2ZY5A

R487a mutant of l-aspartate beta-decarboxylase
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
510
structure length
510
Chain Sequence
ELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGAGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
molecule keywords L-aspartate beta-decarboxylase
total genus 183
structure length 510
sequence length 510
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy5A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy5A01
3CQ4A 4MY5A 4L0OA 3A9YA 4WYCA 1KKJA 1QGNA 1BJOA 3AELA 3CAIA 9AATA 1CQ8A 2GMSA 3E2ZB 4WXGA 1B8GA 1IX6A 3N75A 1AHFA 4GSAA 1SZUA 4F5LA 1WSTA 3N5MA 3FKDA 2VGZA 1VEFA 1BJOB 1AMQA 2AY5A 4XQ2A 2VMUA 1DGEA 4UQVA 2E7JA 1LC7A 3FRKA 1DTYA 1YIZA 3PD6A 3FQAA 4P7YA 4BQ0A 4IY7A 3MADA 3G7QA 4RJYA 2BYLA 3MKJA 1AY8A 1AMRA 3BB8A 2VMXA 2ORDA 1ASDA 2Z20A 1BJ4A 4R5FA 3L8AA 4Y0HA 1G4VA 4JF0A 5D5SA 3OKSA 4B9BA 2VIAA 3ATHA 3ELPA 4U1TA 1QIRA 1W3UA 4F5MA 5G0AA 3VK2A 3QI6A 4B98A 1TARA 1LKCA 1C4KA 2OATA 3LVMA 4QGRA 1ECXA 4F5FA 4ADBA 3RBFA 4AZJA 2HP2A 3ASBA 3P1TA 5M46A 2HOYA 3FVSA 3AEMA 1FG7A 2VMPA 2V1PA 3E9KA 3IHJA 4FL0A 2YCNA 1OHWA 3EZSA 1E5EA 3QGUA 3PDBB 5C6UA 2E54A 4ZDPA 3OP7A 3VK3A 1AICA 2ZY5A 2HUUA 2R5CB 4LNJA 5M4DA 3AOVA 2CTZA 2ZC0A 3AEJC 5FT6A 4BMKA 1DKAA 1RV3A 1RVYA 2W8JA 2FN6A 4AH3A 1M4NA 2XH1A 4F5HA 2NMPA 3A8UX 3CBFA 2FNUA 2VGVA 1C7OA 3AEJA 3BCXA 2VGUA 4A0GA 4WBTA 4XAUA 1TOGA 1GCKA 5DJ1A 3WZFA 2Z9VA 2W7LA 1BJWA 4F5IA 3EI6A 1I29A 4U2HA 2ZY4A 4IX8A 4CBRA 2AY2A 1TOKA 5DX5A 1MAPA 4BA4A 4XJMA 5DB5A 1ASNA 1TOEA 2EH6A 3JWBA 4WLJA 3NYSA 2WK9A 4Q31A 1OXPA 1B9IA 1N31A 2VI8A 2AY1A 1O61A 4W8IA 1FC4A 1V2EA 3E6GA 4NOGA 1GEYA 3MC6C 5TF5A 3RCHB 3LY1A 1UU0A 3AV7A 4ITXA 2O0RA 1GC4A 3N0LA 2D64A 1IUGA 3B1DA 3NU8A 1WKHA 3JW9A 1WYUA 3LV2A 1I41A 4Y0DA 1CL1A 2AATA 2PB0A 3GZDC 4MQRA 1N2TA 4XJOA 4GRXA 3DC1A 3EI7A 1VJOA 2OQXA 4OCAA 4PFNA 2X8UA 1M0PA 2ZY2A 2R5EA 1ARTA 1GEWA 4PIWA 3BN1A 4A0HA 3EIBA 3NUBA 3WX9A 1O62A 4I8AA 1ARGA 2BWOA 5G4JA 2D65A 3FTBA 3L44A 3PPLA 4XJPA 2W7FA 1IAXA 2VI9A 2CH2A 3F9TA 4M2JA 3EUCA 3FVUA 4E3RA 4A6RA 3ZRRA 1CQ7A 4K2BA 4CBSA 2W7DA 4JEWA 1QZ9A 3BWNC 3KE3A 4W5KA 4ADCA 3AEMC 3BC8A 3E77A 5G09A 2CJDA 1UKJA 4ZLVA 2YHKA 2EZ1A 4F5JA 3RUYA 1EQBA 1RV4A 2VMVA 2FYFA 1GEXA 1M0OA 4ATPA 4OC9A 4ZWMA 2Z1ZA 3BCAA 5EIGB 3UE8A 3FSLA 3CQ6A 4WD2A 4E1OA 3MC6A 1ASEA 3HQTA 3VOMA 4XEWA 1M6SA 5E3KA 4E3QA 3PDXA 3WY7A 2AY7A 1YOOA 1KKPA 1ORDA 4W91A 1AMAA 2Z9XA 1DFOA 1JG8A 1BJNA 3FFHA 4WXBA 4A6TA 3RBLA 1B5PA 3E2YA 2Z9WA 1TOJA 2VMRA 5J8QA 1YAAA 1MGVA 3ZRPA 2O1BA 3AENB 3MAUA 3NU7A 2CB1A 1W23A 2W7JA 2CJGA 2W8TA 3GR9A 4ZDOA 3EZ1A 1SFFA 2X5FA 1M0QA 3QPGA 2R0TA 2X5DA 4ZSWA 4DGTA 2QMAA 3FFRA 5HDMA 1ARIA 1P3WA 1CL2A 4XK1A 2FNIA 1SPAA 1DJUA 3GSBA 1KL2A 1WYVB 4DQ6A 2HOXA 2VMWA 2EPJA 4R2NA 3VK4A 3GBXA 4LNMA 1JS3A 2VLFA 2ZJGA 2TPLA 2D63A 1DGDA 1V72A 4ADEA 2DKBA 4F5KA 3MBBA 2VMQA 1AKAA 1CJ0A 4F5GA 1FG3A 4HF8A 3UWCA 1IVRA 4Q75A 3MEBA 4EMYA 1E5FA 2DKJA 4IYOB 1S09A 3KKIA 1AAMA 1W7NA 3K40A 3HL2A 4AO4A 1LK9A 1D7RA 1MDXA 3G8MA 4MKJA 2GQNA 3WGCA 3AEPA 5G4IA 1LS3A 3AEOA 4RKCA 1AHYA 4F4EA 1TPLA 4WLHA 4AO9A 2Z1YA 3A9XA 2FM1A 3NNKA 3QHXA 2VMNA 1KL1A 4IXSA 1JF9A 1B5OA 4MQPA 1D7UA 2VIBA 1AIBA 2BYJA 3A9ZA 1G7WA 4LNLA 1YJZA 4WYFA 1GC3A 3FVXA 4W1WA 4PFFA 5EUEA 3WKRA 1WYTA 1LC8A 2CY8A 3BS8A 5FT8A 3D6KA 3NYTA 1BT4A 4CXRA 1TASA 5F9SA 4WXFA 4WYEA 4ATQA 3ZZKA 1M7YA 1UU1A 3GETA 4LC3A 4A0RA 2GB3A 1H1CA 2BIEA 1YJSA 3ELEA 1Z3ZA 4OT8A 3QN6A 