2ZY5A

R487a mutant of l-aspartate beta-decarboxylase
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
510
structure length
510
Chain Sequence
ELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGAGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-aspartate beta-decarboxylase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
total genus 183
structure length 510
sequence length 510
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy5A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy5A01
4GE7A 4DGTA 3GZDC 1G4XA 1ZOBA 3GZCA 5DB5A 1ECXA 1IBJA 1BQAA 1W7MA 2PB0A 4WYGA 2QBTA 1D7SA 3A9ZA 1TOEA 3EI6A 4U2HA 3RQ1A 3WGCA 1S09A 2YKVA 3FQ7A 3HL2A 3BC8A 2W7EA 5DJ9A 3PIUA 1KMKA 3BV0A 1AHYA 2BI3A 3KE3A 4F5IA 5BJ4A 1VEFA 1IUGA 3LWSA 1GC4A 5EUNA 1AIBA 1JS3A 3BS8A 4E3QA 5EAVA 3Q8NA 3KGXA 3FFHA 5G4IA 3R4TA 2VMYA 3FQAA 3ASBA 4BHDA 2ZSLA 1OXPA 3CBFA 3MKJA 2VMRA 2R5CA 3JW9A 2VI9A 3BCBA 1IJIA 3HQTA 1N31A 2GSAA 2VLHA 1BW0A 1LKCA 2HOZA 3ZZJA 1MAQA 3AENB 5F9SA 2BHXA 1Z7DA 2ZJGA 3R9AA 3PA9A 2JGTA 3LVKA 2D64A 1LW4A 4W91A 1ASDA 2VMQA 3K28A 2W8TA 3EZSA 3T32A 4BA4A 2PO3A 3F9TA 4UHMA 4WYAA 1KKJA 1ASEA 2Z61A 3NX3A 2GMUA 4ZSYA 4WXFA 2W7HA 4CVQA 1ASAA 1MDOA 1MDXA 4GRXA 1FC4A 5FT4A 2VMUA 3AEOA 2YCTA 3E77A 3QPGA 1C7NA 4WYEA 1O4SA 3WGBA 5IWQA 2YRRA 1O62A 2BWOA 3ISLA 3FVXA 2V0YA 1LK9A 1UU0A 1OHVA 3E2ZA 3RCHA 4ZLVA 3MAFA 5EAAA 2ORDA 1QIRA 4QGRA 2C7TA 3A2BA 3PAAA 2DOUA 3EI5A 3LVMA 2E54A 4ISYA 3B1EA 1EG5A 1C9CA 4M2MA 2F8JA 3E9KA 3AOVA 1BKGA 2OQXA 5D95A 1M0NA 2DKJA 1B8GA 2FN6A 3GSBA 1SVVA 1MAPA 3ACZA 4ADEA 4BQ0A 3WZFA 1ARGA 1W23A 1X29A 3AEMC 1ARTA 1TOGA 5EIGA 1D7RA 3E2YA 3MEBA 4M2JA 1DJEA 2JJFA 1AAMA 2HOYA 1G7XA 3K40A 1N2TA 2YHKA 3NYSA 2WK9A 2FNIA 2BIEA 2VGVA 4Q6RA 2VMZA 3FSLA 1J32A 2W7GA 4W5KA 4E1OA 1SZSA 2JJEA 3EZ1A 5K8BA 1DFOA 4EFFA 3HLMA 2EZ2A 1BT4A 2CB1A 3PDXA 3MC6A 2C44A 1P3WA 5F8VA 1AKCA 3PDBA 1PG8A 2E7IA 1S08A 3CAIA 4JEYA 4ZWVA 1V2FA 4JF0A 3WKSA 4PFFA 5AX8A 4ADDA 3EIAA 3I4JA 4JEXA 3DC1A 4GDYA 1RVYA 1AMAA 3M5UA 4ATQA 4Q76A 1PFFA 4W1VA 1FG7A 4AO9A 3EUCA 2E7JA 1ELQA 1S0AA 2AY4A 4WYCA 4IXOA 5I92A 1CQ6A 3UE8A 5M49A 2W7FA 4K2MA 4WB0B 1WKHA 1Z3ZA 3LY1A 3BWNA 3B8XA 3LV2A 3AEJC 1B9HA 3NU8A 4P3MA 4XJPA 1KL1A 3TFUA 3PD6B 1M0OA 4KXKA 1MLYA 3N75A 3N5MA 4ZM4A 1KKPA 1ASGA 1ARSA 2W7DA 4PFNA 2AY7A 2VMWA 3DRDA 1UU2A 3COGA 4GEBA 1TOKA 4A0RA 5FT5A 1B5OA 1EJIA 5M4DA 1S06A 2BI9A 2VGUA 1WYTB 2EO5A 2CTZA 1D2FA 2ZC0A 4R5FA 2W7IA 1I29A 2V1PA 1JS6A 4JEZA 2JJHA 4L0OA 2FNUA 1D7UA 4ITGA 5D5SA 2W8JA 1CS1A 1DTYA 3MC6C 4GE9A 3TFTA 3VK4A 3ASAA 3AOWA 1QZ9A 3P1TA 1DGEA 2ZY4A 2XBNA 2Z9UA 4FFCA 2YCPA 3F0HA 4H51A 3ZRPA 3A9YA 1M4NA 3A9XA 1CL1A 2HOXA 4EU1A 2QB2A 2GQNA 2Z1ZA 1KL2A 3FQ8A 1GEXA 2BIGA 2VMSA 1X28A 2JJGA 2VGSA 2Z9WA 4XK1A 4ADBA 3TCMA 4CXQA 2VGZA 1AJRA 1LC8A 3IHJA 2CH1A 5E4ZA 2YOBA 2ZY3A 2Q7WA 4JEWA 5G09A 2YRIA 4OC9A 2VMTA 1VP4A 4J5UA 2BI5A 4MKJA 4AOAA 3LVJA 3BWNC 4MQQA 4RKCA 3BCAA 3B46A 3H7FA 8AATA 1W3UA 4NOGA 5TF5A 1OHYA 3BB8A 1WYVA 9AATA 2AATA 1AIAA 5HHYA 1CZCA 2VMPA 5C6UA 4ZAHA 4W1WA 2VI8A 3WKRA 4OCAA 3WX9A 1TOIA 1SF2A 1V2DA 1TPLA 3NUBA 1AKBA 1B9IA 3DR4A 4JF1A 2D5YA 1CZEA 4ZSWA 1BJOB 4OT8A 4PIWA 1QISA 3EI8A 4EB7A 3L44A 1AJSB 3E6GA 3JWAA 5EUEA 3RUYA 3QM2A 4ZWMA 3BCXA 3DODA 4GSAA 1BQDA 4LC3A 4HVKA 4TMRA 2BKWA 1AHFA 1QITA 1YAAA 3VK3A 3ZZKA 4AH3A 4XEWA 2AY2A 3NUIA 1BS0A 3FKDA 4Q31A 4A72A 1AHEA 1ASLA 1SZUA 1IAYA 1D7VA 2D7YA 2WK8A 2R2NA 4ADCA 1IAXA 1M0PA 4LNMA 1GC3A 2YKXA 3DXWA 1GEWA 2GMSA 1RVUA 3MADA 3L8AA 3NRAA 2VMXA 3B1CA 3ELPA 4A6RA 2W7MA 1ARIA 4Y0IA 3FDDA 3DXVA 3NDNA 2BWPA 1GCKA 1J04A 1OHWA 2BWNA 2W8WA 1H1CA 4IYOA 1ZODA 7AATA 2WKAA 4WXBA 2VMVA 2AY9A 3MAUA 3LG0A 4DBCA 1AAWA 2EGYA 3AENA 4U1TA 3JWBA 1I41A 5BJ3A 2QLRA 1W7LA 4UOYA 4CBRA 5J8QA 3RBFA 1U08A 1JG8A 1RV3A 2D65A 1UKJA 1I48A 1GBNA 3NU7A 4F5MA 2EPJA 2YKYA 4BA5A 3QHXA 2R5CB 2OGEA 4RKDA 3BWOA 1OATA 3FDBA 4W8IA 5FT6A 1TOJA 1M0QA 3ZRRA 1MLZA 1ASBA 4F5FA 2CY8A 2D7ZA 2BYJA 2D61A 1FG3A 4Q75A 4ATPA 2E7UA 1AX4A 2AY1A 3NNKA 4P7YA 1V2EA 4IY7A 5DJ1A 3UAKA 4AZKA 1QJ5A 5JAYA 3JTXA 2R0TA 3G7QA 4MY5A 4ITXA 1E5FA 1AICA 1CL2A 3PGYA 1GEYA 4MQRA 4K2IA 4RJYA 2QMAA 4A0GA 2VIAA 4A00A 3FFRA 1WYUA 2W7LA 2CJHA 1QGNA 2VMOA 4E77A 4ZDOA 4IXZA 1O61A 1SPAA 3ECDA 2O7CA 1KMJA 4EMYA 3E2ZB 4F5GA 3RCHB 2HP2A 3MAFB 3FRKA 2ZY5A 2WK7A 4MQPA 5G2QA 3VK2A 4A0HA 3USFA 4CBSA 2X5FA 2O1BA 1BJNA 4WXGA 1GD9A 1XI9A 1SZKA 1W7NA 2VIBA 3GBXA 5EFSA 4B9BA 4UHNA 2VLFA 3KKIA 2Z9XA 3AELA 3PJ0A 3VAXA 4UHOA 3EIBA 4MKKA 1CQ7A 5EQCA 4PVFA 1DGDA 2TPLA 4A6TA 1LC7A 4N0WA 2YCNA 2CFBA 3QI6A 3FCRA 5EIGB 2W7KA 4R5ZA 4ZDPA 1M32A 2PB2A 2Z20A 2RFVA 3EI7A 3FVSA 3NYUA 3A8UX 2FQ6A 2QA3A 2CANA 3F6TA 3DU4A 4WBTA 1AY4A 1AY5A 5EUDA 2HUFA 3WLXA 5M46A 2W7JA 3AEMA 1ELUA 2AY6A 4TN4A 4IYOB 1O69A 2AY8A 2O0RA 3EI9A 4F5HA 2C0RA 1CQ8A 4XJOA 1AHGA 1C7GA 3E2FA 1RV4A 3PDBB 3ATHA 1CJ0A 2OGAA 1I43A 1N8PA 1IX8A 2DR1A 4RAEA 4XJMA 1DJUA 4UQVA 2VYCA 4WB0A 4XQ2A 4O6ZA 4LW4A 4WP0A 4OTLA 1ORDA 1T3IA 2CINA 2DKBA 2ZYJA 1AKAA 3PD6A 1YOOA 3CQ4A 2OATA 1MGVA 5DX5A 4ZASA 3P6KA 3UWCA 4LW2A 4ZM3A 3DYDA 3B1DA 2ZUKA 1LC5A 1AY8A 3BN1A 4XAUA 4EB5A 1YIYA 1TARA 4F5KA 3AV7A 3PPLA 1YIZA 4KAMA 2VMNA 3GJUA 3DR7A 3WY7A 1LW5A 1WYTA 1X0MA 4AO4A 5G0AA 2ZSMA 1Y4IA 4M2KA 2R5EA 1ASFA 5M4BA 2HUIA 1DKAA 2ZY2A 3GR9A 1AMQA 1JF9A 4Y0DA 1IVRA 1WYUB 1IX7A 1WKGA 4IXSA 1ASCA 1YJSA 4A6UA 2AY5A 3HDOA 4GE4A 4OMAA 3AEJA 2CSTA 2EH6A 1YJZA 2JG2A 3K7YA 2W8VA 4F4EA 5E3KA 1DJ9A 4CXRA 1C0NA 1OXOA 1QJ3A 3GZDA 1C7OA 5HDMA 5HXXA 1X2AA 1WSTA 1GC0A 4R2NA 2G6WA 2XH1A 2NMPA 1EQBA 1BJWA 1S07A 2CJGA 2QB3A 3VOMA 1YJYA 4W1XA 2BI2A 3RI6A 1TATA 3OKSA 3TATA 2FM1A 1ZC9A 1G7WA 2VGWA 3ELEA 3QBOA 4ZDLA 1ASNA 2C81A 2ZP7A 3KGWA 4LNJA 5FT8A 1UU1A 1C4KA 2X5DA 2FYFA 4XJLA 4WYFA 1B4XA 1AMRA 3CQ6A 3QN6A 1G4VA 2HORA 1V72A 1GDEA 1M6SA 1SFFA 3MBBA 4MSOA 2EZ1A 3FTBA 3I5TA 3N0LA 4JEVA 4AZJA 4E3RA 4F5JA 3CQ5A 3AATA 4B98A 4WLHA 4OYTA 2D63A 5G4JA 1B5PA 1M7YA 4R8DA 1E5EA 4BMKA 2Z1YA 4F5LA 1GC2A 1AHXA 2BIAA 4IW7A 1MDZA 3NYTA 2VGTA 1BJOA 3FVUA 4WLJA 5G2PA 3NTJA 4KYOA 1LS3A 4WYDA 3LVLB 1AJSA 1WYVB 2Z9VA 1ARHA 2BI1A 4DQ6A 2D66A 4K2BA 4FL0A 1BJ4A 1TASA 3TQXA 3OP7A 3ZRQA 1IX6A 1H0CA 2AY3A 1YNUA 1ASMA 2CH2A 2X8UA 3GETA 4LNLA 2HUUA 3QGUA 4IX8A 4Y0HA 5E5IA 3II0A 4WD2A 2W8UA 3AEPA 3G8MA 3HMUA 2BYLA 3DZZA 1VJOA 4HF8A 4I8AA 2HZPA 2CJDA 3D6KA 2GB3A 2YKUA 1AMSA 4A0FA 3RBLA 2HP1A
chains in the Genus database with same CATH superfamily
5GT0A 1ZOBA 4J8XB 2QBTA 2YKVA 3W96A 4G92B 3W99B 1KMKA 3KE3A 1AHYA 5BJ4A 3X1SB 4F5IA 1VEFA 4LD9A 1GC4A 5EUNA 3LJAC 1PMOA 3KWQB 3RELB 4J8XD 3ASBA 3MGPD 3CBFA 2CV5B 2R5CA 3W98A 1TAFA 3C1BB 3X1SD 1P3KD 2GSAA 2VLHA 2KFPA 5B0ZA 1MAQA 3AENB 3KWQD 5GT3D 3MGSD 1ASDA 3K28A 4UHMA 1KX3C 5CPJC 4J8UD 2W7HA 4CVQA 1MDOA 2VMUA 2YCTA 3A6NB 2F8NB 2YRRA 3AZIA 3ISLA 1UU0A 3LZ0B 2RVQC 3H9XA 3MAFA 1KX5C 4X23D 5B1LD 4OBUA 1P3MD 3A2BA 2FFFB 4E44A 4WJ3C 5AV6A 2E54A 1C9CA 4YS3C 1M0NA 3A6ND 1B8GA 5JRGB 1M19D 1F1EA 3WZFA 1TOGA 5EIGA 1D7RA 4Z2MH 1DJEA 2HOYA 5GT0B 2VGVA 3FSLA 1BH8A 3UTBD 4E1OA 5K8BA 1DFOA 5B2IA 1BT4A 3N7NA 4Z66A 5B24A 2Y2PA 1PZRA 1AKCA 4YM6A 3CAIA 5AV8C 4ZWVA 4JF0A 3KUYD 1M18C 4PFFA 4DRAA 3MNNB 1P3GC 1TAFB 1RVYA 3WCNA 4W1VA 4XUJA 2L5AA 1FG7A 3X1VC 4AO9A 3EUCA 2AY4A 3B6FD 3FD0A 4P3MA 1KL1A 1M0OA 3MNND 4CAYB 5AY8A 3WKJB 3N75A 5DNMD 5KDMA 4GEBA 1TOKA 5FT5A 2NQBC 2EO5A 2CTZA 2ZC0A 5E5AA 2JJHA 2FNUA 3X1TD 2JISA 4WU8A 1QZ9A 3ZRPA 1WWSA 3A9YA 4EU1A 2Z1ZA 1P34A 2BIGA 2VGSA 2HIOB 3TCMA 5B40C 2VGZA 1LC8A 3AZJA 2F8NH 2OKJA 4JEWA 2Q7WA 3AZMB 1BH8B 4J5UA 4MKJA 4MQQA 3REHA 2FJ7C 8AATA 3KXBC 1AIAA 5HHYA 3W97C 2AROA 5C6UA 1V2DA 3NUBA 3R45B 5CPKB 4ZSWA 3LJAD 3EI8A 4EB7A 1AJSB 2FKIA 3H0MC 3B0DC 1P3OA 4LC3A 5CPJB 4TMRA 2BKWA 1U35C 4AH3A 2AY2A 4A72A 1TZYA 5DNNA 1P3LC 2WK8A 4LNMA 5AV9C 1RVUA 3MADA 3AZEC 3NRAA 5BT1C 3ELPA 4A6RA 4UUZB 3FZ8A 1KX3D 3DXVA 5CPJD 5B32A 5AVCA 2BWPA 1OHWA 2W8WA 1H1CA 1P3FC 2AY9A 4OBVA 4H9QA 3LG0A 4WU8B 5GXQC 2RVQD 5B31A 4XZQC 1GBNA 1KX5D 4F5MA 2EPJA 2OGEA 3G0TA 4RKDA 3AZHA 5BS7A 1P34B 3ZRRA 4YS3D 3AZJB 4RM1A 1FG3A 1V2EA 5JAYA 3UAKA 3O62A 1AICA 5BNXB 3REHB 2BYKA 2VIAA 4DRBA 4H9NB 4E77A 1O61A 1SPAA 1M1AC 2O7CA 4EMYA 3E2ZB 2ZM5A 3FRKA 2ZY5A 4MQPA 3AV2A 3USFA 3UTAC 2O1BA 1XI9A 2VIBA 5EFSA 3NQUA 2VLFA 5AV8D 3AELA 3PJ0A 4UHOA 4CSRB 1M18D 1CQ7A 4A6TA 2YCNA 2CFBA 1P3GD 1S32C 1P3IC 3EPKA 4R8PC 4R5ZA 3X1VD 4ZBJC 5CP6A 2Y2IA 2CANA 5M46A 4JJNC 1ULYA 2AY6A 4TN4A 3EI9A 4NFTA 3AFAA 2CWEA 4J8VA 3AV1C 4WU9A 2NQBD 4HGAC 4WB0A 1F66A 4O6ZA 4WP0A 1HQ3B 2ZYJA 5B40B 3AZHB 2DKBA 3WTPE 4ZASA 3LELA 4ZM3A 4KUDB 2ZUKA 3X1UA 1TARA 4KAMA 3REIA 3GJUA 3AZFC 2FJ7B 1LW5A 2OKKA 1X0MA 5B40D 4ZUXB 3W97B 3VH5A 5GSUC 4A6UA 3HDOA 4OMAA 3MGRA 2EH6A 2JG2A 3K7YA 5E3KA 3GZDA 3KXBD 3WAAA 3B0DB 