2VMS A;  3ACZ A;  3EIA A;  1M4N A;  3AOV A;  1BJN A;  4EFF A;  2JJH A;  3DC1 A;  1ASG A;  1PG8 A;  4E77 A;  4GDY A;  1AJR A;  4UQV A;  4MKK A;  2W7L A;  4CBR A;  3FQ8 A;  4LW4 A;  5DJ1 A;  5G4I A;  1O61 A;  4XJP A;  1O62 A;  2BIG A;  2TPL A;  3KGW A;  2ZSL A;  3B1C A;  3AAT A;  4RJY A;  5EAV A;  4Q31 A;  1AIC A;  3HL2 A;  1OXP A;  2VI9 A;  3NRA A;  2VMV A;  5K8B A;  1P3W A;  1LW4 A;  1CZE A;  2OGE A;  2OKK A;  3AEP A;  3I16 A;  3FFH A;  4WYE A;  3RCH A;  4A6R A;  4K2I A;  1MDX A;  2E7J A;  3FD0 A;  3AEL A;  3NDN A;  3AV7 A;  1DKA A;  1I43 A;  2EH6 A;  4AZK A;  1BJO A;  2BYJ A;  1EJI A;  2Z1Y A;  3FDB A;  1YIZ A;  3G8M A;  3B46 A;  4F5L A;  3N7N A;  4XJL A;  2W7F A;  3E77 A;  1AJS A;  4J5U A;  1D7U A;  2E7U A;  2YKV A;  3JWB A;  3DOD A;  4IXS A;  4R8D A;  5M46 A;  1RVU A;  1ART A;  1M32 A;  3WX9 A;  1X29 A;  1RVY A;  4F5K A;  1B9H A;  2YRR A;  3E9K A;  2E54 A;  1AAW A;  1C4K A;  1ELU A;  2VMT A;  3DXW A;  4LNJ A;  1AIA A;  1LC8 A;  2JG2 A;  2YCN A;  3PDX A;  2KFP A;  2C0R A;  1O69 A;  2F8J A;  3MC6 C;  3RCH B;  2HUI A;  3MBB A;  3PD6 B;  1CQ7 A;  3M5U A;  4I8A A;  3HLM A;  5FT8 A;  4PFN A;  1DGE A;  2BI5 A;  3LVK A;  4ZWM A;  1V2E A;  4BMK A;  1W7L A;  4UHN A;  3FVU A;  2JJE A;  2W7M A;  3I4J A;  1IX8 A;  5DX5 A;  4GE9 A;  3ELE A;  4ZAH A;  5DB5 A;  1JS3 A;  1LW5 A;  4OT8 A;  4TMR A;  3USF A;  5AX8 A;  2FYF A;  1W23 A;  4ADB A;  2CST A;  1WST A;  1WYT B;  1Z7D A;  3JU7 A;  3VK3 A;  3FTB A;  3JTX A;  4WD2 A;  2CH1 A;  2VGU A;  4A0R A;  3OP7 A;  4RKC A;  5J8Q A;  3DR7 A;  1J32 A;  4W1X A;  2BI2 A;  2FN6 A;  3FSL A;  1EQB A;  4TN4 A;  4BA4 A;  3QPG A;  2WK8 A;  1ZOD A;  1C7G A;  1YNU A;  2CTZ A;  2QSR A;  1CL1 A;  2Z9X A;  3BWN A;  1TOJ A;  4WB0 A;  3TFU A;  2BHX A;  5I92 A;  1CS1 A;  3FZ7 A;  2QB2 A;  1D7V A;  1DFO A;  1OXO A;  3NUB A;  3GBX A;  4MSO A;  3H14 A;  3IF2 A;  2Q7W A;  4JEZ A;  1Z3Z A;  2QA3 A;  3W1H A;  3TCM A;  1BJW A;  2VMR A;  1LC7 A;  2GB3 A;  4N0W A;  3ZRR A;  2ORD A;  2W8T A;  3DXV A;  4OMA A;  5LHA A;  3PGY A;  1KMJ A;  4Q76 A;  2W8J A;  4GEB A;  1ASE A;  5TF5 A;  1CJ0 A;  4OC9 A;  2VIB A;  1E5F A;  1YJZ A;  1GEW A;  2C81 A;  4R5F A;  2D61 A;  1ELQ A;  2W7G A;  4ZSY A;  2WKA A;  2DKJ A;  2VMO A;  2QMA A;  2JIS A;  3P1T A;  1TAR A;  2W7K A;  3NX3 A;  2JJG A;  4Y0H A;  5G09 A;  3RUY A;  3HVY A;  2BYL A;  5EIG B;  1WYU B;  4EMY A;  2BI3 A;  4JE5 D;  4OBV A;  1IAX A;  2HOY A;  3TQX A;  3EI6 A;  1CQ6 A;  2W8W A;  1ECX A;  3FFR A;  4W8I A;  1AMA A;  4ADD A;  4ITG A;  3BS8 A;  1GEX A;  3R4T A;  2VI8 A;  3PA9 A;  3Q8N A;  4O6Z A;  1ZC9 A;  2YKU A;  2AEV A;  3A9Z A;  3WCN A;  4XJM A;  1ARI A;  4WYF A;  4K05 A;  2X5F A;  1B8G A;  4OBU A;  3EI9 A;  2BI9 A;  3VAX A;  2YHK A;  4JEY A;  1BS0 A;  5DJ9 A;  5BJ3 A;  2CJH A;  3CBF A;  4IW7 A;  4A0F A;  4Y0I A;  3LG0 A;  2HOR A;  1BQD A;  3EI7 A;  4F5H A;  3N4S A;  4CXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...