3BV0A 5E4ZA 1MAQA 3RI6A 3AATA 2E7IA 1KMJA 3GJUA 1AJRA 1BQDA 2W7EA 1B4XA 4O6ZA 1D7VA 1J04A 3PA9A 4TMRA 1ZC9A 2YCPA 1DJEA 1OATA 2BI2A 3DODA 4GE9A 2C44A 4R5ZA 5K8BA 5M49A 1ELQA 1EG5A 3RQ1A 1BS0A 3BCBA 3QM2A 2Q7WA 1CS1A 1ASGA 3ACZA 1C0NA 1PFFA 2HP1A 2JG2A 8AATA 2VLHA 2CFBA 3DRDA 1G7XA 2AY6A 2WKAA 4MKKA 2F8JA 3T32A 4IYOA 1U08A 1D2FA 2EZ2A 1W7MA 1T3IA 1IAYA 2D66A 1S06A 2JJFA 5E5IA 1LW4A 4BHDA 2HUFA 3DR7A 4GDYA 3JWAA 4W1VA 3E2ZA 4EU1A 1CZEA 2ZYJA 2VGTA 2ZP7A 3I5TA 3LVKA 3R9AA 1S07A 4ISYA 1V2FA 5F8VA 3NX3A 4A72A 3A2BA 3HDOA 2YRIA 3HLMA 3LG0A 1RVUA 1OHYA 1Y4IA 2HOZA 2BKWA 2GMUA 3DYDA 1O4SA 3EI8A 1AX4A 5EUNA 1I43A 2BI5A 2OGAA 3NRAA 4UHOA 1YNUA 2ZY3A 4K2MA 1ASMA 4IXOA 5HXXA 1BW0A 3TFUA 1MDOA 1ASBA 4M2KA 4HVKA 1CZCA 2VMSA 2YKXA 1ASCA 4R8DA 1X2AA 4ZDLA 3FDDA 4ZASA 2V0YA 3GZCA 1ASLA 4EB5A 1AY4A 1BQAA 2VMYA 2QLRA 1IBJA 4EFFA 4UOYA 2W8WA 2AY8A 2YKYA 3EIAA 3NDNA 2D7YA 2CINA 2GSAA 1ELUA 4AOAA 1ASAA 1SF2A 1C7GA 3ZZJA 1AJSB 2W7KA 4Q76A 2OGEA 3DZZA 1WYTB 1BKGA 1WYUB 2BHXA 2DOUA 2VYCA 2YOBA 4LW2A 1S0AA 2W7MA 1GC2A 2W8UA 3DXWA 4A00A 5D95A 1QJ5A 3R4TA 5EIGA 2PB2A 4MQQA 1X29A 3TATA 3VAXA 1PG8A 3F0HA 1X0MA 2BWPA 1AMSA 1IX7A 3LVJA 2BI3A 4ITGA 4K2IA 3H7FA 3TCMA 4EB7A 1WKGA 1YJYA 2D61A 1TATA 1N8PA 2VMZA 2R2NA 2VMTA 4RKDA 1C9CA 1ASFA 2DR1A 1GD9A 3AOWA 5I92A 7AATA 4OTLA 3EI9A 1ARHA 2G6WA 2C7TA 5EUDA 1X28A 3B1CA 3BWOA 2W8VA 3UAKA 3BWNA 4UHMA 2WK8A 1YIYA 2W7GA 3ECDA 1GC0A 1EJIA 4WP0A 4JEZA 2CSTA 3FQ7A 2BIGA 4M2MA 4UHNA 2BI9A 2CH1A 3DU4A 3DR4A 4KYOA 4Y0IA 2C0RA 1LC5A 3ZRQA 1ZOBA 2JJGA 3MAFB 1S08A 1AHGA 3LWSA 2YRRA 1AHEA 3PDBA 4GE7A 2E7UA 4MSOA 3WLXA 4JEXA 1SVVA 3B46A 4ZAHA 3DXVA 3M5UA 4KAMA 2JJEA 3FCRA 2WK7A 2AY9A 1CQ6A 4JEYA 2VMOA 1OXOA 4GEBA 5BJ4A 1M32A 4GE4A 2O7CA 5HHYA 3EI5A 1XI9A 2W7IA 2JGTA 4ZWVA 3II0A 3PGYA 4FFCA 3QBOA 1W7LA 1TOIA 2RFVA 5G2QA 1MLZA 1V2DA 4RAEA 2Z61A 3K7YA 3P6KA 4OYTA 5EAVA 4XJLA 2PO3A 3MAFA 2AY3A 3FDBA 3WKSA 5AX8A 3ISLA 4KXKA 2AY4A 2VGWA 4JEVA 3JTXA 1QJ3A 1G4XA 3NYUA 1GDEA 3Q8NA 5DJ9A 4ZM3A 2BIAA 4A0FA 3NUIA 2BWNA 3ASAA 3GZDA 2JJHA 1KMKA 2FQ6A 4N0WA 1VP4A 1LW5A 3NTJA 2CANA 1JS6A 3PAAA 3I4JA 3PIUA 1MDZA 1IJIA 2QBTA 3CQ5A 3COGA 3KGXA 4W1XA 1ARSA 2QB3A 1ZODA 1AIAA 1UU2A 4WYAA 5FT5A 3WGBA 4CXQA 5EFSA 5M4BA 1AY5A 2CJHA 1DJ9A 3AENA 2EO5A 4IXZA 4Q6RA 1QITA 4ZSYA 4P3MA 3TQXA 3K28A 1QISA 2QA3A 1GBNA 1C7NA 2HZPA 1I48A 1AAWA 2YKUA 1H0CA 4WB0A 3KGWA 1Z7DA 1O69A 2BI1A 2XBNA 5IWQA 5EAAA 4ADDA 4A6UA 1D7SA 5FT4A 2R5CA 2EGYA 1IX8A 2D7ZA 3E2FA 4J5UA 1J32A 5JAYA 1AJSA 4LW4A 4ZM4A 1AKBA 3HMUA 4OMAA 5EQCA 4BA5A 2QB2A 1M0NA 2YCTA 3TFTA 1SZSA 1SZKA 5BJ3A 3LVLB 3RCHA 2D5YA 4E77A 2ZSLA 2C81A 1WYVA 1OHVA 2HUIA 3PJ0A 2Z9UA 3USFA 4H51A 1AKCA 3F6TA 4WYGA 3PD6B 3B1EA 2W7HA 1MLYA 2HORA 5G2PA 4AZKA 2ZSMA 4DBCA 2VGSA 2YKVA 4JF1A 1B9HA 4WB0B 3FQ8A 4TN4A 1AHXA 4WYDA 4PVFA 4IW7A 4CVQA 2ZUKA 3B8XA
chains in the Genus database with same CATH superfamily
4WNNA 5AV6A 3A9YA 1M19D 1QGNA 3N4RA 4WXGA 1B8GA 1IX6A 5F99B 1ZLAB 3H0LC 4F5LA 3N5MA 4Z66A 3FKDA 5GT3A 3W96C 3MGQB 1LC7A 1DTYA 1YIZA 4BQ0A 3MKJA 3BB8A 2VMXA 3WKJB 1BJ4A 4Y0HA 4JF0A 3A1IA 2Y2QA 4NE3A 5G0AA 3C1CC 2OATA 4QGRA 4AZJA 2HP2A 5GXQA 5AV6C 3ASBA 3X1TD 3FVSA 3LJAB 3E9KA 4R8PD 3IHJA 4EO5B 1HTAA 4ZDPA 3VK3A 3LZ0A 1TZYA 2R5CB 4LNJA 3AOVA 3AEJC 2ZC0A 2FN6A 4AH3A 2NMPA 2NZDD 1P3OB 4OBVA 5F99A 3AEJA 4A0GA 1GCKA 3WZFA 1U35C 2Z9VA 2NQBC 1BJWA 4F5IA 4U2HA 4IX8A 4YM6B 5DB5A 2FFFB 3NYSA 3MNNC 5AV5D 3E6GA 4NOGA 1GEYA 4J8WD 