3TU4C 2NMPA 1YJYA 4J8WA 4K05A 1HTAA 1ASNA 1EQZA 3B6GA 1P3LB 4XJLA 4WYFA 1B4XA 2WB6A 1AMRA 1GDEA 3REJC 1SFFA 2EZ1A 4JEVA 4E3RA 3AATA 4B98A 1U35D 4OYTA 2D63A 5G4JA 5B2JC 3V9RA 1M7YA 4QLCB 1GC2A 1AHXA 1MDZA 1P3LD 3NYTA 2VGTA 4H9OA 5AV9D 4G92C 3NTJA 3W99C 1LS3A 2VQRA 3AZED 5BT1D 1ARHA 4DQ6A 1ASMA 2X8UA 3QGUA 1KAFA 1P3FD 3MVDA 3RELC 4I8AA 2BYLA 2CV5C 2CJDA 2GB3A 5GXQD 3RBLA 5B33B 3C1BC 4XZQD 4H9RA 1BH9A 3AN2C 1G4XA 1IBJA 1W7MA 4WYGA 3WGCA 3EI6A 4U2HA 3HL2A 1ZLAA 2W7EA 5B0YA 3PIUA 3UT9A 4KHAB 1AIBA 3BS8A 5EAVA 3Q8NA 1N1JA 5G4IA 2VMYA 3MGQC 4BHDA 3LZ0C 1LKCA 3ZZJA 3LZ1A 1M1AD 2ZJGA 3PA9A 4J8WB 2HUEB 3UTAD 4W91A 2BYMB 2VMQA 4ZBJB 5BNVB 2X3LA 4BA4A 3AZLA 5JRGC 2PO3A 2GMUA 3W1JA 1KX4B 1FC4A 3VH6W 5FT4A 3E77A 3QPGA 1S32D 1O62A 1P3ID 5GT0C 2BWOA 4R8PD 1OHVA 4G91B 2PYOB 5EAAA 2C7TA 3AZGB 3W96C 3AV1B 5F99A 2DOUA 2F2AC 1EG5A 3C1CA 2AEVA 3AOVA 4JJND 5D95A 2IO5C 5B1MB 5C3IB 3MGPA 1W23A 3AEMC 3MEBA 4NE6A 3AV1D 1AAMA 1G7XA 3K40A 1P3BB 1BH9B 3NYSA 2WK9A 5GT3A 4Q6RA 3MGSA 2W7GA 1P3AA 2JJEA 5G49B 1ZLAB 4EFFA 2EZ2A 5B0YB 2LY8A 4J8UA 3B0BA 1P3WA 3WKJC 1PG8A 3AZFD 4JEXA 4X23A 4GDYA 5GSUD 3M5UA 1PFFA 5AVBA 2E7JA 1ELQA 1CQ6A 3B8XA 3REJB 3TFUA 4KXKA 3TU4D 1KU5A 1ASGA 1ARSA 2HIOC 5B2JB 1B5OA 2VGUA 3AZMC 3UTBA 1WYTB 1D2FA 3REJD 2V1PA 4JEZA 4L0OA 5B32G 4ITGA 4Z66C 2W8JA 1DTYA 3TFTA 5B24C 4GE9A 3EPHA 5B2JD 5BO0B 1DGEA 4FFCA 2YFWA 2W8SA 2YFVA 1CL1A 3KUYA 3W99D 2QB2A 3I16A 2GQNA 5B31G 5CPKC 1GEXA 3AN2B 2JJGA 5CPIB 2CH1A 5E4ZA 3RELD 2YOBA 2CV5D 3B6FA 3LVJA 3REKA 3BCAA 3C1BD 3AN2D 3MGQB 1OHYA 1WYVA 9AATA 2AATA 1CZCA 2Y2QA 4W1WA 4KGCA 1B9IA 1CZEA 1QISA 3L44A 2BG1A 5EUEA 3X1TA 3QM2A 3RUYA 3MGQD 2F8ND 3DODA 4GSAA 4WU8C 3LZ0D 1YAAA 3NUIA 1BS0A 1IAYA 4WNNA 1P34C 4ADCA 1GEWA 2VMXA 3B1CA 3KFUG 3AZJC 5JRGD 1ARIA 3W96B 7AATA 2BWNA 1ZODA 3A1IA 2XD5A 4LD9B 2IO5B 3WA9A 1AAWA 3REHC 5GT0D 2QLRA 1W7LA 2JCHA 1U08A 1JG8A 1I48A 2YFVB 2R5CB 3W96D 3W98B 3FDBA 5FT6A 5B0ZB 3LJAA 4Q75A 5DJ1A 3JTXA 1P3OC 3PGYA 4RJYA 4K2IA 2QMAA 4A0GA 4AWLC 3FFRA 2W7LA 1TZYC 4ZDOA 3AZIB 4IXZA 1KMJA 2HP2A 3MAFB 2WK7A 1W2EA 1KX3A 4A0HA 2X5FA 5AVCC 5AV5A 2JSSA 3WKJD 5AV6B 2Z9XA 3VAXA 3EIBA 4PVFA 1KX5A 5B31C 5EIGB 5FUGA 4ZDPA 2G5HC 3WTPA 1HQ3C 3AZHC 2RFVA 3EI7A 3NYUA 4YS3A 3A8UX 4RJ0A 1AY4A 4KUDC 2HUFA 3WLXA 4RIZA 2QSRA 5B2IB 2O0RA 4Z66B 5B24B 2HIOD 4ZUXC 3WA9B 1C7GA 4YM6B 3ATHA 2OGAA 1N8PA 2RIQA 4RAEA 4XJMA 3AZMD 1DJUA 4XQ2A 3JZLA 4Z5TA 4LW4A 2CINA 4Z66D 3PD6A 5B24D 3CQ4A 4XUJB 5AV8A 1LC5A 4XAUA 1YIYA 1M18A 5CPKD 1P3GA 1XEYA 1ASFA 5AY8B 1AOIA 3X1VA 1AMQA 1JF9A 4Y0DA 5KDMB 5CP6C 1IX7A 1WKGA 3AZKA 4GE4A 2CSTA 3EG5B 2W8VA 4QLCC 5E5AB 1DJ9A 3W1IA 1QJ3A 1C7OA 4R2NA 2G6WA 2CJGA 3AFAC 1S07A 1ZC9A 4ZDLA 3ELEA 2ZP7A 3KGWA 3EPJA 2NZDA 2X5DA 1F66C 3WTPB 3FTBA 3I5TA 4WU8D 4AZJA 5B33C 3CQ5A 3LELC 3X1UC 1B5PA 3AYWA 1T3UA 1P34D 1BJOA 5G2PA 4KYOA 3LVLB 2Z9VA 4H9SC 3AZJD 2BI1A 4K2BA 2AROB 3OP7A 2CH2A 3GETA 5E5IA 4WD2A 3AEPA 4HF8A 3REHD 4A0FA 4H63Q 4GE7A 3GZDC 5DB5A 3GZCA 2PB0A 1P3OB 3RQ1A 1D7SA 3A9ZA 4J8WC 1S09A 2HUEC 3FQ7A 1H3OA 4AWLB 1P3PA 3BC8A 1TZYB 3B6GC 2BI3A 5DNNB 1JS3A 3KGXA 3FFHA 3R4TA 1KX4C 3FQAA 5AVCB 5B32B 2ZSLA 1OXPA 3MKJA 3JW9A 2VI9A 3BCBA 4G91C 4H9QB 4EO5C 2PYOC 1TZYD 1N31A 1BW0A 2HOZA 5F9SA 5AV9A 3AZGC 2BHXA 1Z7DA 3AZEA 3R9AA 2JGTA 5B31B 3LVKA 1LW4A 5B1MC 5AVCD 3EZSA 1P3FA 1JFIA 3F9TA 4WYAA 5C3IC 1KKJA 2Z61A 3FZ6A 4ZSYA 4WXFA 1MDXA 5GXQA 4GRXA 3AEOA 1C7NA 4XZQA 1O4SA 3WGBA 1P3BC 3FVXA 2V0YA 3O62B 3RCHA 3AYWB 4ZLVA 1HQ3D 3AZHD 4QGRA 2BYKB 1ZLAC 3EI5A 3LVMA 5B0YC 3B1EA 4KUDD 3AZNA 2F8JA 3E9KA 2DKJA 2FN6A 3GSBA 1MAPA 1ID3A 4BQ0A 2FJ7D 3AV2B 4ZUXD 3W97D 3NQUB 3N4SA 1N2TA 2YHKA 2FNIA 3LZ1C 1J32A 4W5KA 3WCOA 1SZSA 3UTAA 3EZ1A 3HLMA 3PDXA 2CB1A 4H9PA 3MC6A 2C44A 5CP6B 2Y2LA 5F8VA 4M6BA 3PDBA 2E7IA 1S08A 4JEYA 3KSYA 1S32A 4R8PA 3I4JA 3AFAB 3DC1A 1AMAA 2F8NK 5CP6D 4J8VB 5F99C 4WU9B 1S0AA 4WYCA 5I92A 5M49A 3B0CW 3C1CC 3UE8A 4JJNA 4K2MA 4WB0B 3VH5W 4QLCD 1F66B 1WKHA 3BWNA 3LY1A 3LV2A 3AEJC 1B9HA 3NQJA 4WZSB 3AFAD 1MLYA 3N5MA 4ZM4A 3LELB 1KKPA 2W7DA 3X1UB 5CPIC 2AY7A 2VMWA 4RLGA 1UU2A 3EPLA 3REIB 1F66D 2BI9A 4R5FA 1JS6A 1P3AC 4RITA 5B33D 5D5SA 3LELD 3VK4A 3AOWA 3X1UD 2ZY4A 2XBNA 3F0HA 3AZFA 3MGRB 1ID3B 2HOXA 1KL2A 3FQ8A 2VMSA 3WAAB 2Z9WA 5GSUA 4XK1A 1AJRA 3IHJA 2DGLA 5G09A 2YRIA 5AVBC 1EQZB 1VP4A 3B6GB 2BI5A 2Y2MA 4RKCA 4H9PB 3B46A 3H7FA 3HVYA 3TU4A 1W3UA 4NOGA 4J8WD 2VMPA 2VI8A 3WX9A 3V9RB 1TPLA 1AKBA 4EO5B 3B6GD 4JF1A 4H9OB 3JWAA 1KX4D 4LD9C 3BCXA 1BQDA 4J8XA 4HVKA 3MVDB 1AHFA 3VK3A 2PYOD 4XEWA 4Q31A 3W99A 3AZGD 1ASLA 1SZUA 3NQJB 3W98C 1D7VA 3X1SA 1P3KA 2R2NA 1IAXA 4H9RB 1GC3A 3DXWA 5B0ZC 3KWQA 2GMSA 5B1MD 3RELA 4Y0IA 3NDNA 4IYOA 3UT9B 3MAUA 3REKC 3C1BA 3AENA 4U1TA 5BJ3A 1P3BD 1N1JB 4CBRA 3RBFA 2D65A 1UKJA 3AZIC 2DQNC 1ZLAD 5B0YD 4W8IA 2AEUA 5B1LA 1P3MA 4KGCC 1M0QA 1MLZA 1ASBA 2CY8A 2D7ZA 3LZ1B 5AV6C 1R4VA 2D61A 3X1TC 3A6NA 2E7UA 2F8NA 1M19A 4IY7A 3LZ0A 3AZLB 2R0TA 3G7QA 4MY5A 1GEYA 4MQRA 4A00A 3LZ1D 1QGNA 2VMOA 3HT4A 4CBSA 1GD9A 5B2IC 5F99B 1SZKA 1W7NA 3GBXA 4UHNA 3C1CB 3VH6T 3WA9C 1WWIA 4YM6C 5EQCA 2TPLA 5JA4A 3MGPB 3QI6A 3AL0C 5F99D 3FVSA 1P3KB 3C1CD 2QA3A 4XUJC 5GT3B 3DU4A 4WBTA 1AY5A 5EUDA 3MGSB 3AEMA 1P3AB 1ELUA 4IYOB 2AY8A 3MNNA 4J8UB 2C0RA 5CPID 5DNMA 5AY8C 1RV4A 1CJ0A 2Y2NA 1P3AD 4OTLA 1ORDA 4X23B 5B1LB 1AKAA 1P3MB 2OATA 4CAYA 1PMMA 5DX5A 3WKJA 5E5AC 5AV5C 3UWCA 3DYDA 5AVBB 4EB5A 3BN1A 3AV7A 3FZ7A 2VMNA 1M19B 3DR7A 3WY7A 2ZSMA 2R5EA 2HUIA 1DKAA 3GR9A 3WTPC 5AVBD 4IXSA 3W1HA 2DGMA 3UTBB 1C0NA 1OXOA 1WSTA 1GC0A 2HIOA 1BJWA 4W1XA 2BI2A 3RI6A 2YFWB 3OKSA 2FM1A 2AROC 1G7WA 3AZMA 5JA4B 2C81A 3KUYB 2FYFA 4Z5TC 3CQ6A 1V72A 4LD9D 3MBBA 4MSOA 3N0LA 2Y2KA 3B6FB 1E5EA 3R45A 5CPKA 3REKB 3W98D 2BIAA 4IW7A 3FVUA 5B0ZD 1AJSA 1WYVB 5DNMB 1AOIC 5DNNC 4FL0A 1BJ4A 3ZRQA 1IX6A 1H0CA 2AY3A 1YNUA 4IX8A 4KGCB 5CPJA 3II0A 3AZKC 3REKD 5B32C 3DZZA 3HMUA 2HZPA 2YKUA 1AMSA 2Y2HA 3X1TB 2HP1A 4DGTA 3IP4C 4UPKA 3AZID 1ECXA 1BQAA 2UWXA 4UUZA 1TOEA 4KGCD 5DJ9A 5AV6D 3BV0A 2NZDC 4WNNB 5BS7C 1IUGA 3LWSA 4DQYB 4E3QA 2VMRA 3O62C 3AYWC 1IJIA 3HQTA 5KTBA 1Z2CB 2D64A 3N4RA 5B2ID 2W8TA 3T32A 2DGKA 1ASEA 3NX3A 3AV2C 5BNXA 3LJAB 3WA9D 1ASAA 4YM6D 4H9NA 5IWQA 4WYEA 1LK9A 3E2ZA 2ORDA 1QIRA 3PAAA 4XUJD 1P3PC 4ISYA 4M2MA 1BKGA 2OQXA 4CSRA 1SVVA 3ACZA 4ADEA 1KX3B 1ARGA 1X29A 4NE5A 1ARTA 5AV5B 5AY8D 3E2YA 1BFMA 4M2JA 2JJFA 4J8VC 4Z2MG 2NQBA 2BIEA 2VMZA 4WU9C 1KX5B 5FUGB 5E5AD 5AV5D 4YS3B 3HBXA 1V2FA 3WKSA 3REIC 5AX8A 4ADDA 3EIAA 1HQ3A 5B40A 3WTPD 4ATQA 4Q76A 4KUDA 4IXOA 3AZNC 2W7FA 3N4XA 1Z3ZA 4Z5TB 3NU8A 4XJPA 2FJ7A 3MGRC 1ID3C 3PD6B 4ZUXA 3KXBA 3W97A 4WV4B 3WAAC 5AV8B 2AROD 4PFNA 3DRDA 3COGA 1M18B 4A0RA 1EJIA 5M4DA 1S06A 4Z5TD 1P3GB 1EQZC 2W7IA 1I29A 1AOIB 3X1VB 1D7UA 3MC6C 1CS1A 3ASAA 2EYQA 3P1TA 2Z9UA 1P3OD 3AZKB 2G5IC 1U35A 2YCPA 4H51A 1M4NA 3A9XA 1P3LA 1AOID 5DNND 1X28A 4ADBA 4CXQA 3VP6A 2NQBB 2ZY3A 3AZKD 5CHLB 5B32D 4OC9A 2VMTA 2NZDB 4QLCA 4AOAA 2G7JA 3MVDC 2F8NG 3BWNC 5TF5A 3BB8A 2DF4C 2Y2GA 5B31D 4ZAHA 3WKRA 4OCAA 1TOIA 1SF2A 2NZDD 3DR4A 2D5YA 1BJOB 4OT8A 4PIWA 3E6GA 3UT9C 5B33A 1B6WA 4ZWMA 3O62D 1QITA 2J8PA 3AYWD 3ZZKA 3FKDA 1AHEA 2JE5A 4H9SA 3KXBB 4KHAA 2D7YA 1M0PA 2YKXA 1M1AA 3L8AA 2W7MA 3FDDA 3AV2D 1H3OB 1J04A 1GCKA 1P3PB 2WKAA 3AZLC 4WXBA 2VMVA 4DBCA 2EGYA 3JWBA 1I41A 4UOYA 5J8QA 1RV3A 1U35B 1P3IA 3NU7A 2YKYA 4BA5A 3QHXA 2BYMA 3BWOA 1A7WA 1OATA 5BNVA 1P3PD 1TOJA 5AV9B 4F5FA 3AZEB 1KX4A 2BYJA 4ATPA 1AX4A 2AY1A 3NNKA 4P7YA 4AZKA 1QJ5A 1P3FB 2Y2JA 1JFIB 4J8XC 3MGPC 2PYOA 4ITXA 1E5FA 1CL2A 3AZGA 4J8VD 3AV1A 5GXQB 1WYUA 4WU9D 4XZQB 3X1SC 1P3KC 2CJHA 5B1MA 4F5GA 3KWQC 3ECDA 5GT3C 3RCHB 3MGSC 3VK2A 5G2QA 3VH6A 4WXGA 1BJNA 4B9BA 3KKIA 3AZNB 4J8UC 1P3BA 4MKKA 3REID 1DGDA 1LC7A 4N0WA 3FCRA 5G49A 2W7KA 1M32A 3H0RC 2PB2A 2Z20A 4X23C 5B1LC 1P3MC 2FQ6A 3AZND 3F6TA 1M1AB 3MGRD 1ID3D 2W7JA 3UTAB 3A6NC 1O69A 1M19C 4F5HA 3WAAD 1CQ8A 4XJOA 1AHGA 3E2FA 1Q9CA 3PDBB 4E45A 1I43A 1IX8A 2DR1A 1S32B 4J8LA 1P3IB 1EQZD 4R8PB 4UQVA 2VYCA 3REJA 1T3IA 3UTBC 1YOOA 3A1KA 1MGVA 3P5JB 4NE3A 3P6KA 4LW2A 3B1DA 5B2JA 1AY8A 4JJNB 4F5KA 3PPLA 1YIZA 3GWPA 1WYTA 4AO4A 5G0AA 3KUYC 1Y4IA 4M2KA 5M4BA 2ZY2A 2XD1A 4HGAB 1IVRA 1WYUB 5BO0A 3B0CT 1ASCA 1YJSA 2AY5A 3AEJA 3MVDD 3VH5T 2CV5A 1YJZA 3B6FC 4F4EA 4CXRA 5HXXA 5HDMA 3AN2A 2A1VA 1X2AA 1B67A 5CPIA 3MNNC 2XH1A 2QB3A 1EQBA 3VOMA 5DNMC 1TATA 3TATA 3AZFB 2VGWA 3QBOA 2Y2OA 4LNJA 5FT8A 1UU1A 1C4KA 3UT9D 3QN6A 1G4VA 2HORA 5GSUB 1M6SA 3H0LC 3MGQA 4F5JA 4WLHA 4R8DA 4BMKA 2Z1YA 4F5LA 4WLJA 3TU4B 4WYDA 2D66A 1TASA 3TQXA 5JRGA 4LNLA 2HUUA 4Y0HA 3AZLD 2W8UA 3G8MA 1VJOA 3D6KA
chains in the Genus database with same CATH topology
5GT0A 1ZOBA 4J8XB 2QBTA 2YKVA 3W96A 4G92B 3W99B 1KMKA 3KE3A 1AHYA 5BJ4A 3X1SB 4F5IA 1VEFA 4LD9A 1GC4A 5EUNA 3LJAC 1PMOA 3KWQB 3RELB 4J8XD 3ASBA 3MGPD 3CBFA 2CV5B 2R5CA 3W98A 1TAFA 3C1BB 3X1SD 1P3KD 2GSAA 2VLHA 2KFPA 5B0ZA 1MAQA 3AENB 3KWQD 5GT3D 3MGSD 1ASDA 3K28A 4UHMA 1KX3C 5CPJC 4J8UD 2W7HA 4CVQA 1MDOA 2VMUA 2YCTA 3A6NB 2F8NB 2YRRA 3AZIA 3ISLA 1UU0A 3LZ0B 2RVQC 3H9XA 3MAFA 1KX5C 4X23D 5B1LD 4OBUA 1P3MD 3A2BA 2FFFB 4E44A 4WJ3C 5AV6A 2E54A 1C9CA 4YS3C 1M0NA 3A6ND 1B8GA 5JRGB 1M19D 1F1EA 3WZFA 1TOGA 5EIGA 1D7RA 4Z2MH 1DJEA 2HOYA 5GT0B 2VGVA 3FSLA 1BH8A 3UTBD 4E1OA 5K8BA 1DFOA 5B2IA 1BT4A 3N7NA 4Z66A 5B24A 2Y2PA 1PZRA 1AKCA 4YM6A 3CAIA 5AV8C 4ZWVA 4JF0A 3KUYD 1M18C 4PFFA 4DRAA 3MNNB 1P3GC 1TAFB 1RVYA 3WCNA 4W1VA 4XUJA 2L5AA 1FG7A 3X1VC 4AO9A 3EUCA 2AY4A 3B6FD 3FD0A 4P3MA 1KL1A 1M0OA 3MNND 4CAYB 5AY8A 3WKJB 3N75A 5DNMD 5KDMA 4GEBA 1TOKA 5FT5A 2NQBC 2EO5A 2CTZA 2ZC0A 5E5AA 2JJHA 2FNUA 3X1TD 2JISA 4WU8A 1QZ9A 3ZRPA 1WWSA 3A9YA 4EU1A 2Z1ZA 1P34A 2BIGA 2VGSA 2HIOB 3TCMA 5B40C 2VGZA 1LC8A 3AZJA 2F8NH 2OKJA 4JEWA 2Q7WA 3AZMB 1BH8B 4J5UA 4MKJA 4MQQA 3REHA 2FJ7C 8AATA 3KXBC 1AIAA 5HHYA 3W97C 2AROA 5C6UA 1V2DA 3NUBA 3R45B 5CPKB 4ZSWA 3LJAD 3EI8A 4EB7A 1AJSB 2FKIA 3H0MC 3B0DC 1P3OA 4LC3A 5CPJB 4TMRA 2BKWA 1U35C 4AH3A 2AY2A 4A72A 1TZYA 5DNNA 1P3LC 2WK8A 4LNMA 5AV9C 1RVUA 3MADA 3AZEC 3NRAA 5BT1C 3ELPA 4A6RA 4UUZB 3FZ8A 1KX3D 3DXVA 5CPJD 5B32A 5AVCA 2BWPA 1OHWA 2W8WA 1H1CA 1P3FC 2AY9A 4OBVA 4H9QA 3LG0A 4WU8B 5GXQC 2RVQD 5B31A 4XZQC 1GBNA 1KX5D 4F5MA 2EPJA 2OGEA 3G0TA 4RKDA 3AZHA 5BS7A 1P34B 3ZRRA 4YS3D 3AZJB 4RM1A 1FG3A 1V2EA 5JAYA 3UAKA 3O62A 1AICA 5BNXB 3REHB 2BYKA 2VIAA 4DRBA 4H9NB 4E77A 1O61A 1SPAA 1M1AC 2O7CA 4EMYA 3E2ZB 2ZM5A 3FRKA 2ZY5A 4MQPA 3AV2A 3USFA 3UTAC 2O1BA 1XI9A 2VIBA 5EFSA 3NQUA 2VLFA 5AV8D 3AELA 3PJ0A 4UHOA 4CSRB 1M18D 1CQ7A 4A6TA 2YCNA 2CFBA 1P3GD 1S32C 1P3IC 3EPKA 4R8PC 4R5ZA 3X1VD 4ZBJC 5CP6A 2Y2IA 2CANA 5M46A 4JJNC 1ULYA 2AY6A 4TN4A 3EI9A 4NFTA 3AFAA 2CWEA 4J8VA 3AV1C 4WU9A 2NQBD 4HGAC 4WB0A 1F66A 4O6ZA 4WP0A 1HQ3B 2ZYJA 5B40B 3AZHB 2DKBA 3WTPE 4ZASA 3LELA 4ZM3A 4KUDB 2ZUKA 3X1UA 1TARA 4KAMA 3REIA 3GJUA 3AZFC 2FJ7B 1LW5A 2OKKA 1X0MA 5B40D 4ZUXB 3W97B 3VH5A 5GSUC 4A6UA 3HDOA 4OMAA 3MGRA 2EH6A 2JG2A 3K7YA 5E3KA 3GZDA 3KXBD 3WAAA 3B0DB 3TU4C 2NMPA 1YJYA 4J8WA 4K05A 1HTAA 1ASNA 1EQZA 3B6GA 1P3LB 4XJLA 4WYFA 1B4XA 2WB6A 1AMRA 1GDEA 3REJC 1SFFA 2EZ1A 4JEVA 4E3RA 3AATA 4B98A 1U35D 4OYTA 2D63A 5G4JA 5B2JC 3V9RA 1M7YA 4QLCB 1GC2A 1AHXA 1MDZA 1P3LD 3NYTA 2VGTA 4H9OA 5AV9D 4G92C 3NTJA 3W99C 1LS3A 2VQRA 3AZED 5BT1D 1ARHA 4DQ6A 1ASMA 2X8UA 3QGUA 1P3FD 3MVDA 3RELC 4I8AA 2BYLA 2CV5C 2CJDA 2GB3A 5GXQD 3RBLA 5B33B 3C1BC 4XZQD 4H9RA 1BH9A 3AN2C 1G4XA 1IBJA 1W7MA 4WYGA 3WGCA 3EI6A 4U2HA 3HL2A 1ZLAA 2W7EA 5B0YA 3PIUA 3UT9A 4KHAB 1AIBA 3BS8A 5EAVA 3Q8NA 1N1JA 5G4IA 2VMYA 3MGQC 4BHDA 3LZ0C 1LKCA 3ZZJA 3LZ1A 1M1AD 2ZJGA 3PA9A 4J8WB 2HUEB 3UTAD 4W91A 2BYMB 2VMQA 4ZBJB 5BNVB 2X3LA 4BA4A 3AZLA 5JRGC 2PO3A 2GMUA 3W1JA 1KX4B 1FC4A 3VH6W 5FT4A 3E77A 3QPGA 1S32D 1O62A 1P3ID 5GT0C 2BWOA 4R8PD 1OHVA 4G91B 2PYOB 5EAAA 2C7TA 3AZGB 3W96C 3AV1B 5F99A 2DOUA 2F2AC 1EG5A 3C1CA 2AEVA 3AOVA 4JJND 5D95A 2IO5C 5B1MB 5C3IB 3MGPA 1W23A 3AEMC 3MEBA 4NE6A 3AV1D 1AAMA 1G7XA 3K40A 1P3BB 1BH9B 3NYSA 2WK9A 5GT3A 4Q6RA 3MGSA 2W7GA 1P3AA 2JJEA 5G49B 1ZLAB 4EFFA 2EZ2A 5B0YB 2LY8A 4J8UA 3B0BA 1P3WA 3WKJC 1PG8A 3AZFD 4JEXA 4X23A 4GDYA 5GSUD 3M5UA 1PFFA 5AVBA 2E7JA 1ELQA 1CQ6A 3B8XA 3REJB 3TFUA 4KXKA 3TU4D 1KU5A 1ASGA 1ARSA 2HIOC 5B2JB 1B5OA 2VGUA 3AZMC 3UTBA 1WYTB 1D2FA 3REJD 2V1PA 4JEZA 4L0OA 5B32G 4ITGA 4Z66C 2W8JA 1DTYA 3TFTA 5B24C 4GE9A 3EPHA 5B2JD 5BO0B 1DGEA 4FFCA 2YFWA 2W8SA 2YFVA 1CL1A 3KUYA 3W99D 2QB2A 3I16A 2GQNA 5B31G 5CPKC 1GEXA 3AN2B 2JJGA 5CPIB 2CH1A 5E4ZA 3RELD 2YOBA 2CV5D 3B6FA 3LVJA 3REKA 3BCAA 3C1BD 3AN2D 3MGQB 1OHYA 1WYVA 9AATA 2AATA 1CZCA 2Y2QA 4W1WA 4KGCA 1B9IA 1CZEA 1QISA 3L44A 2BG1A 5EUEA 3X1TA 3QM2A 3RUYA 3MGQD 2F8ND 3DODA 4GSAA 4WU8C 3LZ0D 1YAAA 3NUIA 1BS0A 1IAYA 4WNNA 1P34C 4ADCA 1GEWA 2VMXA 3B1CA 3KFUG 3AZJC 5JRGD 1ARIA 3W96B 7AATA 2BWNA 1ZODA 3A1IA 2XD5A 4LD9B 2IO5B 3WA9A 1AAWA 3REHC 5GT0D 2QLRA 1W7LA 2JCHA 1U08A 1JG8A 1I48A 2YFVB 2R5CB 3W96D 3W98B 3FDBA 5FT6A 5B0ZB 3LJAA 4Q75A 5DJ1A 3JTXA 1P3OC 3PGYA 4RJYA 4K2IA 2QMAA 4A0GA 4AWLC 3FFRA 2W7LA 1TZYC 4ZDOA 3AZIB 4IXZA 1KMJA 2HP2A 3MAFB 2WK7A 1W2EA 1KX3A 4A0HA 2X5FA 5AVCC 5AV5A 2JSSA 3WKJD 5AV6B 2Z9XA 3VAXA 3EIBA 4PVFA 1KX5A 5B31C 5EIGB 5FUGA 4ZDPA 2G5HC 3WTPA 1HQ3C 3AZHC 2RFVA 3EI7A 3NYUA 4YS3A 3A8UX 4RJ0A 1AY4A 4KUDC 2HUFA 3WLXA 4RIZA 2QSRA 5B2IB 2O0RA 4Z66B 5B24B 2HIOD 4ZUXC 3WA9B 1C7GA 4YM6B 3ATHA 2OGAA 1N8PA 2RIQA 4RAEA 4XJMA 3AZMD 1DJUA 4XQ2A 3JZLA 4Z5TA 4LW4A 2CINA 4Z66D 3PD6A 5B24D 3CQ4A 4XUJB 5AV8A 1LC5A 4XAUA 1YIYA 1M18A 5CPKD 1P3GA 1XEYA 1ASFA 5AY8B 1AOIA 3X1VA 1AMQA 1JF9A 4Y0DA 5KDMB 5CP6C 1IX7A 1WKGA 3AZKA 4GE4A 2CSTA 3EG5B 2W8VA 4QLCC 5E5AB 1DJ9A 3W1IA 1QJ3A 1C7OA 4R2NA 2G6WA 2CJGA 3AFAC 1S07A 1ZC9A 4ZDLA 3ELEA 2ZP7A 3KGWA 3EPJA 2NZDA 2X5DA 1F66C 3WTPB 3FTBA 3I5TA 4WU8D 4AZJA 5B33C 3CQ5A 3LELC 3X1UC 1B5PA 3AYWA 1T3UA 1P34D 1BJOA 5G2PA 4KYOA 3LVLB 2Z9VA 4H9SC 3AZJD 2BI1A 4K2BA 2AROB 3OP7A 2CH2A 3GETA 5E5IA 4WD2A 3AEPA 4HF8A 3REHD 4A0FA 4H63Q 4GE7A 3GZDC 5DB5A 3GZCA 2PB0A 1P3OB 3RQ1A 1D7SA 3A9ZA 4J8WC 1S09A 2HUEC 3FQ7A 1H3OA 4AWLB 1P3PA 3BC8A 1TZYB 3B6GC 2BI3A 5DNNB 1JS3A 3KGXA 3FFHA 3R4TA 1KX4C 3FQAA 5AVCB 5B32B 2ZSLA 1OXPA 3MKJA 3JW9A 2VI9A 3BCBA 4G91C 4H9QB 4EO5C 2PYOC 1TZYD 1N31A 1BW0A 2HOZA 5F9SA 5AV9A 3AZGC 2BHXA 1Z7DA 3AZEA 3R9AA 2JGTA 5B31B 3LVKA 1LW4A 5B1MC 5AVCD 3EZSA 1P3FA 1JFIA 3F9TA 4WYAA 5C3IC 1KKJA 2Z61A 3FZ6A 4ZSYA 4WXFA 1MDXA 5GXQA 4GRXA 3AEOA 1C7NA 4XZQA 1O4SA 3WGBA 1P3BC 3FVXA 2V0YA 3O62B 3RCHA 3AYWB 4ZLVA 1HQ3D 3AZHD 4QGRA 2BYKB 1ZLAC 3EI5A 3LVMA 5B0YC 3B1EA 4KUDD 3AZNA 2F8JA 3E9KA 2DKJA 2FN6A 3GSBA 1MAPA 1ID3A 4BQ0A 2FJ7D 3AV2B 4ZUXD 3W97D 3NQUB 3N4SA 1N2TA 2YHKA 2FNIA 3LZ1C 1J32A 4W5KA 3WCOA 1SZSA 3UTAA 3EZ1A 3HLMA 3PDXA 2CB1A 4H9PA 3MC6A 2C44A 5CP6B 2Y2LA 5F8VA 4M6BA 3PDBA 2E7IA 1S08A 4JEYA 3KSYA 1S32A 4R8PA 3I4JA 3AFAB 3DC1A 1AMAA 2F8NK 5CP6D 4J8VB 5F99C 4WU9B 1S0AA 4WYCA 5I92A 5M49A 3B0CW 3C1CC 3UE8A 4JJNA 4K2MA 4WB0B 3VH5W 4QLCD 1F66B 1WKHA 3BWNA 3LY1A 3LV2A 3AEJC 1B9HA 3NQJA 4WZSB 3AFAD 1MLYA 3N5MA 4ZM4A 3LELB 1KKPA 2W7DA 3X1UB 5CPIC 2AY7A 2VMWA 4RLGA 1UU2A 3EPLA 3REIB 1F66D 2BI9A 4R5FA 1JS6A 1P3AC 4RITA 5B33D 5D5SA 3LELD 3VK4A 3AOWA 3X1UD 2ZY4A 2XBNA 3F0HA 3AZFA 3MGRB 1ID3B 2HOXA 1KL2A 3FQ8A 2VMSA 3WAAB 2Z9WA 5GSUA 4XK1A 1AJRA 3IHJA 2DGLA 5G09A 2YRIA 5AVBC 1EQZB 1VP4A 3B6GB 2BI5A 2Y2MA 4RKCA 4H9PB 3B46A 3H7FA 3HVYA 3TU4A 1W3UA 4NOGA 4J8WD 2VMPA 2VI8A 3WX9A 3V9RB 1TPLA 1AKBA 4EO5B 3B6GD 4JF1A 4H9OB 3JWAA 1KX4D 4LD9C 3BCXA 1BQDA 4J8XA 4HVKA 3MVDB 1AHFA 3VK3A 2PYOD 4XEWA 4Q31A 3W99A 3AZGD 1ASLA 1SZUA 3NQJB 3W98C 1D7VA 3X1SA 1P3KA 2R2NA 1IAXA 4H9RB 1GC3A 3DXWA 5B0ZC 3KWQA 2GMSA 5B1MD 3RELA 4Y0IA 3NDNA 4IYOA 3UT9B 3MAUA 3REKC 3C1BA 3AENA 4U1TA 5BJ3A 1P3BD 1N1JB 4CBRA 3RBFA 2D65A 1UKJA 3AZIC 2DQNC 1ZLAD 5B0YD 4W8IA 2AEUA 5B1LA 1P3MA 4KGCC 1M0QA 1MLZA 1ASBA 2CY8A 2D7ZA 3LZ1B 5AV6C 1R4VA 2D61A 3X1TC 3A6NA 2E7UA 2F8NA 1M19A 4IY7A 3LZ0A 3AZLB 2R0TA 3G7QA 4MY5A 1GEYA 4MQRA 4A00A 3LZ1D 1QGNA 2VMOA 3HT4A 4CBSA 1GD9A 5B2IC 5F99B 1SZKA 1W7NA 3GBXA 4UHNA 3C1CB 3VH6T 3WA9C 1WWIA 4YM6C 5EQCA 2TPLA 5JA4A 3MGPB 3QI6A 3AL0C 5F99D 3FVSA 1P3KB 3C1CD 2QA3A 4XUJC 5GT3B 3DU4A 4WBTA 1AY5A 5EUDA 3MGSB 3AEMA 1P3AB 1ELUA 4IYOB 2AY8A 3MNNA 4J8UB 2C0RA 5CPID 5DNMA 5AY8C 1RV4A 1CJ0A 2Y2NA 1P3AD 4OTLA 1ORDA 4X23B 5B1LB 1AKAA 1P3MB 2OATA 4CAYA 1PMMA 5DX5A 3WKJA 5E5AC 5AV5C 3UWCA 3DYDA 5AVBB 4EB5A 3BN1A 3AV7A 3FZ7A 2VMNA 1M19B 3DR7A 3WY7A 2ZSMA 2R5EA 2HUIA 1DKAA 3GR9A 3WTPC 5AVBD 4IXSA 3W1HA 2DGMA 3UTBB 1C0NA 1OXOA 1WSTA 1GC0A 2HIOA 1BJWA 4W1XA 2BI2A 3RI6A 2YFWB 3OKSA 2FM1A 2AROC 1G7WA 3AZMA 5JA4B 2C81A 3KUYB 2FYFA 4Z5TC 3CQ6A 1V72A 4LD9D 3MBBA 4MSOA 3N0LA 2Y2KA 3B6FB 1E5EA 3R45A 5CPKA 3REKB 3W98D 2BIAA 4IW7A 3FVUA 5B0ZD 1AJSA 1WYVB 5DNMB 1AOIC 5DNNC 4FL0A 1BJ4A 3ZRQA 1IX6A 1H0CA 2AY3A 1YNUA 4IX8A 4KGCB 5CPJA 3II0A 3AZKC 3REKD 5B32C 3DZZA 3HMUA 2HZPA 2YKUA 1AMSA 2Y2HA 3X1TB 2HP1A 4DGTA 3IP4C 4UPKA 3AZID 1ECXA 1BQAA 2UWXA 4UUZA 1TOEA 4KGCD 5DJ9A 5AV6D 3BV0A 2NZDC 4WNNB 5BS7C 1IUGA 3LWSA 4DQYB 4E3QA 2VMRA 3O62C 3AYWC 1IJIA 3HQTA 5KTBA 1Z2CB 2D64A 3N4RA 5B2ID 2W8TA 3T32A 2DGKA 1ASEA 3NX3A 3AV2C 5BNXA 3LJAB 3WA9D 1ASAA 4YM6D 4H9NA 5IWQA 4WYEA 1LK9A 3E2ZA 2ORDA 1QIRA 3PAAA 4XUJD 1P3PC 4ISYA 4M2MA 1BKGA 2OQXA 4CSRA 1SVVA 3ACZA 4ADEA 1KX3B 1ARGA 1X29A 4NE5A 1ARTA 5AV5B 5AY8D 3E2YA 1BFMA 4M2JA 2JJFA 4J8VC 4Z2MG 2NQBA 2BIEA 2VMZA 4WU9C 1KX5B 5FUGB 5E5AD 5AV5D 4YS3B 3HBXA 1V2FA 3WKSA 3REIC 5AX8A 4ADDA 3EIAA 1HQ3A 5B40A 3WTPD 4ATQA 4Q76A 4KUDA 4IXOA 3AZNC 2W7FA 