4ITXA 2D64A 1IUGA 4WJ3C 2HUEC 4WU8C 2NZDB 5B40C 1CL1A 3GZDC 2Y2MA 5JA4B 1WWSA 5F99C 3BN1A 3LZ0D 3REIA 4I8AA 5G4JA 4XJPA 3EPHA 2W7FA 4J8VA 4XZQD 1IAXA 4M2JA 2CH2A 3I16A 3VP6A 3X1SC 1P3KA 5B31A 5GXQD 1CQ7A 3X1UA 4JEWA 4J8XB 3KE3A 3E77A 1TAFB 4WU9A 1EQBA 4OC9A 2Z1ZA 2DGLA 3C1BB 3TU4B 5B31B 3HQTA 2AROA 3LZ0B 4E3QA 3AZHD 1YOOA 3O62C 5GT0C 5B31G 1JG8A 4Z5TD 4WXBA 3E2YA 5G49B 3AZJA 5B33D 1F66B 3AENB 4H9SC 2CB1A 1W23A 3GR9A 3W1IA 5FUGB 5DNNB 2R0TA 4DGTA 2BG1A 4G91C 1ARIA 4XK1A 1DJUA 4YM6C 1P3AA 3GBXA 4LNMA 1JS3A 2VLFA 4ADEA 1DGDA 1V72A 5B24A 3UTAA 1FG3A 3UWCA 4RIZA 3WA9A 1P34A 1S09A 3KKIA 1AAMA 1W7NA 4AO4A 1P3LA 1LS3A 4RKCA 4WLHA 4J8VC 4AO9A 5KTBA 2VMNA 3A9ZA 5BNXB 1G7WA 4W1WA 4LD9C 3AL0C 4J8UC 3UT9A 1M7YA 4QLCC 3GETA 4CAYB 2BIEA 1YJSA 5E4ZA 3A1KA 2E7IA 3GJUA 1BQDA 2W7EA 1B4XA 5B0YC 1J04A 3MNNA 5JRGA 2BI2A 1OATA 4R5ZA 5K8BA 2C44A 1ELQA 3QM2A 3AZJC 3REHA 2RVQC 1G7XA 3B6GD 2Y2GA 1D2FA 1BH8A 2D66A 5E5IA 3WCNA 1P3GD 4GDYA 3JWAA 3E2ZA 2VGTA 1F66D 2ZP7A 3LVKA 5AV9B 4ISYA 4WU9C 2YRIA 5AVBD 1Y4IA 1O4SA 3NRAA 1YNUA 4UUZB 3REKC 1BW0A 5JA4A 1ASBA 4HVKA 1CZCA 1X2AA 3UTBA 4RJ0A 3EIAA 1KX4D 2CINA 4H9SA 1SF2A 4G92B 1P3LD 3AZKD 1WYTB 2YOBA 4LW2A 3REID 5JRGC 2FJ7D 3X1VB 3DXWA 1P34D 5B2IC 5D95A 3MGSC 1KX5C 3WA9D 1X29A 2PB2A 5EIGA 3TATA 3VAXA 1P3AB 3UTAD 4EB7A 3AZEC 2CV5D 2R2NA 2AEUA 1GD9A 3AOWA 5I92A 3EI9A 1ARHA 2C7TA 5EUDA 5CPIB 3UAKA 2W8VA 2W7GA 3ECDA 1GC0A 4WP0A 1N1JA 2CSTA 2BYKA 2CH1A 3DU4A 3DR4A 4KYOA 2C0RA 3B0CW 1ZOBA 4Z5TA 3PDBA 3WLXA 2AROB 5KDMA 3B6FC 4JEXA 3B46A 5GSUC 3AZHA 3W97C 2AY9A 4JEYA 4GEBA 5BJ4A 5B0ZD 3W96B 3MGQD 3AV1D 1W7LA 1TZYD 4ZUXC 2RFVA 4RAEA 1HQ3C 5EAVA 2JSSA 5B40B 3X1UD 3FDBA 3WKSA 4LD9A 5B24B 5AX8A 3KWQD 1M19C 2AY4A 4JEVA 3JTXA 1P3IB 1G4XA 3NYUA 1M1AD 4Z2MH 2BWNA 1KMKA 2FQ6A 4AWLB 3AZNB 1VP4A 3NTJA 1JS6A 3PIUA 2QBTA 4KUDB 4EO5C 3WGBA 4CXQA 1DJ9A 4HGAB 3AENA 4IXZA 4Q6RA 4ZSYA 4P3MA 2FJ7B 1H0CA 3X1VC 1P34B 2DGKA 1D7SA 1P3AC 1T3UA 4OMAA 2QB2A 3WCOA 2YCTA 3C1BC 1AOID 5AV6D 3LVLB 3EPKA 4E77A 2C81A 4K05A 4H51A 3F6TA 4WYGA 4WV4B 5CPKA 3B1EA 1H3OA 3AV2A 3FQ8A 4WYDA 5AV9C 4IW7A 3B8XA 5BO0A 5CHLB 3AZLA 2PYOC 4WYCA 3AELA 9AATA 2GMSA 3E2ZB 4R8PA 3N75A 1AHFA 2HIOD 2KFPA 3AZIC 1AMQA 5AV5C 4P7YA 4RJYA 2OKKA 4KHAB 5B40D 4R5FA 5JRGB 3X1SA 1G4VA 3L8AA 5D5SA 3OKSA 4B9BA 1P3FB 3ELPA 3AZFD 1W3UA 1ZLAA 3HVYA 1ECXA 4Z66D 3MGSA 5M46A 3P1TA 1ZLAD 1W2EA 3LZ0C 4JJNA 3AEMA 4DRBA 3KXBC 3AZFA 1OHWA 1E5EA 3A6ND 5C6UA 3KUYB 3X1SD 1AICA 4QLCB 5M4DA 5FT6A 4BMKA 3O62A 5AV8B 3B0DC 5DNNC 5B0YB 4WBTA 5CPIA 3AYWB 5B32B 1P3PA 1AOIB 2ZY4A 3LJAD 3W99B 4KGCB 1OXPA 5GT0D 1B9IA 4ZBJB 3MGPD 1B6WA 4Z5TC 3MC6C 1UU0A 1GC4A 4H9PA 3B1DA 1WKHA 5CPKD 1JFIB 5B24C 4XJOA 3W1HA 3DC1A 3EI7A 2ZY2A 3N4SA 5B1MB 1ARTA 1AOIA 3TU4D 4A0HA 3EIBA 3AZNC 1ARGA 3R45B 3G0TA 3EUCA 3ZRRA 4CBSA 2W7DA 1F1EA 3AEMC 1PZRA 4ZLVA 2CWEA 4F5JA 3WTPD 1U35A 1RV4A 3AZGD 1GEXA 2F2AC 4ZWMA 3BCAA 3CQ6A 4WD2A 3VOMA 1M6SA 3KWQA 4LD9D 1BJNA 5CPJD 4A6TA 3NQUA 4QLCD 4CSRA 5B2JC 5BT1C 1YAAA 3ZRPA 2O1BA 3MAUA 2IO5C 1P3KC 4XUJB 2W8TA 3EZ1A 2X5FA 5B0YD 3EG5B 3V9RB 3FFRA 3C1CA 1SPAA 1KL2A 2EPJA 2ZJGA 2QSRA 2TPLA 2D63A 2DKBA 4F5KA 3MGPB 1CJ0A 4F5GA 4YM6A 4J8WB 4Q75A 1P3GC 3MEBA 4EMYA 1E5FA 2DKJA 3LELD 3K40A 3HL2A 3W98B 1P3MC 4OBUA 1LK9A 4MKJA 3WAAB 1PMOA 3AN2A 2Z1YA 3NNKA 3RELB 5DNMA 1KL1A 1B5OA 3REKD 3AZEB 3FVXA 3WKRA 4PFFA 1LC8A 5GSUA 3BS8A 5FT8A 3LZ1A 3D6KA 3REJB 5F9SA 4ATQA 3ZZKA 2F8NA 5GXQB 4A0RA 1Z3ZA 1P3LC 3QN6A 