3N4XA 1Z3ZA 4Z5TB 3NU8A 4XJPA 2FJ7A 3MGRC 1ID3C 3PD6B 4ZUXA 3KXBA 3W97A 4WV4B 3WAAC 5AV8B 2AROD 4PFNA 3DRDA 3COGA 1M18B 4A0RA 1EJIA 5M4DA 1S06A 4Z5TD 1P3GB 1EQZC 2W7IA 1I29A 1AOIB 3X1VB 1D7UA 3MC6C 1CS1A 3ASAA 2EYQA 3P1TA 2Z9UA 1P3OD 3AZKB 2G5IC 1U35A 2YCPA 4H51A 1M4NA 3A9XA 1P3LA 1AOID 5DNND 1X28A 4ADBA 4CXQA 3VP6A 2NQBB 2ZY3A 3AZKD 5CHLB 5B32D 4OC9A 2VMTA 2NZDB 4QLCA 4AOAA 2G7JA 3MVDC 2F8NG 3BWNC 5TF5A 3BB8A 2DF4C 2Y2GA 5B31D 4ZAHA 3WKRA 4OCAA 1TOIA 1SF2A 2NZDD 3DR4A 2D5YA 1BJOB 4OT8A 4PIWA 3E6GA 3UT9C 5B33A 1B6WA 4ZWMA 3O62D 1QITA 2J8PA 3AYWD 3ZZKA 3FKDA 1AHEA 2JE5A 4H9SA 3KXBB 4KHAA 2D7YA 1M0PA 2YKXA 1M1AA 3L8AA 2W7MA 3FDDA 3AV2D 1H3OB 1J04A 1GCKA 1P3PB 2WKAA 3AZLC 4WXBA 2VMVA 4DBCA 2EGYA 3JWBA 1I41A 4UOYA 5J8QA 1RV3A 1U35B 1P3IA 3NU7A 2YKYA 4BA5A 3QHXA 2BYMA 3BWOA 1A7WA 1OATA 5BNVA 1P3PD 1TOJA 5AV9B 4F5FA 3AZEB 1KX4A 2BYJA 4ATPA 1AX4A 2AY1A 3NNKA 4P7YA 4AZKA 1QJ5A 1P3FB 2Y2JA 1JFIB 4J8XC 3MGPC 2PYOA 4ITXA 1E5FA 1CL2A 3AZGA 4J8VD 3AV1A 5GXQB 1WYUA 4WU9D 4XZQB 3X1SC 1P3KC 2CJHA 5B1MA 4F5GA 3KWQC 3ECDA 5GT3C 3RCHB 3MGSC 3VK2A 5G2QA 3VH6A 4WXGA 1BJNA 4B9BA 3KKIA 3AZNB 4J8UC 1P3BA 4MKKA 3REID 1DGDA 1LC7A 4N0WA 3FCRA 5G49A 2W7KA 1M32A 3H0RC 2PB2A 2Z20A 4X23C 5B1LC 1P3MC 2FQ6A 3AZND 3F6TA 1M1AB 3MGRD 1ID3D 2W7JA 3UTAB 3A6NC 1O69A 1M19C 4F5HA 3WAAD 1CQ8A 4XJOA 1AHGA 3E2FA 1Q9CA 3PDBB 4E45A 1I43A 1IX8A 2DR1A 1S32B 4J8LA 1P3IB 1EQZD 4R8PB 4UQVA 2VYCA 3REJA 1T3IA 3UTBC 1YOOA 3A1KA 1MGVA 3P5JB 4NE3A 3P6KA 4LW2A 3B1DA 5B2JA 1AY8A 4JJNB 4F5KA 3PPLA 1YIZA 3GWPA 1WYTA 4AO4A 5G0AA 3KUYC 1Y4IA 4M2KA 5M4BA 2ZY2A 2XD1A 4HGAB 1IVRA 1WYUB 5BO0A 3B0CT 1ASCA 1YJSA 2AY5A 3AEJA 3MVDD 3VH5T 2CV5A 1YJZA 3B6FC 4F4EA 4CXRA 5HXXA 5HDMA 3AN2A 2A1VA 1X2AA 1B67A 5CPIA 3MNNC 2XH1A 2QB3A 1EQBA 3VOMA 5DNMC 1TATA 3TATA 3AZFB 2VGWA 3QBOA 2Y2OA 4LNJA 5FT8A 1UU1A 1C4KA 3UT9D 3QN6A 1G4VA 2HORA 5GSUB 1M6SA 3H0LC 3MGQA 4F5JA 4WLHA 4R8DA 4BMKA 2Z1YA 4F5LA 4WLJA 3TU4B 4WYDA 2D66A 1TASA 3TQXA 5JRGA 4LNLA 2HUUA 4Y0HA 3AZLD 2W8UA 3G8MA 1VJOA 3D6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GE7 A;  4DGT A;  3GZD C;  1G4X A;  1ZOB A;  3GZC A;  5DB5 A;  1ECX A;  1IBJ A;  1BQA A;  1W7M A;  2PB0 A;  4WYG A;  2QBT A;  1D7S A;  3A9Z A;  1TOE A;  3EI6 A;  4U2H A;  3RQ1 A;  3WGC A;  1S09 A;  2YKV A;  3FQ7 A;  3HL2 A;  3BC8 A;  2W7E A;  5DJ9 A;  3PIU A;  1KMK A;  3BV0 A;  1AHY A;  2BI3 A;  3KE3 A;  4F5I A;  5BJ4 A;  1VEF A;  1IUG A;  3LWS A;  1GC4 A;  5EUN A;  1AIB A;  1JS3 A;  3BS8 A;  4E3Q A;  5EAV A;  3Q8N A;  3KGX A;  3FFH A;  5G4I A;  3R4T A;  2VMY A;  3FQA A;  3ASB A;  4BHD A;  2ZSL A;  1OXP A;  3CBF A;  3MKJ A;  2VMR A;  2R5C A;  3JW9 A;  2VI9 A;  3BCB A;  1IJI A;  3HQT A;  1N31 A;  2GSA A;  2VLH A;  1BW0 A;  1LKC A;  2HOZ A;  3ZZJ A;  1MAQ A;  3AEN B;  5F9S A;  2BHX A;  1Z7D A;  2ZJG A;  3R9A A;  3PA9 A;  2JGT A;  3LVK A;  2D64 A;  1LW4 A;  4W91 A;  1ASD A;  2VMQ A;  3K28 A;  2W8T A;  3EZS A;  3T32 A;  4BA4 A;  2PO3 A;  3F9T A;  4UHM A;  4WYA A;  1KKJ A;  1ASE A;  2Z61 A;  3NX3 A;  2GMU A;  4ZSY A;  4WXF A;  2W7H A;  4CVQ A;  1ASA A;  1MDO A;  1MDX A;  4GRX A;  1FC4 A;  5FT4 A;  2VMU A;  3AEO A;  2YCT A;  3E77 A;  3QPG A;  1C7N A;  4WYE A;  1O4S A;  3WGB A;  5IWQ A;  2YRR A;  1O62 A;  2BWO A;  3ISL A;  3FVX A;  2V0Y A;  1LK9 A;  1UU0 A;  1OHV A;  3E2Z A;  3RCH A;  4ZLV A;  3MAF A;  5EAA A;  2ORD A;  1QIR A;  4QGR A;  2C7T A;  3A2B A;  3PAA A;  2DOU A;  3EI5 A;  3LVM A;  2E54 A;  4ISY A;  3B1E A;  1EG5 A;  1C9C A;  4M2M A;  2F8J A;  3E9K A;  3AOV A;  1BKG A;  2OQX A;  5D95 A;  1M0N A;  2DKJ A;  1B8G A;  2FN6 A;  3GSB A;  1SVV A;  1MAP A;  3ACZ A;  4ADE A;  4BQ0 A;  3WZF A;  1ARG A;  1W23 A;  1X29 A;  3AEM C;  1ART A;  1TOG A;  5EIG A;  1D7R A;  3E2Y A;  3MEB A;  4M2J A;  1DJE A;  2JJF A;  1AAM A;  2HOY A;  1G7X A;  3K40 A;  1N2T A;  2YHK A;  3NYS A;  2WK9 A;  2FNI A;  2BIE A;  2VGV A;  4Q6R A;  2VMZ A;  3FSL A;  1J32 A;  2W7G A;  4W5K A;  4E1O A;  1SZS A;  2JJE A;  3EZ1 A;  5K8B A;  1DFO A;  4EFF A;  3HLM A;  2EZ2 A;  1BT4 A;  2CB1 A;  3PDX A;  3MC6 A;  2C44 A;  1P3W A;  5F8V A;  1AKC A;  3PDB A;  1PG8 A;  2E7I A;  1S08 A;  3CAI A;  4JEY A;  4ZWV A;  1V2F A;  4JF0 A;  3WKS A;  4PFF A;  5AX8 A;  4ADD A;  3EIA A;  3I4J A;  4JEX A;  3DC1 A;  4GDY A;  1RVY A;  1AMA A;  3M5U A;  4ATQ A;  4Q76 A;  1PFF A;  4W1V A;  1FG7 A;  4AO9 A;  3EUC A;  2E7J A;  1ELQ A;  1S0A A;  2AY4 A;  4WYC A;  4IXO A;  5I92 A;  1CQ6 A;  3UE8 A;  5M49 A;  2W7F A;  4K2M A;  4WB0 B;  1WKH A;  1Z3Z A;  3LY1 A;  3BWN A;  3B8X A;  3LV2 A;  3AEJ C;  1B9H A;  3NU8 A;  4P3M A;  4XJP A;  1KL1 A;  3TFU A;  3PD6 B;  1M0O A;  4KXK A;  1MLY A;  3N75 A;  3N5M A;  4ZM4 A;  1KKP A;  1ASG A;  1ARS A;  2W7D A;  4PFN A;  2AY7 A;  2VMW A;  3DRD A;  1UU2 A;  3COG A;  4GEB A;  1TOK A;  4A0R A;  5FT5 A;  1B5O A;  1EJI A;  5M4D A;  1S06 A;  2BI9 A;  2VGU A;  1WYT B;  2EO5 A;  2CTZ A;  1D2F A;  2ZC0 A;  4R5F A;  2W7I A;  1I29 A;  2V1P A;  1JS6 A;  4JEZ A;  2JJH A;  4L0O A;  2FNU A;  1D7U A;  4ITG A;  5D5S A;  2W8J A;  1CS1 A;  1DTY A;  3MC6 C;  4GE9 A;  3TFT A;  3VK4 A;  3ASA A;  3AOW A;  1QZ9 A;  3P1T A;  1DGE A;  2ZY4 A;  2XBN A;  2Z9U A;  4FFC A;  2YCP A;  3F0H A;  4H51 A;  3ZRP A;  3A9Y A;  1M4N A;  3A9X A;  1CL1 A;  2HOX A;  4EU1 A;  2QB2 A;  2GQN A;  2Z1Z A;  1KL2 A;  3FQ8 A;  1GEX A;  2BIG A;  2VMS A;  1X28 A;  2JJG A;  2VGS A;  2Z9W A;  4XK1 A;  4ADB A;  3TCM A;  4CXQ A;  2VGZ A;  1AJR A;  1LC8 A;  3IHJ A;  2CH1 A;  5E4Z A;  2YOB A;  2ZY3 A;  2Q7W A;  4JEW A;  5G09 A;  2YRI A;  4OC9 A;  2VMT A;  1VP4 A;  4J5U A;  2BI5 A;  4MKJ A;  4AOA A;  3LVJ A;  3BWN C;  4MQQ A;  4RKC A;  3BCA A;  3B46 A;  3H7F A;  8AAT A;  1W3U A;  4NOG A;  5TF5 A;  1OHY A;  3BB8 A;  1WYV A;  9AAT A;  2AAT A;  1AIA A;  5HHY A;  1CZC A;  2VMP A;  5C6U A;  4ZAH A;  4W1W A;  2VI8 A;  3WKR A;  4OCA A;  3WX9 A;  1TOI A;  1SF2 A;  1V2D A;  1TPL A;  3NUB A;  1AKB A;  1B9I A;  3DR4 A;  4JF1 A;  2D5Y A;  1CZE A;  4ZSW A;  1BJO B;  4OT8 A;  4PIW A;  1QIS A;  3EI8 A;  4EB7 A;  3L44 A;  1AJS B;  3E6G A;  3JWA A;  5EUE A;  3RUY A;  3QM2 A;  4ZWM A;  3BCX A;  3DOD A;  4GSA A;  1BQD A;  4LC3 A;  4HVK A;  4TMR A;  2BKW A;  1AHF A;  1QIT A;  1YAA A;  3VK3 A;  3ZZK A;  4AH3 A;  4XEW A;  2AY2 A;  3NUI A;  1BS0 A;  3FKD A;  4Q31 A;  4A72 A;  1AHE A;  1ASL A;  1SZU A;  1IAY A;  1D7V A;  2D7Y A;  2WK8 A;  2R2N A;  4ADC A;  1IAX A;  1M0P A;  4LNM A;  1GC3 A;  2YKX A;  3DXW A;  1GEW A;  2GMS A;  1RVU A;  3MAD A;  3L8A A;  3NRA A;  2VMX A;  3B1C A;  3ELP A;  4A6R A;  2W7M A;  1ARI A;  4Y0I A;  3FDD A;  3DXV A;  3NDN A;  2BWP A;  1GCK A;  1J04 A;  1OHW A;  2BWN A;  2W8W A;  1H1C A;  4IYO A;  1ZOD A;  7AAT A;  2WKA A;  4WXB A;  2VMV A;  2AY9 A;  3MAU A;  3LG0 A;  4DBC A;  1AAW A;  2EGY A;  3AEN A;  4U1T A;  3JWB A;  1I41 A;  5BJ3 A;  2QLR A;  1W7L A;  4UOY A;  4CBR A;  5J8Q A;  3RBF A;  1U08 A;  1JG8 A;  1RV3 A;  2D65 A;  1UKJ A;  1I48 A;  1GBN A;  3NU7 A;  4F5M A;  2EPJ A;  2YKY A;  4BA5 A;  3QHX A;  2R5C B;  2OGE A;  4RKD A;  3BWO A;  1OAT A;  3FDB A;  4W8I A;  5FT6 A;  1TOJ A;  1M0Q A;  3ZRR A;  1MLZ A;  1ASB A;  4F5F A;  2CY8 A;  2D7Z A;  2BYJ A;  2D61 A;  1FG3 A;  4Q75 A;  4ATP A;  2E7U A;  1AX4 A;  2AY1 A;  3NNK A;  4P7Y A;  1V2E A;  4IY7 A;  5DJ1 A;  3UAK A;  4AZK A;  1QJ5 A;  5JAY A;  3JTX A;  2R0T A;  3G7Q A;  4MY5 A;  4ITX A;  1E5F A;  1AIC A;  1CL2 A;  3PGY A;  1GEY A;  4MQR A;  4K2I A;  4RJY A;  2QMA A;  4A0G A;  2VIA A;  4A00 A;  3FFR A;  1WYU A;  2W7L A;  2CJH A;  1QGN A;  2VMO A;  4E77 A;  4ZDO A;  4IXZ A;  1O61 A;  1SPA A;  3ECD A;  2O7C A;  1KMJ A;  4EMY A;  3E2Z B;  4F5G A;  3RCH B;  2HP2 A;  3MAF B;  3FRK A;  2ZY5 A;  2WK7 A;  4MQP A;  5G2Q A;  3VK2 A;  4A0H A;  3USF A;  4CBS A;  2X5F A;  2O1B A;  1BJN A;  4WXG A;  1GD9 A;  1XI9 A;  1SZK A;  1W7N A;  2VIB A;  3GBX A;  5EFS A;  4B9B A;  4UHN A;  2VLF A;  3KKI A;  2Z9X A;  3AEL A;  3PJ0 A;  3VAX A;  4UHO A;  3EIB A;  4MKK A;  1CQ7 A;  5EQC A;  4PVF A;  1DGD A;  2TPL A;  4A6T A;  1LC7 A;  4N0W A;  2YCN A;  2CFB A;  3QI6 A;  3FCR A;  5EIG B;  2W7K A;  4R5Z A;  4ZDP A;  1M32 A;  2PB2 A;  2Z20 A;  2RFV A;  3EI7 A;  3FVS A;  3NYU A;  3A8U X;  2FQ6 A;  2QA3 A;  2CAN A;  3F6T A;  3DU4 A;  4WBT A;  1AY4 A;  1AY5 A;  5EUD A;  2HUF A;  3WLX A;  5M46 A;  2W7J A;  3AEM A;  1ELU A;  2AY6 A;  4TN4 A;  4IYO B;  1O69 A;  2AY8 A;  2O0R A;  3EI9 A;  4F5H A;  2C0R A;  1CQ8 A;  4XJO A;  1AHG A;  1C7G A;  3E2F A;  1RV4 A;  3PDB B;  3ATH A;  1CJ0 A;  2OGA A;  1I43 A;  1N8P A;  1IX8 A;  2DR1 A;  4RAE A;  4XJM A;  1DJU A;  4UQV A;  2VYC A;  4WB0 A;  4XQ2 A;  4O6Z A;  4LW4 A;  4WP0 A;  4OTL A;  1ORD A;  1T3I A;  2CIN A;  2DKB A;  2ZYJ A;  1AKA A;  3PD6 A;  1YOO A;  3CQ4 A;  2OAT A;  1MGV A;  5DX5 A;  4ZAS A;  3P6K A;  3UWC A;  4LW2 A;  4ZM3 A;  3DYD A;  3B1D A;  2ZUK A;  1LC5 A;  1AY8 A;  3BN1 A;  4XAU A;  4EB5 A;  1YIY A;  1TAR A;  4F5K A;  3AV7 A;  3PPL A;  1YIZ A;  4KAM A;  2VMN A;  3GJU A;  3DR7 A;  3WY7 A;  1LW5 A;  1WYT A;  1X0M A;  4AO4 A;  5G0A A;  2ZSM A;  1Y4I A;  4M2K A;  2R5E A;  1ASF A;  5M4B A;  2HUI A;  1DKA A;  2ZY2 A;  3GR9 A;  1AMQ A;  1JF9 A;  4Y0D A;  1IVR A;  1WYU B;  1IX7 A;  1WKG A;  4IXS A;  1ASC A;  1YJS A;  4A6U A;  2AY5 A;  3HDO A;  4GE4 A;  4OMA A;  3AEJ A;  2CST A;  2EH6 A;  1YJZ A;  2JG2 A;  3K7Y A;  2W8V A;  4F4E A;  5E3K A;  1DJ9 A;  4CXR A;  1C0N A;  1OXO A;  1QJ3 A;  3GZD A;  1C7O A;  5HDM A;  5HXX A;  1X2A A;  1WST A;  1GC0 A;  4R2N A;  2G6W A;  2XH1 A;  2NMP A;  1EQB A;  1BJW A;  1S07 A;  2CJG A;  2QB3 A;  3VOM A;  1YJY A;  4W1X A;  2BI2 A;  3RI6 A;  1TAT A;  3OKS A;  3TAT A;  2FM1 A;  1ZC9 A;  1G7W A;  2VGW A;  3ELE A;  3QBO A;  4ZDL A;  1ASN A;  2C81 A;  2ZP7 A;  3KGW A;  4LNJ A;  5FT8 A;  1UU1 A;  1C4K A;  2X5D A;  2FYF A;  4XJL A;  4WYF A;  1B4X A;  1AMR A;  3CQ6 A;  3QN6 A;  1G4V A;  2HOR A;  1V72 A;  1GDE A;  1M6S A;  1SFF A;  3MBB A;  4MSO A;  2EZ1 A;  3FTB A;  3I5T A;  3N0L A;  4JEV A;  4AZJ A;  4E3R A;  4F5J A;  3CQ5 A;  3AAT A;  4B98 A;  4WLH A;  4OYT A;  2D63 A;  5G4J A;  1B5P A;  1M7Y A;  4R8D A;  1E5E A;  4BMK A;  2Z1Y A;  4F5L A;  1GC2 A;  1AHX A;  2BIA A;  4IW7 A;  1MDZ A;  3NYT A;  2VGT A;  1BJO A;  3FVU A;  4WLJ A;  5G2P A;  3NTJ A;  4KYO A;  1LS3 A;  4WYD A;  3LVL B;  1AJS A;  1WYV B;  2Z9V A;  1ARH A;  2BI1 A;  4DQ6 A;  2D66 A;  4K2B A;  4FL0 A;  1BJ4 A;  1TAS A;  3TQX A;  3OP7 A;  3ZRQ A;  1IX6 A;  1H0C A;  2AY3 A;  1YNU A;  1ASM A;  2CH2 A;  2X8U A;  3GET A;  4LNL A;  2HUU A;  3QGU A;  4IX8 A;  4Y0H A;  5E5I A;  3II0 A;  4WD2 A;  2W8U A;  3AEP A;  3G8M A;  3HMU A;  2BYL A;  3DZZ A;  1VJO A;  4HF8 A;  4I8A A;  2HZP A;  2CJD A;  3D6K A;  2GB3 A;  2YKU A;  1AMS A;  4A0F A;  3RBL A;  2HP1 A; 
#chains in the Genus database with same CATH topology
 5GT0 A;  1ZOB A;  4J8X B;  2QBT A;  2YKV A;  3W96 A;  4G92 B;  3W99 B;  1KMK A;  3KE3 A;  1AHY A;  5BJ4 A;  3X1S B;  4F5I A;  1VEF A;  4LD9 A;  1GC4 A;  5EUN A;  3LJA C;  1PMO A;  3KWQ B;  3REL B;  4J8X D;  3ASB A;  3MGP D;  3CBF A;  2CV5 B;  2R5C A;  3W98 A;  1TAF A;  3C1B B;  3X1S D;  1P3K D;  2GSA A;  2VLH A;  2KFP A;  5B0Z A;  1MAQ A;  3AEN B;  3KWQ D;  5GT3 D;  3MGS D;  1ASD A;  3K28 A;  4UHM A;  1KX3 C;  5CPJ C;  4J8U D;  2W7H A;  4CVQ A;  1MDO A;  2VMU A;  2YCT A;  3A6N B;  2F8N B;  2YRR A;  3AZI A;  3ISL A;  1UU0 A;  3LZ0 B;  2RVQ C;  3H9X A;  3MAF A;  1KX5 C;  4X23 D;  5B1L D;  4OBU A;  1P3M D;  3A2B A;  2FFF B;  4E44 A;  4WJ3 C;  5AV6 A;  2E54 A;  1C9C A;  4YS3 C;  1M0N A;  3A6N D;  1B8G A;  5JRG B;  1M19 D;  1F1E A;  3WZF A;  1TOG A;  5EIG A;  1D7R A;  4Z2M H;  1DJE A;  2HOY A;  5GT0 B;  2VGV A;  3FSL A;  1BH8 A;  3UTB D;  4E1O A;  5K8B A;  1DFO A;  5B2I A;  1BT4 A;  3N7N A;  4Z66 A;  5B24 A;  2Y2P A;  1PZR A;  1AKC A;  4YM6 A;  3CAI A;  5AV8 C;  4ZWV A;  4JF0 A;  3KUY D;  1M18 C;  4PFF A;  4DRA A;  3MNN B;  1P3G C;  1TAF B;  1RVY A;  3WCN A;  4W1V A;  4XUJ A;  2L5A A;  1FG7 A;  3X1V C;  4AO9 A;  3EUC A;  2AY4 A;  3B6F D;  3FD0 A;  4P3M A;  1KL1 A;  1M0O A;  3MNN D;  4CAY B;  5AY8 A;  3WKJ B;  3N75 A;  5DNM D;  5KDM A;  4GEB A;  1TOK A;  5FT5 A;  2NQB C;  2EO5 A;  2CTZ A;  2ZC0 A;  5E5A A;  2JJH A;  2FNU A;  3X1T D;  2JIS A;  4WU8 A;  1QZ9 A;  3ZRP A;  1WWS A;  3A9Y A;  4EU1 A;  2Z1Z A;  1P34 A;  2BIG A;  2VGS A;  2HIO B;  3TCM A;  5B40 C;  2VGZ A;  1LC8 A;  3AZJ A;  2F8N H;  2OKJ A;  4JEW A;  2Q7W A;  3AZM B;  1BH8 B;  4J5U A;  4MKJ A;  4MQQ A;  3REH A;  2FJ7 C;  8AAT A;  3KXB C;  1AIA A;  5HHY A;  3W97 C;  2ARO A;  5C6U A;  1V2D A;  3NUB A;  3R45 B;  5CPK B;  4ZSW A;  3LJA D;  3EI8 A;  4EB7 A;  1AJS B;  2FKI A;  3H0M C;  3B0D C;  1P3O A;  4LC3 A;  5CPJ B;  4TMR A;  2BKW A;  1U35 C;  4AH3 A;  2AY2 A;  4A72 A;  1TZY A;  5DNN A;  1P3L C;  2WK8 A;  4LNM A;  5AV9 C;  1RVU A;  3MAD A;  3AZE C;  3NRA A;  5BT1 C;  3ELP A;  4A6R A;  4UUZ B;  3FZ8 A;  1KX3 D;  3DXV A;  5CPJ D;  5B32 A;  5AVC A;  2BWP A;  1OHW A;  2W8W A;  1H1C A;  1P3F C;  2AY9 A;  4OBV A;  4H9Q A;  3LG0 A;  4WU8 B;  5GXQ C;  2RVQ D;  5B31 A;  4XZQ C;  1GBN A;  1KX5 D;  4F5M A;  2EPJ A;  2OGE A;  3G0T A;  4RKD A;  3AZH A;  5BS7 A;  1P34 B;  3ZRR A;  4YS3 D;  3AZJ B;  4RM1 A;  1FG3 A;  1V2E A;  5JAY A;  3UAK A;  3O62 A;  1AIC A;  5BNX B;  3REH B;  2BYK A;  2VIA A;  4DRB A;  4H9N B;  4E77 A;  1O61 A;  1SPA A;  1M1A C;  2O7C A;  4EMY A;  3E2Z B;  2ZM5 A;  3FRK A;  2ZY5 A;  4MQP A;  3AV2 A;  3USF A;  3UTA C;  2O1B A;  1XI9 A;  2VIB A;  5EFS A;  3NQU A;  2VLF A;  5AV8 D;  3AEL A;  3PJ0 A;  4UHO A;  4CSR B;  1M18 D;  1CQ7 A;  4A6T A;  2YCN A;  2CFB A;  1P3G D;  1S32 C;  1P3I C;  3EPK A;  4R8P C;  4R5Z A;  3X1V D;  4ZBJ C;  5CP6 A;  2Y2I A;  2CAN A;  5M46 A;  4JJN C;  1ULY A;  2AY6 A;  4TN4 A;  3EI9 A;  4NFT A;  3AFA A;  2CWE A;  4J8V A;  3AV1 C;  4WU9 A;  2NQB D;  4HGA C;  4WB0 A;  1F66 A;  4O6Z A;  4WP0 A;  1HQ3 B;  2ZYJ A;  5B40 B;  3AZH B;  2DKB A;  3WTP E;  4ZAS A;  3LEL A;  4ZM3 A;  4KUD B;  2ZUK A;  3X1U A;  1TAR A;  4KAM A;  3REI A;  3GJU A;  3AZF C;  2FJ7 B;  1LW5 A;  2OKK A;  1X0M A;  5B40 D;  4ZUX B;  3W97 B;  3VH5 A;  5GSU C;  4A6U A;  3HDO A;  4OMA A;  3MGR A;  2EH6 A;  2JG2 A;  3K7Y A;  5E3K A;  3GZD A;  3KXB D;  3WAA A;  3B0D B;  3TU4 C;  2NMP A;  1YJY A;  4J8W A;  4K05 A;  1HTA A;  1ASN A;  1EQZ A;  3B6G A;  1P3L B;  4XJL A;  4WYF A;  1B4X A;  2WB6 A;  1AMR A;  1GDE A;  3REJ C;  1SFF A;  2EZ1 A;  4JEV A;  4E3R A;  3AAT A;  4B98 A;  1U35 D;  4OYT A;  2D63 A;  5G4J A;  5B2J C;  3V9R A;  1M7Y A;  4QLC B;  1GC2 A;  1AHX A;  1MDZ A;  1P3L D;  3NYT A;  2VGT A;  4H9O A;  5AV9 D;  4G92 C;  3NTJ A;  3W99 C;  1LS3 A;  2VQR A;  3AZE D;  5BT1 D;  1ARH A;  4DQ6 A;  1ASM A;  2X8U A;  3QGU A;  1KAF A;  1P3F D;  3MVD A;  3REL C;  4I8A A;  2BYL A;  2CV5 C;  2CJD A;  2GB3 A;  5GXQ D;  3RBL A;  5B33 B;  3C1B C;  4XZQ D;  4H9R A;  1BH9 A;  3AN2 C;  1G4X A;  1IBJ A;  1W7M A;  4WYG A;  3WGC A;  3EI6 A;  4U2H A;  3HL2 A;  1ZLA A;  2W7E A;  5B0Y A;  3PIU A;  3UT9 A;  4KHA B;  1AIB A;  3BS8 A;  5EAV A;  3Q8N A;  1N1J A;  5G4I A;  2VMY A;  3MGQ C;  4BHD A;  3LZ0 C;  1LKC A;  3ZZJ A;  3LZ1 A;  1M1A D;  2ZJG A;  3PA9 A;  4J8W B;  2HUE B;  3UTA D;  4W91 A;  2BYM B;  2VMQ A;  4ZBJ B;  5BNV B;  2X3L A;  4BA4 A;  3AZL A;  5JRG C;  2PO3 A;  2GMU A;  3W1J A;  1KX4 B;  1FC4 A;  3VH6 W;  5FT4 A;  3E77 A;  3QPG A;  1S32 D;  1O62 A;  1P3I D;  5GT0 C;  2BWO A;  4R8P D;  1OHV A;  4G91 B;  2PYO B;  5EAA A;  2C7T A;  3AZG B;  3W96 C;  3AV1 B;  5F99 A;  2DOU A;  2F2A C;  1EG5 A;  3C1C A;  2AEV A;  3AOV A;  4JJN D;  5D95 A;  2IO5 C;  5B1M B;  5C3I B;  3MGP A;  1W23 A;  3AEM C;  3MEB A;  4NE6 A;  3AV1 D;  1AAM A;  1G7X A;  3K40 A;  1P3B B;  1BH9 B;  3NYS A;  2WK9 A;  5GT3 A;  4Q6R A;  3MGS A;  2W7G A;  1P3A A;  2JJE A;  5G49 B;  1ZLA B;  4EFF A;  2EZ2 A;  5B0Y B;  2LY8 A;  4J8U A;  3B0B A;  1P3W A;  3WKJ C;  1PG8 A;  3AZF D;  4JEX A;  4X23 A;  4GDY A;  5GSU D;  3M5U A;  1PFF A;  5AVB A;  2E7J A;  1ELQ A;  1CQ6 A;  3B8X A;  3REJ B;  3TFU A;  4KXK A;  3TU4 D;  1KU5 A;  1ASG A;  1ARS A;  2HIO C;  5B2J B;  1B5O A;  2VGU A;  3AZM C;  3UTB A;  1WYT B;  1D2F A;  3REJ D;  2V1P A;  4JEZ A;  4L0O A;  5B32 G;  4ITG A;  4Z66 C;  2W8J A;  1DTY A;  3TFT A;  5B24 C;  4GE9 A;  3EPH A;  5B2J D;  5BO0 B;  1DGE A;  4FFC A;  2YFW A;  2W8S A;  2YFV A;  1CL1 A;  3KUY A;  3W99 D;  2QB2 A;  3I16 A;  2GQN A;  5B31 G;  5CPK C;  1GEX A;  3AN2 B;  2JJG A;  5CPI B;  2CH1 A;  5E4Z A;  3REL D;  2YOB A;  2CV5 D;  3B6F A;  3LVJ A;  3REK A;  3BCA A;  3C1B D;  3AN2 D;  3MGQ B;  1OHY A;  1WYV A;  9AAT A;  2AAT A;  1CZC A;  2Y2Q A;  4W1W A;  4KGC A;  1B9I A;  1CZE A;  1QIS A;  3L44 A;  2BG1 A;  5EUE A;  3X1T A;  3QM2 A;  3RUY A;  3MGQ D;  2F8N D;  3DOD A;  4GSA A;  4WU8 C;  3LZ0 D;  1YAA A;  3NUI A;  1BS0 A;  1IAY A;  4WNN A;  1P34 C;  4ADC A;  1GEW A;  2VMX A;  3B1C A;  3KFU G;  3AZJ C;  5JRG D;  1ARI A;  3W96 B;  7AAT A;  2BWN A;  1ZOD A;  3A1I A;  2XD5 A;  4LD9 B;  2IO5 B;  3WA9 A;  1AAW A;  3REH C;  5GT0 D;  2QLR A;  1W7L A;  2JCH A;  1U08 A;  1JG8 A;  1I48 A;  2YFV B;  2R5C B;  3W96 D;  3W98 B;  3FDB A;  5FT6 A;  5B0Z B;  3LJA A;  4Q75 A;  5DJ1 A;  3JTX A;  1P3O C;  3PGY A;  4RJY A;  4K2I A;  2QMA A;  4A0G A;  4AWL C;  3FFR A;  2W7L A;  1TZY C;  4ZDO A;  3AZI B;  4IXZ A;  1KMJ A;  