3BV0A 1MAQA 3AATA 2FJ7C 5E5AA 1P34C 4TMRA 1BFMA 3WTPB 3NQUB 3C1CD 3REJA 3B6FB 3X1TC 1C0NA 3MGQA 1PFFA 2HP1A 2VLHA 2CFBA 3DRDA 1KU5A 5B0ZA 1HQ3A 4Z5TB 4XUJA 2HUFA 3DR7A 1CZEA 5E5AD 3I5TA 2NZDC 4J8XA 1V2FA 1M18B 3NX3A 3A2BA 2GMUA 3MGRC 5EUNA 4WZSB 4UHOA 3WTPA 1U35D 5HXXA 3B6FD 3R45A 1ID3D 5GSUD 3TFUA 2X3LA 2VMSA 2YKXA 3B6GB 1ASLA 5B1MA 1AY4A 3MNND 5B0ZC 1BQAA 4CSRB 1IBJA 4KUDC 4UOYA 4EFFA 1P3BA 3MGQC 2BYKB 4J8WC 4ZUXD 4AOAA 3X1VA 3ZZJA 4WU8D 2OGEA 1P3MB 3DZZA 2DOUA 1P3BC 2W8UA 3X1UC 3AZEA 3R4TA 4ITGA 3AFAB 4K2IA 1M1AC 3H7FA 3TCMA 1WKGA 2VMZA 1N8PA 4RKDA 3REHC 1BH8B 2FKIA 3FZ6A 7AATA 2G6WA 4XZQC 1X28A 5GXQC 3MGPA 1YIYA 3AFAA 4XUJC 2BIGA 4M2MA 3ZRQA 1KX3B 1AHGA 1P3AD 1F66A 4ZAHA 3M5UA 3FCRA 3W99C 3AZIB 3O62D 3B6GA 3EI5A 3VH5T 1M18A 3QBOA 1TOIA 5CP6A 1P3GB 3K7YA 5AV9D 4XJLA 4NE5A 3MAFA 3WKJD 3WAAC 1P3FC 4YS3A 3HT4A 2PYOD 3ISLA 1QJ3A 3MGRA 4ZM3A 2BIAA 4WNNB 5AV6B 3GZDA 3W99A 4N0WA 1LW5A 4R8PB 3AZMD 3PAAA 3AN2C 1AIAA 4WYAA 3X1SB 5M4BA 1AY5A 1KX5A 2JE5A 3HBXA 1QISA 2QA3A 2HZPA 1C7NA 1P3OD 4J8VD 5FT4A 4J5UA 3E2FA 5JAYA 1J32A 1AJSA 3AYWD 1KX3A 5EQCA 3W97A 3TFTA 1SZKA 5BJ3A 3RELA 2ZSLA 3KFUG 2Z9UA 5BO0B 3AZLB 5G2PA 4JF1A 5B32G 3MVDD 4TN4A 1AHXA 4WU9B 3N7NA 2ZUKA 4MY5A 3A6NA 1BJOA 3AZJD 5AVCA 3W97B 4GSAA 1SZUA 3B6GC 2VGZA 1VEFA 3A6NB 3MGPC 1BJOB 4XQ2A 2E7JA 3PD6A 3FQAA 3N4XA 4WU9D 1ASDA 2Z20A 2ORDA 5AVBC 3FD0A 3MGSB 4U1TA 1QIRA 1M19B 3VK2A 3QI6A 4B98A 4F5FA 5B31D 2HIOB 2VMPA 2V1PA 4H9QB 2ZM5A 3EZSA 5B2JA 3REJC 1EQZD 3PDBB 2E54A 1S32B 3OP7A 2HUUA 2ZY5A 4H9NA 3VH6W 2CTZA 5B33B 1DKAA 1RV3A 1M4NA 4F5HA 4Z2MG 2IO5B 3A8UX 2FNUA 1P3KB 2XD1A 5GT3D 5AVCB 1C7OA 3BCXA 4H9OA 1KX3C 4XAUA 5DJ1A 3EI6A 1I29A 2CV5C 4CBRA 4BA4A 2F8NH 1ASNA 3JWBA 4WLJA 4Q31A 2WK9A 1N31A 1O61A 4W8IA 4JJNB 1V2EA 5AY8C 5TF5A 3RCHB 3AV7A 2RIQA 3MVDB 3JW9A 1WYUA 3LV2A 1I41A 4Y0DA 2AATA 2PB0A 4MQRA 3UT9C 4GRXA 2OQXA 4OCAA 3RELD 4PFNA 2X8UA 1M0PA 2R5EA 4YS3C 3W97D 2FJ7A 4AWLC 3WX9A 3WAAA 3AYWA 3AZKA 3AZHB 2BWOA 3FTBA 3F9TA 2BYMB 5CPJB 3AV1C 3WTPE 1P3OA 3FVUA 4E3RA 3X1TA 4J8LA 2Y2PA 1QZ9A 4G92C 3BWNC 4ADCA 3BC8A 5G09A 1P3BB 3AZFB 2YHKA 3AZMA 1P3PC 2FYFA 1M0OA 2VQRA 5EIGB 3X1TB 3MC6A 1H3OB 3H0RC 2AY7A 3KXBB 3AZLC 2Z9XA 1DFOA 1EQZB 3FFHA 3RBLA 1B5PA 5AV9A 1TOJA 2VMRA 1MGVA 3VH5A 3W98D 3NU7A 5CP6D 1M19A 2W7JA 1M18D 4ZDOA 1SFFA 1M0QA 3JZLA 2X5DA 4ZSWA 3AZGB 1CL2A 2AROC 4UPKA 3C1BD 1AOIC 3GSBA 4DQ6A 2HOXA 4KGCC 2L5AA 3MBBA 4JJNC 1PMMA 1IVRA 1XEYA 5BNVA 3G8MA 3AZKB 5G4IA 3AEOA 3UT9B 1AHYA 1TPLA 5B2IB 3WA9B 3QHXA 1KX4A 3EPJA 1JF9A 3UTAB 4MQPA 1ID3C 5B1LC 2BYJA 3REHB 2HIOC 4WYFA 5EUEA 1WYTA 2CY8A 3NYTA 3AV2C 1TASA 4WYEA 2F8NG 1S32C 5CPIC 1UU1A 4LC3A 4WU8A 5AVBA 5AV8C 1KMJA 1P3BD 4O6ZA 1D7VA 3AZFC 3PA9A 1ZC9A 1A7WA 1N1JB 4DQYB 3DODA 5B32C 4GE9A 5M49A 1EG5A 3RQ1A 1BS0A 3BCBA 5GSUB 1ASGA 3NQJA 3REHD 3ACZA 3KXBD 4NFTA 3O62B 2F8JA 3T32A 1U08A 5B33A 2JJFA 3AZNA 1S06A 3W96D 1LW4A 4BHDA 4W1VA 1HQ3B 3LZ1C 3R9AA 4WU8B 1S07A 4XUJD 3HDOA 5DNND 3LG0A 1OHYA 2HOZA 2BKWA 3EI8A 1AX4A 2PYOB 1I43A 2BI5A 2OGAA 5DNMC 3AFAD 1ASMA 4IXOA 5B1MC 4X23A 3NQJB 4ZDLA 3FDDA 4R8PC 4ZASA 3GZCA 2VMYA 2QLRA 2W8WA 2AY8A 2LY8A 2D7YA 1ELUA 1ASAA 1AJSB 2W7KA 4J8XC 1BKGA 2W7MA 2VYCA 3WAAD 1GC2A 3VH6A 1R4VA 1QJ5A 4MQQA 3UTBC 2A1VA 1AMSA 1IX7A 2BI3A 1YJYA 3TU4C 1TATA 1C9CA 4DRAA 2DR1A 3AN2D 4J8WA 3BWNA 5AV5A 2WK8A 1EJIA 3W98A 3FQ7A 4UHNA 2BI9A 4Y0IA 3MAFB 3WTPC 3KWQB 3AZGC 3LWSA 1AHEA 1P3ID 3AYWC 4MSOA 2E7UA 1SVVA 3DXVA 5F99D 4KAMA 2WK7A 5B32A 3VH6T 2NZDA 5HHYA 2W7IA 2JGTA 3II0A 3PGYA 5AV8A 2Z61A 5B2JD 4QLCA 3FZ7A 5CPJA 5AVBB 4H9PB 2AY3A 3MGRB 4KXKA 2VGWA 4XZQA 1GDEA 3Q8NA 4YS3B 3NUIA 2F8ND 2NQBA 3ASAA 3AZGA 3I4JA 4RLGA 1MDZA 5B0ZB 1IJIA 3CQ5A 3COGA 5FT5A 2QB3A 4X23C 3KUYD 3AV1B 2EO5A 1QITA 1P3MD 3KGWA 5AVCD 2G5IC 5EAAA 4ADDA 2R5CA 1IX8A 2D7ZA 2EGYA 4ZM4A 4BA5A 3HMUA 5BNXA 5BS7C 2CV5B 3AZJB 1SZSA 2F8NB 3GWPA 4YM6D 3RCHA 1WYVA 1OHVA 3AZMB 2HUIA 2W8SA 1BH9B 2W7HA 2HORA 4AZKA 2YKVA 1B9HA 4WB0B 2HUEB 4NE6A 5CPKB 1TAFA 3CQ4A 5GT0A 2J8PA 4L0OA 1KX3D 1KKJA 1EQZA 3CAIA 4G91B 1CQ8A 4Z66B 1S32A 1WSTA 5FUGA 2AY5A 4J8UD 2VMUA 1DGEA 4UQVA 5AY8D 5B1LA 3FRKA 5E5AC 4IY7A 4RITA 3MADA 3G7QA 2BYLA 2G7JA 1AY8A 1AMRA 2XD5A 2VIAA 4KUDA 3MGRD 3ATHA 4F5MA 4H63Q 1TARA 1LKCA 1C4KA 4H9RB 1M1AB 3LVMA 4H9QA 4YS3D 3RBFA 4ADBA 5B1LB 2HOYA 3WKJA 1FG7A 2RVQD 4FL0A 3EPLA 2YCNA 4KUDD 3QGUA 4J8UB 3TU4A 2Y2JA 2W8JA 1RVYA 3FZ8A 1F66C 2XH1A 3CBFA 2VGVA 3MVDA 4J8UA 2VGUA 1TOGA 2W7LA 2AY2A 1TOKA 5DX5A 1MAPA 5C3IC 4XJMA 1TOEA 2EH6A 3AZLD 1B67A 2VI8A 2AY1A 1FC4A 3LJAA 4CAYA 3LY1A 2Y2IA 2O0RA 3N0LA 3NU8A 5CP6C 1N2TA 5B2ID 1KX5D 3WA9C 1VJOA 3REKB 1GEWA 4PIWA 3AZED 3NUBA 3W99D 1O62A 2D65A 3L44A 3PPLA 4KGCD 4LD9B 2WB6A 2VI9A 3W1JA 5AV5B 4JJND 2PYOA 4A6RA 4K2BA 4W5KA 2YFWA 3WKJC 1P3FD 2CJDA 1UKJA 1ID3A 3B6FA 1KX5B 2EZ1A 1KAFA 3RUYA 2VMVA 4ATPA 2NQBD 3UE8A 3FSLA 5B1LD 4E1OA 3VH5W 1ASEA 4XEWA 4H9RA 1M1AA 5E3KA 3PDXA 3WY7A 2BYMA 3AZMC 1KKPA 1ORDA 4W91A 1AMAA 1S32D 1Z2CB 2Z9WA 1HQ3D 3LELB 5J8QA 3LZ1B 5AV8D 3B0DB 2CJGA 3AV1A 1P3OC 2DF4C 5GT3B 3KSYA 3QPGA 1BH9A 3KWQC 2QMAA 5DNMB 5B32D 5HDMA 1U35B 2NQBB 1P3WA 2FNIA 1WYVB 2VMWA 4R2NA 3VK4A 2VMQA 1AKAA 4HF8A 1KX4B 4ZUXB 3MVDC 3LZ1D 4IYOB 5CP6B 1D7RA 1MDXA 4RM1A 3WGCA 2GQNA 3AEPA 3REIB 4F4EA 5BNVB 4M6BA 3X1VD 5BS7A 3A9XA 4ZUXA 2FM1A 2AEVA 3UTBB 1P3MA 3C1CB 5DNMD 4IXSA 3AFAC 3V9RA 3H0MC 5B1MD 1D7UA 2CV5A 2VIBA 1AIBA 4H9NB 4LNLA 4UUZA 1YJZA 1GC3A 3KUYA 2DGMA 3AZHC 4XZQB 1BT4A 4CXRA 4WXFA 4HGAC 5B33C 2GB3A 2YFVA 1H1CA 3ELEA 4J8XD 4OT8A 3RI6A 2EYQA 1AJRA 2YCPA 3UTBD 4KHAA 1DJEA 3AZIA 5B0YA 2Q7WA 5B31C 1CS1A 2JG2A 8AATA 3P5JB 3IP4C 3AZID 2AY6A 2WKAA 4MKKA 4IYOA 3MNNB 3H9XA 3REJD 1EQZC 5DNNA 2EZ2A 1W7MA 1T3IA 1IAYA 1TZYB 2DQNC 2F8NK 4EU1A 2ZYJA 1P3IA 4CVQA 5F8VA 4A72A 5GT3C 3HLMA 2Y2NA 1RVUA 3DYDA 2ZY3A 1P3IC 4K2MA 2Y2HA 4Z66C 1MDOA 4M2KA 1P3FA 1ZLAC 1ASCA 4R8DA 2V0YA 2JISA 4EB5A 3REKA 3AN2B 3A6NC 2YKYA 4X23B 3NDNA 2GSAA 4KGCA 1C7GA 4Q76A 2Y2OA 1WYUB 2BHXA 1S0AA 3UT9D 3LELA 4A00A 5G49A 1P3PB 1PG8A 3F0HA 1X0MA 3RELC 2BWPA 3LVJA 2UWXA 2D61A 1ID3B 2VMTA 1ASFA 3LJAC 2YFWB 3B0CT 1WWIA 1Q9CA 4OTLA 4X23D 3KUYC 3B1CA 3BWOA 4UHMA 2Y2LA 1ULYA 5B2JB 1P3LB 4JEZA 2JCHA 5CPKC 1LC5A 5AVCC 5B24D 2JJGA 1P3PD 1S08A 2YRRA 4GE7A 2Y2KA 3C1BA 1P3GA 2JJEA 1CQ6A 3W96A 3AZND 2VMOA 1OXOA 5C3IB 1M32A 4GE4A 2O7CA 3KXBA 4E45A 1XI9A 1KX4C 4ZWVA 4FFCA 5AY8B 5G2QA 1MLZA 1V2DA 3P6KA 5E5AB 3W98C 4OYTA 3AZKC 2PO3A 1M18C 3REIC 5JRGD 4E44A 4J8VB 3MGSD 3UTAC 2G5HC 2AROD 5DJ9A 4A0FA 2JJHA 5B40A 2CANA 3AV2B 3KGXA 4W1XA 1ARSA 1JFIA 1ZODA 1UU2A 3B0BA 5CPJC 5EFSA 5AY8A 2CJHA 5B2IA 5BT1D 3TQXA 3K28A 2HIOA 1GBNA 1P3KD 1I48A 2YKUA 1AAWA 4WB0A 3X1UB 1Z7DA 1O69A 2BI1A 2XBNA 5IWQA 4A6UA 5KDMB 4LW4A 1AKBA 1M0NA 2YFVB 2D5YA 3PJ0A 3USFA 3AV2D 5GT0B 1AKCA 4ZBJC 3PD6B 5CPID 1MLYA 1TZYC 2ZSMA 4DBCA 2VGSA 3LELC 4PVFA 2OKJA 4H9OB
chains in the Genus database with same CATH topology