2HP2 A;  3MAF B;  2WK7 A;  1W2E A;  1KX3 A;  4A0H A;  2X5F A;  5AVC C;  5AV5 A;  2JSS A;  3WKJ D;  5AV6 B;  2Z9X A;  3VAX A;  3EIB A;  4PVF A;  1KX5 A;  5B31 C;  5EIG B;  5FUG A;  4ZDP A;  2G5H C;  3WTP A;  1HQ3 C;  3AZH C;  2RFV A;  3EI7 A;  3NYU A;  4YS3 A;  3A8U X;  4RJ0 A;  1AY4 A;  4KUD C;  2HUF A;  3WLX A;  4RIZ A;  2QSR A;  5B2I B;  2O0R A;  4Z66 B;  5B24 B;  2HIO D;  4ZUX C;  3WA9 B;  1C7G A;  4YM6 B;  3ATH A;  2OGA A;  1N8P A;  2RIQ A;  4RAE A;  4XJM A;  3AZM D;  1DJU A;  4XQ2 A;  3JZL A;  4Z5T A;  4LW4 A;  2CIN A;  4Z66 D;  3PD6 A;  5B24 D;  3CQ4 A;  4XUJ B;  5AV8 A;  1LC5 A;  4XAU A;  1YIY A;  1M18 A;  5CPK D;  1P3G A;  1XEY A;  1ASF A;  5AY8 B;  1AOI A;  3X1V A;  1AMQ A;  1JF9 A;  4Y0D A;  5KDM B;  5CP6 C;  1IX7 A;  1WKG A;  3AZK A;  4GE4 A;  2CST A;  3EG5 B;  2W8V A;  4QLC C;  5E5A B;  1DJ9 A;  3W1I A;  1QJ3 A;  1C7O A;  4R2N A;  2G6W A;  2CJG A;  3AFA C;  1S07 A;  1ZC9 A;  4ZDL A;  3ELE A;  2ZP7 A;  3KGW A;  3EPJ A;  2NZD A;  2X5D A;  1F66 C;  3WTP B;  3FTB A;  3I5T A;  4WU8 D;  4AZJ A;  5B33 C;  3CQ5 A;  3LEL C;  3X1U C;  1B5P A;  3AYW A;  1T3U A;  1P34 D;  1BJO A;  5G2P A;  4KYO A;  3LVL B;  2Z9V A;  4H9S C;  3AZJ D;  2BI1 A;  4K2B A;  2ARO B;  3OP7 A;  2CH2 A;  3GET A;  5E5I A;  4WD2 A;  3AEP A;  4HF8 A;  3REH D;  4A0F A;  4H63 Q;  4GE7 A;  3GZD C;  5DB5 A;  3GZC A;  2PB0 A;  1P3O B;  3RQ1 A;  1D7S A;  3A9Z A;  4J8W C;  1S09 A;  2HUE C;  3FQ7 A;  1H3O A;  4AWL B;  1P3P A;  3BC8 A;  1TZY B;  3B6G C;  2BI3 A;  5DNN B;  1JS3 A;  3KGX A;  3FFH A;  3R4T A;  1KX4 C;  3FQA A;  5AVC B;  5B32 B;  2ZSL A;  1OXP A;  3MKJ A;  3JW9 A;  2VI9 A;  3BCB A;  4G91 C;  4H9Q B;  4EO5 C;  2PYO C;  1TZY D;  1N31 A;  1BW0 A;  2HOZ A;  5F9S A;  5AV9 A;  3AZG C;  2BHX A;  1Z7D A;  3AZE A;  3R9A A;  2JGT A;  5B31 B;  3LVK A;  1LW4 A;  5B1M C;  5AVC D;  3EZS A;  1P3F A;  1JFI A;  3F9T A;  4WYA A;  5C3I C;  1KKJ A;  2Z61 A;  3FZ6 A;  4ZSY A;  4WXF A;  1MDX A;  5GXQ A;  4GRX A;  3AEO A;  1C7N A;  4XZQ A;  1O4S A;  3WGB A;  1P3B C;  3FVX A;  2V0Y A;  3O62 B;  3RCH A;  3AYW B;  4ZLV A;  1HQ3 D;  3AZH D;  4QGR A;  2BYK B;  1ZLA C;  3EI5 A;  3LVM A;  5B0Y C;  3B1E A;  4KUD D;  3AZN A;  2F8J A;  3E9K A;  2DKJ A;  2FN6 A;  3GSB A;  1MAP A;  1ID3 A;  4BQ0 A;  2FJ7 D;  3AV2 B;  4ZUX D;  3W97 D;  3NQU B;  3N4S A;  1N2T A;  2YHK A;  2FNI A;  3LZ1 C;  1J32 A;  4W5K A;  3WCO A;  1SZS A;  3UTA A;  3EZ1 A;  3HLM A;  3PDX A;  2CB1 A;  4H9P A;  3MC6 A;  2C44 A;  5CP6 B;  2Y2L A;  5F8V A;  4M6B A;  3PDB A;  2E7I A;  1S08 A;  4JEY A;  3KSY A;  1S32 A;  4R8P A;  3I4J A;  3AFA B;  3DC1 A;  1AMA A;  2F8N K;  5CP6 D;  4J8V B;  5F99 C;  4WU9 B;  1S0A A;  4WYC A;  5I92 A;  5M49 A;  3B0C W;  3C1C C;  3UE8 A;  4JJN A;  4K2M A;  4WB0 B;  3VH5 W;  4QLC D;  1F66 B;  1WKH A;  3BWN A;  3LY1 A;  3LV2 A;  3AEJ C;  1B9H A;  3NQJ A;  4WZS B;  3AFA D;  1MLY A;  3N5M A;  4ZM4 A;  3LEL B;  1KKP A;  2W7D A;  3X1U B;  5CPI C;  2AY7 A;  2VMW A;  4RLG A;  1UU2 A;  3EPL A;  3REI B;  1F66 D;  2BI9 A;  4R5F A;  1JS6 A;  1P3A C;  4RIT A;  5B33 D;  5D5S A;  3LEL D;  3VK4 A;  3AOW A;  3X1U D;  2ZY4 A;  2XBN A;  3F0H A;  3AZF A;  3MGR B;  1ID3 B;  2HOX A;  1KL2 A;  3FQ8 A;  2VMS A;  3WAA B;  2Z9W A;  5GSU A;  4XK1 A;  1AJR A;  3IHJ A;  2DGL A;  5G09 A;  2YRI A;  5AVB C;  1EQZ B;  1VP4 A;  3B6G B;  2BI5 A;  2Y2M A;  4RKC A;  4H9P B;  3B46 A;  3H7F A;  3HVY A;  3TU4 A;  1W3U A;  4NOG A;  4J8W D;  2VMP A;  2VI8 A;  3WX9 A;  3V9R B;  1TPL A;  1AKB A;  4EO5 B;  3B6G D;  4JF1 A;  4H9O B;  3JWA A;  1KX4 D;  4LD9 C;  3BCX A;  1BQD A;  4J8X A;  4HVK A;  3MVD B;  1AHF A;  3VK3 A;  2PYO D;  4XEW A;  4Q31 A;  3W99 A;  3AZG D;  1ASL A;  1SZU A;  3NQJ B;  3W98 C;  1D7V A;  3X1S A;  1P3K A;  2R2N A;  1IAX A;  4H9R B;  1GC3 A;  3DXW A;  5B0Z C;  3KWQ A;  2GMS A;  5B1M D;  3REL A;  4Y0I A;  3NDN A;  4IYO A;  3UT9 B;  3MAU A;  3REK C;  3C1B A;  3AEN A;  4U1T A;  5BJ3 A;  1P3B D;  1N1J B;  4CBR A;  3RBF A;  2D65 A;  1UKJ A;  3AZI C;  2DQN C;  1ZLA D;  5B0Y D;  4W8I A;  2AEU A;  5B1L A;  1P3M A;  4KGC C;  1M0Q A;  1MLZ A;  1ASB A;  2CY8 A;  2D7Z A;  3LZ1 B;  5AV6 C;  1R4V A;  2D61 A;  3X1T C;  3A6N A;  2E7U A;  2F8N A;  1M19 A;  4IY7 A;  3LZ0 A;  3AZL B;  2R0T A;  3G7Q A;  4MY5 A;  1GEY A;  4MQR A;  4A00 A;  3LZ1 D;  1QGN A;  2VMO A;  3HT4 A;  4CBS A;  1GD9 A;  5B2I C;  5F99 B;  1SZK A;  1W7N A;  3GBX A;  4UHN A;  3C1C B;  3VH6 T;  3WA9 C;  1WWI A;  4YM6 C;  5EQC A;  2TPL A;  5JA4 A;  3MGP B;  3QI6 A;  3AL0 C;  5F99 D;  3FVS A;  1P3K B;  3C1C D;  2QA3 A;  4XUJ C;  5GT3 B;  3DU4 A;  4WBT A;  1AY5 A;  5EUD A;  3MGS B;  3AEM A;  1P3A B;  1ELU A;  4IYO B;  2AY8 A;  3MNN A;  4J8U B;  2C0R A;  5CPI D;  5DNM A;  5AY8 C;  1RV4 A;  1CJ0 A;  2Y2N A;  1P3A D;  4OTL A;  1ORD A;  4X23 B;  5B1L B;  1AKA A;  1P3M B;  2OAT A;  4CAY A;  1PMM A;  5DX5 A;  3WKJ A;  5E5A C;  5AV5 C;  3UWC A;  3DYD A;  5AVB B;  4EB5 A;  3BN1 A;  3AV7 A;  3FZ7 A;  2VMN A;  1M19 B;  3DR7 A;  3WY7 A;  2ZSM A;  2R5E A;  2HUI A;  1DKA A;  3GR9 A;  3WTP C;  5AVB D;  4IXS A;  3W1H A;  2DGM A;  3UTB B;  1C0N A;  1OXO A;  1WST A;  1GC0 A;  2HIO A;  1BJW A;  4W1X A;  2BI2 A;  3RI6 A;  2YFW B;  3OKS A;  2FM1 A;  2ARO C;  1G7W A;  3AZM A;  5JA4 B;  2C81 A;  3KUY B;  2FYF A;  4Z5T C;  3CQ6 A;  1V72 A;  4LD9 D;  3MBB A;  4MSO A;  3N0L A;  2Y2K A;  3B6F B;  1E5E A;  3R45 A;  5CPK A;  3REK B;  3W98 D;  2BIA A;  4IW7 A;  3FVU A;  5B0Z D;  1AJS A;  1WYV B;  5DNM B;  1AOI C;  5DNN C;  4FL0 A;  1BJ4 A;  3ZRQ A;  1IX6 A;  1H0C A;  2AY3 A;  1YNU A;  4IX8 A;  4KGC B;  5CPJ A;  3II0 A;  3AZK C;  3REK D;  5B32 C;  3DZZ A;  3HMU A;  2HZP A;  2YKU A;  1AMS A;  2Y2H A;  3X1T B;  2HP1 A;  4DGT A;  3IP4 C;  4UPK A;  3AZI D;  1ECX A;  1BQA A;  2UWX A;  4UUZ A;  1TOE A;  4KGC D;  5DJ9 A;  5AV6 D;  3BV0 A;  2NZD C;  4WNN B;  5BS7 C;  1IUG A;  3LWS A;  4DQY B;  4E3Q A;  2VMR A;  3O62 C;  3AYW C;  1IJI A;  3HQT A;  5KTB A;  1Z2C B;  2D64 A;  3N4R A;  5B2I D;  2W8T A;  3T32 A;  2DGK A;  1ASE A;  3NX3 A;  3AV2 C;  5BNX A;  3LJA B;  3WA9 D;  1ASA A;  4YM6 D;  4H9N A;  5IWQ A;  4WYE A;  1LK9 A;  3E2Z A;  2ORD A;  1QIR A;  3PAA A;  4XUJ D;  1P3P C;  4ISY A;  4M2M A;  1BKG A;  2OQX A;  4CSR A;  1SVV A;  3ACZ A;  4ADE A;  1KX3 B;  1ARG A;  1X29 A;  4NE5 A;  1ART A;  5AV5 B;  5AY8 D;  3E2Y A;  1BFM A;  4M2J A;  2JJF A;  4J8V C;  4Z2M G;  2NQB A;  2BIE A;  2VMZ A;  4WU9 C;  1KX5 B;  5FUG B;  5E5A D;  5AV5 D;  4YS3 B;  3HBX A;  1V2F A;  3WKS A;  3REI C;  5AX8 A;  4ADD A;  3EIA A;  1HQ3 A;  5B40 A;  3WTP D;  4ATQ A;  4Q76 A;  4KUD A;  4IXO A;  3AZN C;  2W7F A;  3N4X A;  1Z3Z A;  4Z5T B;  3NU8 A;  4XJP A;  2FJ7 A;  3MGR C;  1ID3 C;  3PD6 B;  4ZUX A;  3KXB A;  3W97 A;  4WV4 B;  3WAA C;  5AV8 B;  2ARO D;  4PFN A;  3DRD A;  3COG A;  1M18 B;  4A0R A;  1EJI A;  5M4D A;  1S06 A;  4Z5T D;  1P3G B;  1EQZ C;  2W7I A;  1I29 A;  1AOI B;  3X1V B;  1D7U A;  3MC6 C;  1CS1 A;  3ASA A;  2EYQ A;  3P1T A;  2Z9U A;  1P3O D;  3AZK B;  2G5I C;  1U35 A;  2YCP A;  4H51 A;  1M4N A;  3A9X A;  1P3L A;  1AOI D;  5DNN D;  1X28 A;  4ADB A;  4CXQ A;  3VP6 A;  2NQB B;  2ZY3 A;  3AZK D;  5CHL B;  5B32 D;  4OC9 A;  2VMT A;  2NZD B;  4QLC A;  4AOA A;  2G7J A;  3MVD C;  2F8N G;  3BWN C;  5TF5 A;  3BB8 A;  2DF4 C;  2Y2G A;  5B31 D;  4ZAH A;  3WKR A;  4OCA A;  1TOI A;  1SF2 A;  2NZD D;  3DR4 A;  2D5Y A;  1BJO B;  4OT8 A;  4PIW A;  3E6G A;  3UT9 C;  5B33 A;  1B6W A;  4ZWM A;  3O62 D;  1QIT A;  2J8P A;  3AYW D;  3ZZK A;  3FKD A;  1AHE A;  2JE5 A;  4H9S A;  3KXB B;  4KHA A;  2D7Y A;  1M0P A;  2YKX A;  1M1A A;  3L8A A;  2W7M A;  3FDD A;  3AV2 D;  1H3O B;  1J04 A;  1GCK A;  1P3P B;  2WKA A;  3AZL C;  4WXB A;  2VMV A;  4DBC A;  2EGY A;  3JWB A;  1I41 A;  4UOY A;  5J8Q A;  1RV3 A;  1U35 B;  1P3I A;  3NU7 A;  2YKY A;  4BA5 A;  3QHX A;  2BYM A;  3BWO A;  1A7W A;  1OAT A;  5BNV A;  1P3P D;  1TOJ A;  5AV9 B;  4F5F A;  3AZE B;  1KX4 A;  2BYJ A;  4ATP A;  1AX4 A;  2AY1 A;  3NNK A;  4P7Y A;  4AZK A;  1QJ5 A;  1P3F B;  2Y2J A;  1JFI B;  4J8X C;  3MGP C;  2PYO A;  4ITX A;  1E5F A;  1CL2 A;  3AZG A;  4J8V D;  3AV1 A;  5GXQ B;  1WYU A;  4WU9 D;  4XZQ B;  3X1S C;  1P3K C;  2CJH A;  5B1M A;  4F5G A;  3KWQ C;  3ECD A;  5GT3 C;  3RCH B;  3MGS C;  3VK2 A;  5G2Q A;  3VH6 A;  4WXG A;  1BJN A;  4B9B A;  3KKI A;  3AZN B;  4J8U C;  1P3B A;  4MKK A;  3REI D;  1DGD A;  1LC7 A;  4N0W A;  3FCR A;  5G49 A;  2W7K A;  1M32 A;  3H0R C;  2PB2 A;  2Z20 A;  4X23 C;  5B1L C;  1P3M C;  2FQ6 A;  3AZN D;  3F6T A;  1M1A B;  3MGR D;  1ID3 D;  2W7J A;  3UTA B;  3A6N C;  1O69 A;  1M19 C;  4F5H A;  3WAA D;  1CQ8 A;  4XJO A;  1AHG A;  3E2F A;  1Q9C A;  3PDB B;  4E45 A;  1I43 A;  1IX8 A;  2DR1 A;  1S32 B;  4J8L A;  1P3I B;  1EQZ D;  4R8P B;  4UQV A;  2VYC A;  3REJ A;  1T3I A;  3UTB C;  1YOO A;  3A1K A;  1MGV A;  3P5J B;  4NE3 A;  3P6K A;  4LW2 A;  3B1D A;  5B2J A;  1AY8 A;  4JJN B;  4F5K A;  3PPL A;  1YIZ A;  3GWP A;  1WYT A;  4AO4 A;  5G0A A;  3KUY C;  1Y4I A;  4M2K A;  5M4B A;  2ZY2 A;  2XD1 A;  4HGA B;  1IVR A;  1WYU B;  5BO0 A;  3B0C T;  1ASC A;  1YJS A;  2AY5 A;  3AEJ A;  3MVD D;  3VH5 T;  2CV5 A;  1YJZ A;  3B6F C;  4F4E A;  4CXR A;  5HXX A;  5HDM A;  3AN2 A;  2A1V A;  1X2A A;  1B67 A;  5CPI A;  3MNN C;  2XH1 A;  2QB3 A;  1EQB A;  3VOM A;  5DNM C;  1TAT A;  3TAT A;  3AZF B;  2VGW A;  3QBO A;  2Y2O A;  4LNJ A;  5FT8 A;  1UU1 A;  1C4K A;  3UT9 D;  3QN6 A;  1G4V A;  2HOR A;  5GSU B;  1M6S A;  3H0L C;  3MGQ A;  4F5J A;  4WLH A;  4R8D A;  4BMK A;  2Z1Y A;  4F5L A;  4WLJ A;  3TU4 B;  4WYD A;  2D66 A;  1TAS A;  3TQX A;  5JRG A;  4LNL A;  2HUU A;  4Y0H A;  3AZL D;  2W8U A;  3G8M A;  1VJO A;  3D6K A; 