4WNNA 5AV6A 3A9YA 1M19D 1QGNA 3N4RA 4WXGA 1B8GA 1IX6A 5F99B 1ZLAB 3H0LC 4F5LA 3N5MA 4Z66A 3FKDA 5GT3A 3W96C 3MGQB 1LC7A 1DTYA 1YIZA 4BQ0A 3MKJA 3BB8A 2VMXA 3WKJB 1BJ4A 4Y0HA 4JF0A 3A1IA 2Y2QA 4NE3A 5G0AA 3C1CC 2OATA 4QGRA 4AZJA 2HP2A 5GXQA 5AV6C 3ASBA 3X1TD 3FVSA 3LJAB 3E9KA 4R8PD 3IHJA 4EO5B 1HTAA 4ZDPA 3VK3A 3LZ0A 1TZYA 2R5CB 4LNJA 3AOVA 3AEJC 2ZC0A 2FN6A 4AH3A 2NMPA 2NZDD 1P3OB 4OBVA 5F99A 3AEJA 4A0GA 1GCKA 3WZFA 1U35C 2Z9VA 2NQBC 1BJWA 4F5IA 4U2HA 4IX8A 4YM6B 5DB5A 2FFFB 3NYSA 3MNNC 5AV5D 3E6GA 4NOGA 1GEYA 4J8WD 4ITXA 2D64A 1IUGA 4WJ3C 2HUEC 4WU8C 2NZDB 5B40C 1CL1A 3GZDC 2Y2MA 5JA4B 1WWSA 5F99C 3BN1A 3LZ0D 3REIA 4I8AA 5G4JA 4XJPA 3EPHA 2W7FA 4J8VA 4XZQD 1IAXA 4M2JA 2CH2A 3I16A 3VP6A 3X1SC 1P3KA 5B31A 5GXQD 1CQ7A 3X1UA 4JEWA 4J8XB 3KE3A 3E77A 1TAFB 4WU9A 1EQBA 4OC9A 2Z1ZA 2DGLA 3C1BB 3TU4B 5B31B 3HQTA 2AROA 3LZ0B 4E3QA 3AZHD 1YOOA 3O62C 5GT0C 5B31G 1JG8A 4Z5TD 4WXBA 3E2YA 5G49B 3AZJA 5B33D 1F66B 3AENB 4H9SC 2CB1A 1W23A 3GR9A 3W1IA 5FUGB 5DNNB 2R0TA 4DGTA 2BG1A 4G91C 1ARIA 4XK1A 1DJUA 4YM6C 1P3AA 3GBXA 4LNMA 1JS3A 2VLFA 4ADEA 1DGDA 1V72A 5B24A 3UTAA 1FG3A 3UWCA 4RIZA 3WA9A 1P34A 1S09A 3KKIA 1AAMA 1W7NA 4AO4A 1P3LA 1LS3A 4RKCA 4WLHA 4J8VC 4AO9A 5KTBA 2VMNA 3A9ZA 5BNXB 1G7WA 4W1WA 4LD9C 3AL0C 4J8UC 3UT9A 1M7YA 4QLCC 3GETA 4CAYB 2BIEA 1YJSA 5E4ZA 3A1KA 2E7IA 3GJUA 1BQDA 2W7EA 1B4XA 5B0YC 1J04A 3MNNA 5JRGA 2BI2A 1OATA 4R5ZA 5K8BA 2C44A 1ELQA 3QM2A 3AZJC 3REHA 2RVQC 1G7XA 3B6GD 2Y2GA 1D2FA 1BH8A 2D66A 5E5IA 3WCNA 1P3GD 4GDYA 3JWAA 3E2ZA 2VGTA 1F66D 2ZP7A 3LVKA 5AV9B 4ISYA 4WU9C 2YRIA 5AVBD 1Y4IA 1O4SA 3NRAA 1YNUA 4UUZB 3REKC 1BW0A 5JA4A 1ASBA 4HVKA 1CZCA 1X2AA 3UTBA 4RJ0A 3EIAA 1KX4D 2CINA 4H9SA 1SF2A 4G92B 1P3LD 3AZKD 1WYTB 2YOBA 4LW2A 3REID 5JRGC 2FJ7D 3X1VB 3DXWA 1P34D 5B2IC 5D95A 3MGSC 1KX5C 3WA9D 1X29A 2PB2A 5EIGA 3TATA 3VAXA 1P3AB 3UTAD 4EB7A 3AZEC 2CV5D 2R2NA 2AEUA 1GD9A 3AOWA 5I92A 3EI9A 1ARHA 2C7TA 5EUDA 5CPIB 3UAKA 2W8VA 2W7GA 3ECDA 1GC0A 4WP0A 1N1JA 2CSTA 2BYKA 2CH1A 3DU4A 3DR4A 4KYOA 2C0RA 3B0CW 1ZOBA 4Z5TA 3PDBA 3WLXA 2AROB 5KDMA 3B6FC 4JEXA 3B46A 5GSUC 3AZHA 3W97C 2AY9A 4JEYA 4GEBA 5BJ4A 5B0ZD 3W96B 3MGQD 3AV1D 1W7LA 1TZYD 4ZUXC 2RFVA 4RAEA 1HQ3C 5EAVA 2JSSA 5B40B 3X1UD 3FDBA 3WKSA 4LD9A 5B24B 5AX8A 3KWQD 1M19C 2AY4A 4JEVA 3JTXA 1P3IB 1G4XA 3NYUA 1M1AD 4Z2MH 2BWNA 1KMKA 2FQ6A 4AWLB 3AZNB 1VP4A 3NTJA 1JS6A 3PIUA 2QBTA 4KUDB 4EO5C 3WGBA 4CXQA 1DJ9A 4HGAB 3AENA 4IXZA 4Q6RA 4ZSYA 4P3MA 2FJ7B 1H0CA 3X1VC 1P34B 2DGKA 1D7SA 1P3AC 1T3UA 4OMAA 2QB2A 3WCOA 2YCTA 3C1BC 1AOID 5AV6D 3LVLB 3EPKA 4E77A 2C81A 4K05A 4H51A 3F6TA 4WYGA 4WV4B 5CPKA 3B1EA 1H3OA 3AV2A 3FQ8A 4WYDA 5AV9C 4IW7A 3B8XA 5BO0A 5CHLB 3AZLA 2PYOC 4WYCA 3AELA 9AATA 2GMSA 3E2ZB 4R8PA 3N75A 1AHFA 2HIOD 2KFPA 3AZIC 1AMQA 5AV5C 4P7YA 4RJYA 2OKKA 4KHAB 5B40D 4R5FA 5JRGB 3X1SA 1G4VA 3L8AA 5D5SA 3OKSA 4B9BA 1P3FB 3ELPA 3AZFD 1W3UA 1ZLAA 3HVYA 1ECXA 4Z66D 3MGSA 5M46A 3P1TA 1ZLAD 1W2EA 3LZ0C 4JJNA 3AEMA 4DRBA 3KXBC 3AZFA 1OHWA 1E5EA 3A6ND 5C6UA 3KUYB 3X1SD 1AICA 4QLCB 5M4DA 5FT6A 4BMKA 3O62A 5AV8B 3B0DC 5DNNC 5B0YB 4WBTA 5CPIA 3AYWB 5B32B 1P3PA 1AOIB 2ZY4A 3LJAD 3W99B 4KGCB 1OXPA 5GT0D 1B9IA 4ZBJB 3MGPD 1B6WA 4Z5TC 3MC6C 1UU0A 1GC4A 4H9PA 3B1DA 1WKHA 5CPKD 1JFIB 5B24C 4XJOA 3W1HA 3DC1A 3EI7A 2ZY2A 3N4SA 5B1MB 1ARTA 1AOIA 3TU4D 4A0HA 3EIBA 3AZNC 1ARGA 3R45B 3G0TA 3EUCA 3ZRRA 4CBSA 2W7DA 1F1EA 3AEMC 1PZRA 4ZLVA 2CWEA 4F5JA 3WTPD 1U35A 1RV4A 3AZGD 1GEXA 2F2AC 4ZWMA 3BCAA 3CQ6A 4WD2A 3VOMA 1M6SA 3KWQA 