#chains in the Genus database with same CATH homology
 5GT0 A;  1ZOB A;  4J8X B;  2QBT A;  2YKV A;  3W96 A;  4G92 B;  3W99 B;  1KMK A;  3KE3 A;  1AHY A;  5BJ4 A;  3X1S B;  4F5I A;  1VEF A;  4LD9 A;  1GC4 A;  5EUN A;  3LJA C;  1PMO A;  3KWQ B;  3REL B;  4J8X D;  3ASB A;  3MGP D;  3CBF A;  2CV5 B;  2R5C A;  3W98 A;  1TAF A;  3C1B B;  3X1S D;  1P3K D;  2GSA A;  2VLH A;  2KFP A;  5B0Z A;  1MAQ A;  3AEN B;  3KWQ D;  5GT3 D;  3MGS D;  1ASD A;  3K28 A;  4UHM A;  1KX3 C;  5CPJ C;  4J8U D;  2W7H A;  4CVQ A;  1MDO A;  2VMU A;  2YCT A;  3A6N B;  2F8N B;  2YRR A;  3AZI A;  3ISL A;  1UU0 A;  3LZ0 B;  2RVQ C;  3H9X A;  3MAF A;  1KX5 C;  4X23 D;  5B1L D;  4OBU A;  1P3M D;  3A2B A;  2FFF B;  4E44 A;  4WJ3 C;  5AV6 A;  2E54 A;  1C9C A;  4YS3 C;  1M0N A;  3A6N D;  1B8G A;  5JRG B;  1M19 D;  1F1E A;  3WZF A;  1TOG A;  5EIG A;  1D7R A;  4Z2M H;  1DJE A;  2HOY A;  5GT0 B;  2VGV A;  3FSL A;  1BH8 A;  3UTB D;  4E1O A;  5K8B A;  1DFO A;  5B2I A;  1BT4 A;  3N7N A;  4Z66 A;  5B24 A;  2Y2P A;  1PZR A;  1AKC A;  4YM6 A;  3CAI A;  5AV8 C;  4ZWV A;  4JF0 A;  3KUY D;  1M18 C;  4PFF A;  4DRA A;  3MNN B;  1P3G C;  1TAF B;  1RVY A;  3WCN A;  4W1V A;  4XUJ A;  2L5A A;  1FG7 A;  3X1V C;  4AO9 A;  3EUC A;  2AY4 A;  3B6F D;  3FD0 A;  4P3M A;  1KL1 A;  1M0O A;  3MNN D;  4CAY B;  5AY8 A;  3WKJ B;  3N75 A;  5DNM D;  5KDM A;  4GEB A;  1TOK A;  5FT5 A;  2NQB C;  2EO5 A;  2CTZ A;  2ZC0 A;  5E5A A;  2JJH A;  2FNU A;  3X1T D;  2JIS A;  4WU8 A;  1QZ9 A;  3ZRP A;  1WWS A;  3A9Y A;  4EU1 A;  2Z1Z A;  1P34 A;  2BIG A;  2VGS A;  2HIO B;  3TCM A;  5B40 C;  2VGZ A;  1LC8 A;  3AZJ A;  2F8N H;  2OKJ A;  4JEW A;  2Q7W A;  3AZM B;  1BH8 B;  4J5U A;  4MKJ A;  4MQQ A;  3REH A;  2FJ7 C;  8AAT A;  3KXB C;  1AIA A;  5HHY A;  3W97 C;  2ARO A;  5C6U A;  1V2D A;  3NUB A;  3R45 B;  5CPK B;  4ZSW A;  3LJA D;  3EI8 A;  4EB7 A;  1AJS B;  2FKI A;  3H0M C;  3B0D C;  1P3O A;  4LC3 A;  5CPJ B;  4TMR A;  2BKW A;  1U35 C;  4AH3 A;  2AY2 A;  4A72 A;  1TZY A;  5DNN A;  1P3L C;  2WK8 A;  4LNM A;  5AV9 C;  1RVU A;  3MAD A;  3AZE C;  3NRA A;  5BT1 C;  3ELP A;  4A6R A;  4UUZ B;  3FZ8 A;  1KX3 D;  3DXV A;  5CPJ D;  5B32 A;  5AVC A;  2BWP A;  1OHW A;  2W8W A;  1H1C A;  1P3F C;  2AY9 A;  4OBV A;  4H9Q A;  3LG0 A;  4WU8 B;  5GXQ C;  2RVQ D;  5B31 A;  4XZQ C;  1GBN A;  1KX5 D;  4F5M A;  2EPJ A;  2OGE A;  3G0T A;  4RKD A;  3AZH A;  5BS7 A;  1P34 B;  3ZRR A;  4YS3 D;  3AZJ B;  4RM1 A;  1FG3 A;  1V2E A;  5JAY A;  3UAK A;  3O62 A;  1AIC A;  5BNX B;  3REH B;  2BYK A;  2VIA A;  4DRB A;  4H9N B;  4E77 A;  1O61 A;  1SPA A;  1M1A C;  2O7C A;  4EMY A;  3E2Z B;  2ZM5 A;  3FRK A;  2ZY5 A;  4MQP A;  3AV2 A;  3USF A;  3UTA C;  2O1B A;  1XI9 A;  2VIB A;  5EFS A;  3NQU A;  2VLF A;  5AV8 D;  3AEL A;  3PJ0 A;  4UHO A;  4CSR B;  1M18 D;  1CQ7 A;  4A6T A;  2YCN A;  2CFB A;  1P3G D;  1S32 C;  1P3I C;  3EPK A;  4R8P C;  4R5Z A;  3X1V D;  4ZBJ C;  5CP6 A;  2Y2I A;  2CAN A;  5M46 A;  4JJN C;  1ULY A;  2AY6 A;  4TN4 A;  3EI9 A;  4NFT A;  3AFA A;  2CWE A;  4J8V A;  3AV1 C;  4WU9 A;  2NQB D;  4HGA C;  4WB0 A;  1F66 A;  4O6Z A;  4WP0 A;  1HQ3 B;  2ZYJ A;  5B40 B;  3AZH B;  2DKB A;  3WTP E;  4ZAS A;  3LEL A;  4ZM3 A;  4KUD B;  2ZUK A;  3X1U A;  1TAR A;  4KAM A;  3REI A;  3GJU A;  3AZF C;  2FJ7 B;  1LW5 A;  2OKK A;  1X0M A;  5B40 D;  4ZUX B;  3W97 B;  3VH5 A;  5GSU C;  4A6U A;  3HDO A;  4OMA A;  3MGR A;  2EH6 A;  2JG2 A;  3K7Y A;  5E3K A;  3GZD A;  3KXB D;  3WAA A;  3B0D B;  3TU4 C;  2NMP A;  1YJY A;  4J8W A;  4K05 A;  1HTA A;  1ASN A;  1EQZ A;  3B6G A;  1P3L B;  4XJL A;  4WYF A;  1B4X A;  2WB6 A;  1AMR A;  1GDE A;  3REJ C;  1SFF A;  2EZ1 A;  4JEV A;  4E3R A;  3AAT A;  4B98 A;  1U35 D;  4OYT A;  2D63 A;  5G4J A;  5B2J C;  3V9R A;  1M7Y A;  4QLC B;  1GC2 A;  1AHX A;  1MDZ A;  1P3L D;  3NYT A;  2VGT A;  4H9O A;  5AV9 D;  4G92 C;  3NTJ A;  3W99 C;  1LS3 A;  2VQR A;  3AZE D;  5BT1 D;  1ARH A;  4DQ6 A;  1ASM A;  2X8U A;  3QGU A;  1P3F D;  3MVD A;  3REL C;  4I8A A;  2BYL A;  2CV5 C;  2CJD A;  2GB3 A;  5GXQ D;  3RBL A;  5B33 B;  3C1B C;  4XZQ D;  4H9R A;  1BH9 A;  3AN2 C;  1G4X A;  1IBJ A;  1W7M A;  4WYG A;  3WGC A;  3EI6 A;  4U2H A;  3HL2 A;  1ZLA A;  2W7E A;  5B0Y A;  3PIU A;  3UT9 A;  4KHA B;  1AIB A;  3BS8 A;  5EAV A;  3Q8N A;  1N1J A;  5G4I A;  2VMY A;  3MGQ C;  4BHD A;  3LZ0 C;  1LKC A;  3ZZJ A;  3LZ1 A;  1M1A D;  2ZJG A;  3PA9 A;  4J8W B;  2HUE B;  3UTA D;  4W91 A;  2BYM B;  2VMQ A;  4ZBJ B;  5BNV B;  2X3L A;  4BA4 A;  3AZL A;  5JRG C;  2PO3 A;  2GMU A;  3W1J A;  1KX4 B;  1FC4 A;  3VH6 W;  5FT4 A;  3E77 A;  3QPG A;  1S32 D;  1O62 A;  1P3I D;  5GT0 C;  2BWO A;  4R8P D;  1OHV A;  4G91 B;  2PYO B;  5EAA A;  2C7T A;  3AZG B;  3W96 C;  3AV1 B;  5F99 A;  2DOU A;  2F2A C;  1EG5 A;  3C1C A;  2AEV A;  3AOV A;  4JJN D;  5D95 A;  2IO5 C;  5B1M B;  5C3I B;  3MGP A;  1W23 A;  3AEM C;  3MEB A;  4NE6 A;  3AV1 D;  1AAM A;  1G7X A;  3K40 A;  1P3B B;  1BH9 B;  3NYS A;  2WK9 A;  5GT3 A;  4Q6R A;  3MGS A;  2W7G A;  1P3A A;  2JJE A;  5G49 B;  1ZLA B;  4EFF A;  2EZ2 A;  5B0Y B;  2LY8 A;  4J8U A;  3B0B A;  1P3W A;  3WKJ C;  1PG8 A;  3AZF D;  4JEX A;  4X23 A;  4GDY A;  5GSU D;  3M5U A;  1PFF A;  5AVB A;  2E7J A;  1ELQ A;  1CQ6 A;  3B8X A;  3REJ B;  3TFU A;  4KXK A;  3TU4 D;  1KU5 A;  1ASG A;  1ARS A;  2HIO C;  5B2J B;  1B5O A;  2VGU A;  3AZM C;  3UTB A;  1WYT B;  1D2F A;  3REJ D;  2V1P A;  4JEZ A;  4L0O A;  5B32 G;  4ITG A;  4Z66 C;  2W8J A;  1DTY A;  3TFT A;  5B24 C;  4GE9 A;  3EPH A;  5B2J D;  5BO0 B;  1DGE A;  4FFC A;  2YFW A;  2W8S A;  2YFV A;  1CL1 A;  3KUY A;  3W99 D;  2QB2 A;  3I16 A;  2GQN A;  5B31 G;  5CPK C;  1GEX A;  3AN2 B;  2JJG A;  5CPI B;  2CH1 A;  5E4Z A;  3REL D;  2YOB A;  2CV5 D;  3B6F A;  3LVJ A;  3REK A;  3BCA A;  3C1B D;  3AN2 D;  3MGQ B;  1OHY A;  1WYV A;  9AAT A;  2AAT A;  1CZC A;  2Y2Q A;  4W1W A;  4KGC A;  1B9I A;  1CZE A;  1QIS A;  3L44 A;  2BG1 A;  5EUE A;  3X1T A;  3QM2 A;  3RUY A;  3MGQ D;  2F8N D;  3DOD A;  4GSA A;  4WU8 C;  3LZ0 D;  1YAA A;  3NUI A;  1BS0 A;  1IAY A;  4WNN A;  1P34 C;  4ADC A;  1GEW A;  2VMX A;  3B1C A;  3KFU G;  3AZJ C;  5JRG D;  1ARI A;  3W96 B;  7AAT A;  2BWN A;  1ZOD A;  3A1I A;  2XD5 A;  4LD9 B;  2IO5 B;  3WA9 A;  1AAW A;  3REH C;  5GT0 D;  2QLR A;  1W7L A;  2JCH A;  1U08 A;  1JG8 A;  1I48 A;  2YFV B;  2R5C B;  3W96 D;  3W98 B;  3FDB A;  5FT6 A;  5B0Z B;  3LJA A;  4Q75 A;  5DJ1 A;  3JTX A;  1P3O C;  3PGY A;  4RJY A;  4K2I A;  2QMA A;  4A0G A;  4AWL C;  3FFR A;  2W7L A;  1TZY C;  4ZDO A;  3AZI B;  4IXZ A;  1KMJ A;  2HP2 A;  3MAF B;  2WK7 A;  1W2E A;  1KX3 A;  4A0H A;  2X5F A;  5AVC C;  5AV5 A;  2JSS A;  3WKJ D;  5AV6 B;  2Z9X A;  3VAX A;  3EIB A;  4PVF A;  1KX5 A;  5B31 C;  5EIG B;  5FUG A;  4ZDP A;  2G5H C;  3WTP A;  1HQ3 C;  3AZH C;  2RFV A;  3EI7 A;  3NYU A;  4YS3 A;  3A8U X;  4RJ0 A;  1AY4 A;  4KUD C;  2HUF A;  3WLX A;  4RIZ A;  2QSR A;  5B2I B;  2O0R A;  4Z66 B;  5B24 B;  2HIO D;  4ZUX C;  3WA9 B;  1C7G A;  4YM6 B;  3ATH A;  2OGA A;  1N8P A;  2RIQ A;  4RAE A;  4XJM A;  3AZM D;  1DJU A;  4XQ2 A;  3JZL A;  4Z5T A;  4LW4 A;  2CIN A;  4Z66 D;  3PD6 A;  5B24 D;  3CQ4 A;  4XUJ B;  5AV8 A;  1LC5 A;  4XAU A;  1YIY A;  1M18 A;  5CPK D;  1P3G A;  1XEY A;  1ASF A;  5AY8 B;  1AOI A;  3X1V A;  1AMQ A;  1JF9 A;  4Y0D A;  5KDM B;  5CP6 C;  1IX7 A;  1WKG A;  3AZK A;  4GE4 A;  2CST A;  3EG5 B;  2W8V A;  4QLC C;  5E5A B;  1DJ9 A;  3W1I A;  1QJ3 A;  1C7O A;  4R2N A;  2G6W A;  2CJG A;  3AFA C;  1S07 A;  1ZC9 A;  4ZDL A;  3ELE A;  2ZP7 A;  3KGW A;  3EPJ A;  2NZD A;  2X5D A;  1F66 C;  3WTP B;  3FTB A;  3I5T A;  4WU8 D;  4AZJ A;  5B33 C;  