4LD9D 1BJNA 5CPJD 4A6TA 3NQUA 4QLCD 4CSRA 5B2JC 5BT1C 1YAAA 3ZRPA 2O1BA 3MAUA 2IO5C 1P3KC 4XUJB 2W8TA 3EZ1A 2X5FA 5B0YD 3EG5B 3V9RB 3FFRA 3C1CA 1SPAA 1KL2A 2EPJA 2ZJGA 2QSRA 2TPLA 2D63A 2DKBA 4F5KA 3MGPB 1CJ0A 4F5GA 4YM6A 4J8WB 4Q75A 1P3GC 3MEBA 4EMYA 1E5FA 2DKJA 3LELD 3K40A 3HL2A 3W98B 1P3MC 4OBUA 1LK9A 4MKJA 3WAAB 1PMOA 3AN2A 2Z1YA 3NNKA 3RELB 5DNMA 1KL1A 1B5OA 3REKD 3AZEB 3FVXA 3WKRA 4PFFA 1LC8A 5GSUA 3BS8A 5FT8A 3LZ1A 3D6KA 3REJB 5F9SA 4ATQA 3ZZKA 2F8NA 5GXQB 4A0RA 1Z3ZA 1P3LC 3QN6A 3BV0A 1MAQA 3AATA 2FJ7C 5E5AA 1P34C 4TMRA 1BFMA 3WTPB 3NQUB 3C1CD 3REJA 3B6FB 3X1TC 1C0NA 3MGQA 1PFFA 2HP1A 2VLHA 2CFBA 3DRDA 1KU5A 5B0ZA 1HQ3A 4Z5TB 4XUJA 2HUFA 3DR7A 1CZEA 5E5AD 3I5TA 2NZDC 4J8XA 1V2FA 1M18B 3NX3A 3A2BA 2GMUA 3MGRC 5EUNA 4WZSB 4UHOA 3WTPA 1U35D 5HXXA 3B6FD 3R45A 1ID3D 5GSUD 3TFUA 2X3LA 2VMSA 2YKXA 3B6GB 1ASLA 5B1MA 1AY4A 3MNND 5B0ZC 1BQAA 4CSRB 1IBJA 4KUDC 4UOYA 4EFFA 1P3BA 3MGQC 2BYKB 4J8WC 4ZUXD 4AOAA 3X1VA 3ZZJA 4WU8D 2OGEA 1P3MB 3DZZA 2DOUA 1P3BC 2W8UA 3X1UC 3AZEA 3R4TA 4ITGA 3AFAB 4K2IA 1M1AC 3H7FA 3TCMA 1WKGA 2VMZA 1N8PA 4RKDA 3REHC 1BH8B 2FKIA 3FZ6A 7AATA 2G6WA 4XZQC 1X28A 5GXQC 3MGPA 1YIYA 3AFAA 4XUJC 2BIGA 4M2MA 3ZRQA 1KX3B 1AHGA 1P3AD 1F66A 4ZAHA 3M5UA 3FCRA 3W99C 3AZIB 3O62D 3B6GA 3EI5A 3VH5T 1M18A 3QBOA 1TOIA 5CP6A 1P3GB 3K7YA 5AV9D 4XJLA 4NE5A 3MAFA 3WKJD 3WAAC 1P3FC 4YS3A 3HT4A 2PYOD 3ISLA 1QJ3A 3MGRA 4ZM3A 2BIAA 4WNNB 5AV6B 3GZDA 3W99A 4N0WA 1LW5A 4R8PB 3AZMD 3PAAA 3AN2C 1AIAA 4WYAA 3X1SB 5M4BA 1AY5A 1KX5A 2JE5A 3HBXA 1QISA 2QA3A 2HZPA 1C7NA 1P3OD 4J8VD 5FT4A 4J5UA 3E2FA 5JAYA 1J32A 1AJSA 3AYWD 1KX3A 5EQCA 3W97A 3TFTA 1SZKA 5BJ3A 3RELA 2ZSLA 3KFUG 2Z9UA 5BO0B 3AZLB 5G2PA 4JF1A 5B32G 3MVDD 4TN4A 1AHXA 4WU9B 3N7NA 2ZUKA 4MY5A 3A6NA 1BJOA 3AZJD 5AVCA 3W97B 4GSAA 1SZUA 3B6GC 2VGZA 1VEFA 3A6NB 3MGPC 1BJOB 4XQ2A 2E7JA 3PD6A 3FQAA 3N4XA 4WU9D 1ASDA 2Z20A 2ORDA 5AVBC 3FD0A 3MGSB 4U1TA 1QIRA 1M19B 3VK2A 3QI6A 4B98A 4F5FA 5B31D 2HIOB 2VMPA 2V1PA 4H9QB 2ZM5A 3EZSA 5B2JA 3REJC 1EQZD 3PDBB 2E54A 1S32B 3OP7A 2HUUA 2ZY5A 4H9NA 3VH6W 2CTZA 5B33B 1DKAA 1RV3A 1M4NA 4F5HA 4Z2MG 2IO5B 3A8UX 2FNUA 1P3KB 2XD1A 5GT3D 5AVCB 1C7OA 3BCXA 4H9OA 1KX3C 4XAUA 5DJ1A 3EI6A 1I29A 2CV5C 4CBRA 4BA4A 2F8NH 1ASNA 3JWBA 4WLJA 4Q31A 2WK9A 1N31A 1O61A 4W8IA 4JJNB 1V2EA 5AY8C 5TF5A 3RCHB 3AV7A 2RIQA 3MVDB 3JW9A 1WYUA 3LV2A 1I41A 4Y0DA 2AATA 2PB0A 4MQRA 3UT9C 4GRXA 2OQXA 4OCAA 3RELD 4PFNA 2X8UA 1M0PA 2R5EA 4YS3C 3W97D 2FJ7A 4AWLC 3WX9A 3WAAA 3AYWA 3AZKA 3AZHB 2BWOA 3FTBA 3F9TA 2BYMB 5CPJB 3AV1C 3WTPE 1P3OA 3FVUA 4E3RA 3X1TA 4J8LA 2Y2PA 1QZ9A 4G92C 3BWNC 4ADCA 3BC8A 5G09A 1P3BB 3AZFB 2YHKA 3AZMA 1P3PC 2FYFA 1M0OA 2VQRA 5EIGB 3X1TB 3MC6A 1H3OB 3H0RC 2AY7A 3KXBB 3AZLC 2Z9XA 1DFOA 1EQZB 3FFHA 3RBLA 1B5PA 5AV9A 1TOJA 2VMRA 1MGVA 3VH5A 3W98D 3NU7A 5CP6D 1M19A 2W7JA 1M18D 4ZDOA 1SFFA 1M0QA 3JZLA 2X5DA 4ZSWA 3AZGB 1CL2A 2AROC 4UPKA 3C1BD 1AOIC 3GSBA 4DQ6A 2HOXA 4KGCC 2L5AA 3MBBA 4JJNC 1PMMA 1IVRA 1XEYA 5BNVA 3G8MA 3AZKB 5G4IA 3AEOA 3UT9B 1AHYA 1TPLA 5B2IB 3WA9B 3QHXA 1KX4A 3EPJA 1JF9A 3UTAB 4MQPA 1ID3C 5B1LC 2BYJA 3REHB 2HIOC 4WYFA 5EUEA 1WYTA 2CY8A 3NYTA 3AV2C 1TASA 4WYEA 2F8NG 1S32C 5CPIC 1UU1A 4LC3A 4WU8A 5AVBA 5AV8C 1KMJA 1P3BD 4O6ZA 1D7VA 3AZFC 3PA9A 1ZC9A 1A7WA 1N1JB 4DQYB 3DODA 5B32C 4GE9A 5M49A 1EG5A 3RQ1A 1BS0A 3BCBA 5GSUB 1ASGA 3NQJA 3REHD 3ACZA 3KXBD 4NFTA 3O62B 2F8JA 3T32A 1U08A 5B33A 2JJFA 3AZNA 1S06A 3W96D 1LW4A 4BHDA 4W1VA 1HQ3B 3LZ1C 3R9AA 