3CQ5 A;  3LEL C;  3X1U C;  1B5P A;  3AYW A;  1T3U A;  1P34 D;  1BJO A;  5G2P A;  4KYO A;  3LVL B;  2Z9V A;  4H9S C;  3AZJ D;  2BI1 A;  4K2B A;  2ARO B;  3OP7 A;  2CH2 A;  3GET A;  5E5I A;  4WD2 A;  3AEP A;  4HF8 A;  3REH D;  4A0F A;  4H63 Q;  4GE7 A;  3GZD C;  5DB5 A;  3GZC A;  2PB0 A;  1P3O B;  3RQ1 A;  1D7S A;  3A9Z A;  4J8W C;  1S09 A;  2HUE C;  3FQ7 A;  1H3O A;  4AWL B;  1P3P A;  3BC8 A;  1TZY B;  3B6G C;  2BI3 A;  5DNN B;  1JS3 A;  3KGX A;  3FFH A;  3R4T A;  1KX4 C;  3FQA A;  5AVC B;  5B32 B;  2ZSL A;  1OXP A;  3MKJ A;  3JW9 A;  2VI9 A;  3BCB A;  4G91 C;  4H9Q B;  4EO5 C;  2PYO C;  1TZY D;  1N31 A;  1BW0 A;  2HOZ A;  5F9S A;  5AV9 A;  3AZG C;  2BHX A;  1Z7D A;  3AZE A;  3R9A A;  2JGT A;  5B31 B;  3LVK A;  1LW4 A;  5B1M C;  5AVC D;  3EZS A;  1P3F A;  1JFI A;  3F9T A;  4WYA A;  5C3I C;  1KKJ A;  2Z61 A;  3FZ6 A;  4ZSY A;  4WXF A;  1MDX A;  5GXQ A;  4GRX A;  3AEO A;  1C7N A;  4XZQ A;  1O4S A;  3WGB A;  1P3B C;  3FVX A;  2V0Y A;  3O62 B;  3RCH A;  3AYW B;  4ZLV A;  1HQ3 D;  3AZH D;  4QGR A;  2BYK B;  1ZLA C;  3EI5 A;  3LVM A;  5B0Y C;  3B1E A;  4KUD D;  3AZN A;  2F8J A;  3E9K A;  2DKJ A;  2FN6 A;  3GSB A;  1MAP A;  1ID3 A;  4BQ0 A;  2FJ7 D;  3AV2 B;  4ZUX D;  3W97 D;  3NQU B;  3N4S A;  1N2T A;  2YHK A;  2FNI A;  3LZ1 C;  1J32 A;  4W5K A;  3WCO A;  1SZS A;  3UTA A;  3EZ1 A;  3HLM A;  3PDX A;  2CB1 A;  4H9P A;  3MC6 A;  2C44 A;  5CP6 B;  2Y2L A;  5F8V A;  4M6B A;  3PDB A;  2E7I A;  1S08 A;  4JEY A;  3KSY A;  1S32 A;  4R8P A;  3I4J A;  3AFA B;  3DC1 A;  1AMA A;  2F8N K;  5CP6 D;  4J8V B;  5F99 C;  4WU9 B;  1S0A A;  4WYC A;  5I92 A;  5M49 A;  3B0C W;  3C1C C;  3UE8 A;  4JJN A;  4K2M A;  4WB0 B;  3VH5 W;  4QLC D;  1F66 B;  1WKH A;  3BWN A;  3LY1 A;  3LV2 A;  3AEJ C;  1B9H A;  3NQJ A;  4WZS B;  3AFA D;  1MLY A;  3N5M A;  4ZM4 A;  3LEL B;  1KKP A;  2W7D A;  3X1U B;  5CPI C;  2AY7 A;  2VMW A;  4RLG A;  1UU2 A;  3EPL A;  3REI B;  1F66 D;  2BI9 A;  4R5F A;  1JS6 A;  1P3A C;  4RIT A;  5B33 D;  5D5S A;  3LEL D;  3VK4 A;  3AOW A;  3X1U D;  2ZY4 A;  2XBN A;  3F0H A;  3AZF A;  3MGR B;  1ID3 B;  2HOX A;  1KL2 A;  3FQ8 A;  2VMS A;  3WAA B;  2Z9W A;  5GSU A;  4XK1 A;  1AJR A;  3IHJ A;  2DGL A;  5G09 A;  2YRI A;  5AVB C;  1EQZ B;  1VP4 A;  3B6G B;  2BI5 A;  2Y2M A;  4RKC A;  4H9P B;  3B46 A;  3H7F A;  3HVY A;  3TU4 A;  1W3U A;  4NOG A;  4J8W D;  2VMP A;  2VI8 A;  3WX9 A;  3V9R B;  1TPL A;  1AKB A;  4EO5 B;  3B6G D;  4JF1 A;  4H9O B;  3JWA A;  1KX4 D;  4LD9 C;  3BCX A;  1BQD A;  4J8X A;  4HVK A;  3MVD B;  1AHF A;  3VK3 A;  2PYO D;  4XEW A;  4Q31 A;  3W99 A;  3AZG D;  1ASL A;  1SZU A;  3NQJ B;  3W98 C;  1D7V A;  3X1S A;  1P3K A;  2R2N A;  1IAX A;  4H9R B;  1GC3 A;  3DXW A;  5B0Z C;  3KWQ A;  2GMS A;  5B1M D;  3REL A;  4Y0I A;  3NDN A;  4IYO A;  3UT9 B;  3MAU A;  3REK C;  3C1B A;  3AEN A;  4U1T A;  5BJ3 A;  1P3B D;  1N1J B;  4CBR A;  3RBF A;  2D65 A;  1UKJ A;  3AZI C;  2DQN C;  1ZLA D;  5B0Y D;  4W8I A;  2AEU A;  5B1L A;  1P3M A;  4KGC C;  1M0Q A;  1MLZ A;  1ASB A;  2CY8 A;  2D7Z A;  3LZ1 B;  5AV6 C;  1R4V A;  2D61 A;  3X1T C;  3A6N A;  2E7U A;  2F8N A;  1M19 A;  4IY7 A;  3LZ0 A;  3AZL B;  2R0T A;  3G7Q A;  4MY5 A;  1GEY A;  4MQR A;  4A00 A;  3LZ1 D;  1QGN A;  2VMO A;  3HT4 A;  4CBS A;  1GD9 A;  5B2I C;  5F99 B;  1SZK A;  1W7N A;  3GBX A;  4UHN A;  3C1C B;  3VH6 T;  3WA9 C;  1WWI A;  4YM6 C;  5EQC A;  2TPL A;  5JA4 A;  3MGP B;  3QI6 A;  3AL0 C;  5F99 D;  3FVS A;  1P3K B;  3C1C D;  2QA3 A;  4XUJ C;  5GT3 B;  3DU4 A;  4WBT A;  1AY5 A;  5EUD A;  3MGS B;  3AEM A;  1P3A B;  1ELU A;  4IYO B;  2AY8 A;  3MNN A;  4J8U B;  2C0R A;  5CPI D;  5DNM A;  5AY8 C;  1RV4 A;  1CJ0 A;  2Y2N A;  1P3A D;  4OTL A;  1ORD A;  4X23 B;  5B1L B;  1AKA A;  1P3M B;  2OAT A;  4CAY A;  1PMM A;  5DX5 A;  3WKJ A;  5E5A C;  5AV5 C;  3UWC A;  3DYD A;  5AVB B;  4EB5 A;  3BN1 A;  3AV7 A;  3FZ7 A;  2VMN A;  1M19 B;  3DR7 A;  3WY7 A;  2ZSM A;  2R5E A;  2HUI A;  1DKA A;  3GR9 A;  3WTP C;  5AVB D;  4IXS A;  3W1H A;  2DGM A;  3UTB B;  1C0N A;  1OXO A;  1WST A;  1GC0 A;  2HIO A;  1BJW A;  4W1X A;  2BI2 A;  3RI6 A;  2YFW B;  3OKS A;  2FM1 A;  2ARO C;  1G7W A;  3AZM A;  5JA4 B;  2C81 A;  3KUY B;  2FYF A;  4Z5T C;  3CQ6 A;  1V72 A;  4LD9 D;  3MBB A;  4MSO A;  3N0L A;  2Y2K A;  3B6F B;  1E5E A;  3R45 A;  5CPK A;  3REK B;  3W98 D;  2BIA A;  4IW7 A;  3FVU A;  5B0Z D;  1AJS A;  1WYV B;  5DNM B;  1AOI C;  5DNN C;  4FL0 A;  1BJ4 A;  3ZRQ A;  1IX6 A;  1H0C A;  2AY3 A;  1YNU A;  4IX8 A;  4KGC B;  5CPJ A;  3II0 A;  3AZK C;  3REK D;  5B32 C;  3DZZ A;  3HMU A;  2HZP A;  2YKU A;  1AMS A;  2Y2H A;  3X1T B;  2HP1 A;  4DGT A;  3IP4 C;  4UPK A;  3AZI D;  1ECX A;  1BQA A;  2UWX A;  4UUZ A;  1TOE A;  4KGC D;  5DJ9 A;  5AV6 D;  3BV0 A;  2NZD C;  4WNN B;  5BS7 C;  1IUG A;  3LWS A;  4DQY B;  4E3Q A;  2VMR A;  3O62 C;  3AYW C;  1IJI A;  3HQT A;  5KTB A;  1Z2C B;  2D64 A;  3N4R A;  5B2I D;  2W8T A;  3T32 A;  2DGK A;  1ASE A;  3NX3 A;  3AV2 C;  5BNX A;  3LJA B;  3WA9 D;  1ASA A;  4YM6 D;  4H9N A;  5IWQ A;  4WYE A;  1LK9 A;  3E2Z A;  2ORD A;  1QIR A;  3PAA A;  4XUJ D;  1P3P C;  4ISY A;  4M2M A;  1BKG A;  2OQX A;  4CSR A;  1SVV A;  3ACZ A;  4ADE A;  1KX3 B;  1ARG A;  1X29 A;  4NE5 A;  1ART A;  5AV5 B;  5AY8 D;  3E2Y A;  1BFM A;  4M2J A;  2JJF A;  4J8V C;  4Z2M G;  2NQB A;  2BIE A;  2VMZ A;  4WU9 C;  1KX5 B;  5FUG B;  5E5A D;  5AV5 D;  4YS3 B;  3HBX A;  1V2F A;  3WKS A;  3REI C;  5AX8 A;  4ADD A;  3EIA A;  1HQ3 A;  5B40 A;  3WTP D;  4ATQ A;  4Q76 A;  4KUD A;  4IXO A;  3AZN C;  2W7F A;  3N4X A;  1Z3Z A;  4Z5T B;  3NU8 A;  4XJP A;  2FJ7 A;  3MGR C;  1ID3 C;  3PD6 B;  4ZUX A;  3KXB A;  3W97 A;  4WV4 B;  3WAA C;  5AV8 B;  2ARO D;  4PFN A;  3DRD A;  3COG A;  1M18 B;  4A0R A;  1EJI A;  5M4D A;  1S06 A;  4Z5T D;  1P3G B;  1EQZ C;  2W7I A;  1I29 A;  1AOI B;  3X1V B;  1D7U A;  3MC6 C;  1CS1 A;  3ASA A;  2EYQ A;  3P1T A;  2Z9U A;  1P3O D;  3AZK B;  2G5I C;  1U35 A;  2YCP A;  4H51 A;  1M4N A;  3A9X A;  1P3L A;  1AOI D;  5DNN D;  1X28 A;  4ADB A;  4CXQ A;  3VP6 A;  2NQB B;  2ZY3 A;  3AZK D;  5CHL B;  5B32 D;  4OC9 A;  2VMT A;  2NZD B;  4QLC A;  4AOA A;  2G7J A;  3MVD C;  2F8N G;  3BWN C;  5TF5 A;  3BB8 A;  2DF4 C;  2Y2G A;  5B31 D;  4ZAH A;  3WKR A;  4OCA A;  1TOI A;  1SF2 A;  2NZD D;  3DR4 A;  2D5Y A;  1BJO B;  4OT8 A;  4PIW A;  3E6G A;  3UT9 C;  5B33 A;  1B6W A;  4ZWM A;  3O62 D;  1QIT A;  2J8P A;  3AYW D;  3ZZK A;  3FKD A;  1AHE A;  2JE5 A;  4H9S A;  3KXB B;  4KHA A;  2D7Y A;  1M0P A;  2YKX A;  1M1A A;  3L8A A;  2W7M A;  3FDD A;  3AV2 D;  1H3O B;  1J04 A;  1GCK A;  1P3P B;  2WKA A;  3AZL C;  4WXB A;  2VMV A;  4DBC A;  2EGY A;  3JWB A;  1I41 A;  4UOY A;  5J8Q A;  1RV3 A;  1U35 B;  1P3I A;  3NU7 A;  2YKY A;  4BA5 A;  3QHX A;  2BYM A;  3BWO A;  1A7W A;  1OAT A;  5BNV A;  1P3P D;  1TOJ A;  5AV9 B;  4F5F A;  3AZE B;  1KX4 A;  2BYJ A;  4ATP A;  1AX4 A;  2AY1 A;  3NNK A;  4P7Y A;  4AZK A;  1QJ5 A;  1P3F B;  2Y2J A;  1JFI B;  4J8X C;  3MGP C;  2PYO A;  4ITX A;  1E5F A;  1CL2 A;  3AZG A;  4J8V D;  3AV1 A;  5GXQ B;  1WYU A;  4WU9 D;  4XZQ B;  3X1S C;  1P3K C;  2CJH A;  5B1M A;  4F5G A;  3KWQ C;  3ECD A;  5GT3 C;  3RCH B;  3MGS C;  3VK2 A;  5G2Q A;  3VH6 A;  4WXG A;  1BJN A;  4B9B A;  3KKI A;  3AZN B;  4J8U C;  1P3B A;  4MKK A;  3REI D;  1DGD A;  1LC7 A;  4N0W A;  3FCR A;  5G49 A;  2W7K A;  1M32 A;  3H0R C;  2PB2 A;  2Z20 A;  4X23 C;  5B1L C;  1P3M C;  2FQ6 A;  3AZN D;  3F6T A;  1M1A B;  3MGR D;  1ID3 D;  2W7J A;  3UTA B;  3A6N C;  1O69 A;  1M19 C;  4F5H A;  3WAA D;  1CQ8 A;  4XJO A;  1AHG A;  3E2F A;  1Q9C A;  3PDB B;  4E45 A;  1I43 A;  1IX8 A;  2DR1 A;  1S32 B;  4J8L A;  1P3I B;  1EQZ D;  4R8P B;  4UQV A;  2VYC A;  3REJ A;  1T3I A;  3UTB C;  1YOO A;  3A1K A;  1MGV A;  3P5J B;  4NE3 A;  3P6K A;  4LW2 A;  3B1D A;  5B2J A;  1AY8 A;  4JJN B;  4F5K A;  3PPL A;  1YIZ A;  3GWP A;  1WYT A;  4AO4 A;  5G0A A;  3KUY C;  1Y4I A;  4M2K A;  5M4B A;  2ZY2 A;  2XD1 A;  4HGA B;  1IVR A;  1WYU B;  5BO0 A;  3B0C T;  1ASC A;  1YJS A;  2AY5 A;  3AEJ A;  3MVD D;  3VH5 T;  2CV5 A;  1YJZ A;  3B6F C;  4F4E A;  4CXR A;  5HXX A;  5HDM A;  3AN2 A;  2A1V A;  1X2A A;  1B67 A;  5CPI A;  3MNN C;  2XH1 A;  2QB3 A;  1EQB A;  3VOM A;  5DNM C;  1TAT A;  3TAT A;  3AZF B;  2VGW A;  3QBO A;  2Y2O A;  4LNJ A;  5FT8 A;  1UU1 A;  1C4K A;  3UT9 D;  3QN6 A;  1G4V A;  2HOR A;  5GSU B;  1M6S A;  3H0L C;  3MGQ A;  4F5J A;  4WLH A;  4R8D A;  4BMK A;  2Z1Y A;  4F5L A;  4WLJ A;  3TU4 B;  4WYD A;  2D66 A;  1TAS A;  3TQX A;  5JRG A;  4LNL A;  2HUU A;  4Y0H A;  3AZL D;  2W8U A;  3G8M A;  1VJO A;  3D6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...