4WU8B 1S07A 4XUJD 3HDOA 5DNND 3LG0A 1OHYA 2HOZA 2BKWA 3EI8A 1AX4A 2PYOB 1I43A 2BI5A 2OGAA 5DNMC 3AFAD 1ASMA 4IXOA 5B1MC 4X23A 3NQJB 4ZDLA 3FDDA 4R8PC 4ZASA 3GZCA 2VMYA 2QLRA 2W8WA 2AY8A 2LY8A 2D7YA 1ELUA 1ASAA 1AJSB 2W7KA 4J8XC 1BKGA 2W7MA 2VYCA 3WAAD 1GC2A 3VH6A 1R4VA 1QJ5A 4MQQA 3UTBC 2A1VA 1AMSA 1IX7A 2BI3A 1YJYA 3TU4C 1TATA 1C9CA 4DRAA 2DR1A 3AN2D 4J8WA 3BWNA 5AV5A 2WK8A 1EJIA 3W98A 3FQ7A 4UHNA 2BI9A 4Y0IA 3MAFB 3WTPC 3KWQB 3AZGC 3LWSA 1AHEA 1P3ID 3AYWC 4MSOA 2E7UA 1SVVA 3DXVA 5F99D 4KAMA 2WK7A 5B32A 3VH6T 2NZDA 5HHYA 2W7IA 2JGTA 3II0A 3PGYA 5AV8A 2Z61A 5B2JD 4QLCA 3FZ7A 5CPJA 5AVBB 4H9PB 2AY3A 3MGRB 4KXKA 2VGWA 4XZQA 1GDEA 3Q8NA 4YS3B 3NUIA 2F8ND 2NQBA 3ASAA 3AZGA 3I4JA 4RLGA 1MDZA 5B0ZB 1IJIA 3CQ5A 3COGA 5FT5A 2QB3A 4X23C 3KUYD 3AV1B 2EO5A 1QITA 1P3MD 3KGWA 5AVCD 2G5IC 5EAAA 4ADDA 2R5CA 1IX8A 2D7ZA 2EGYA 4ZM4A 4BA5A 3HMUA 5BNXA 5BS7C 2CV5B 3AZJB 1SZSA 2F8NB 3GWPA 4YM6D 3RCHA 1WYVA 1OHVA 3AZMB 2HUIA 2W8SA 1BH9B 2W7HA 2HORA 4AZKA 2YKVA 1B9HA 4WB0B 2HUEB 4NE6A 5CPKB 1TAFA 3CQ4A 5GT0A 2J8PA 4L0OA 1KX3D 1KKJA 1EQZA 3CAIA 4G91B 1CQ8A 4Z66B 1S32A 1WSTA 5FUGA 2AY5A 4J8UD 2VMUA 1DGEA 4UQVA 5AY8D 5B1LA 3FRKA 5E5AC 4IY7A 4RITA 3MADA 3G7QA 2BYLA 2G7JA 1AY8A 1AMRA 2XD5A 2VIAA 4KUDA 3MGRD 3ATHA 4F5MA 4H63Q 1TARA 1LKCA 1C4KA 4H9RB 1M1AB 3LVMA 4H9QA 4YS3D 3RBFA 4ADBA 5B1LB 2HOYA 3WKJA 1FG7A 2RVQD 4FL0A 3EPLA 2YCNA 4KUDD 3QGUA 4J8UB 3TU4A 2Y2JA 2W8JA 1RVYA 3FZ8A 1F66C 2XH1A 3CBFA 2VGVA 3MVDA 4J8UA 2VGUA 1TOGA 2W7LA 2AY2A 1TOKA 5DX5A 1MAPA 5C3IC 4XJMA 1TOEA 2EH6A 3AZLD 1B67A 2VI8A 2AY1A 1FC4A 3LJAA 4CAYA 3LY1A 2Y2IA 2O0RA 3N0LA 3NU8A 5CP6C 1N2TA 5B2ID 1KX5D 3WA9C 1VJOA 3REKB 1GEWA 4PIWA 3AZED 3NUBA 3W99D 1O62A 2D65A 3L44A 3PPLA 4KGCD 4LD9B 2WB6A 2VI9A 3W1JA 5AV5B 4JJND 2PYOA 4A6RA 4K2BA 4W5KA 2YFWA 3WKJC 1P3FD 2CJDA 1UKJA 1ID3A 3B6FA 1KX5B 2EZ1A 3RUYA 2VMVA 4ATPA 2NQBD 3UE8A 3FSLA 5B1LD 4E1OA 3VH5W 1ASEA 4XEWA 4H9RA 1M1AA 5E3KA 3PDXA 3WY7A 2BYMA 3AZMC 1KKPA 1ORDA 4W91A 1AMAA 1S32D 1Z2CB 2Z9WA 1HQ3D 3LELB 5J8QA 3LZ1B 5AV8D 3B0DB 2CJGA 3AV1A 1P3OC 2DF4C 5GT3B 3KSYA 3QPGA 1BH9A 3KWQC 2QMAA 5DNMB 5B32D 5HDMA 1U35B 2NQBB 1P3WA 2FNIA 1WYVB 2VMWA 4R2NA 3VK4A 2VMQA 1AKAA 4HF8A 1KX4B 4ZUXB 3MVDC 3LZ1D 4IYOB 5CP6B 1D7RA 1MDXA 4RM1A 3WGCA 2GQNA 3AEPA 3REIB 4F4EA 5BNVB 4M6BA 3X1VD 5BS7A 3A9XA 4ZUXA 2FM1A 2AEVA 3UTBB 1P3MA 3C1CB 5DNMD 4IXSA 3AFAC 3V9RA 3H0MC 5B1MD 1D7UA 2CV5A 2VIBA 1AIBA 4H9NB 4LNLA 4UUZA 1YJZA 1GC3A 3KUYA 2DGMA 3AZHC 4XZQB 1BT4A 4CXRA 4WXFA 4HGAC 5B33C 2GB3A 2YFVA 1H1CA 3ELEA 4J8XD 4OT8A 3RI6A 2EYQA 1AJRA 2YCPA 3UTBD 4KHAA 1DJEA 3AZIA 5B0YA 2Q7WA 5B31C 1CS1A 2JG2A 8AATA 3P5JB 3IP4C 3AZID 2AY6A 2WKAA 4MKKA 4IYOA 3MNNB 3H9XA 3REJD 1EQZC 5DNNA 2EZ2A 1W7MA 1T3IA 1IAYA 1TZYB 2DQNC 2F8NK 4EU1A 2ZYJA 1P3IA 4CVQA 5F8VA 4A72A 5GT3C 3HLMA 2Y2NA 1RVUA 3DYDA 2ZY3A 1P3IC 4K2MA 2Y2HA 4Z66C 1MDOA 4M2KA 1P3FA 1ZLAC 1ASCA 4R8DA 2V0YA 2JISA 4EB5A 3REKA 3AN2B 3A6NC 2YKYA 4X23B 3NDNA 2GSAA 4KGCA 1C7GA 4Q76A 2Y2OA 1WYUB 2BHXA 1S0AA 3UT9D 3LELA 4A00A 5G49A 1P3PB 1PG8A 3F0HA 1X0MA 3RELC 2BWPA 3LVJA 2UWXA 2D61A 1ID3B 2VMTA 1ASFA 3LJAC 2YFWB 3B0CT 1WWIA 1Q9CA 4OTLA 4X23D 3KUYC 3B1CA 3BWOA 4UHMA 2Y2LA 1ULYA 5B2JB 1P3LB 4JEZA 2JCHA 5CPKC 1LC5A 5AVCC 5B24D 2JJGA 1P3PD 1S08A 2YRRA 4GE7A 2Y2KA 3C1BA 1P3GA 2JJEA 1CQ6A 3W96A 3AZND 2VMOA 1OXOA 5C3IB 1M32A 4GE4A 2O7CA 3KXBA 4E45A 1XI9A 1KX4C 4ZWVA 4FFCA 5AY8B 5G2QA 1MLZA 1V2DA 3P6KA 5E5AB 3W98C 4OYTA 3AZKC 2PO3A 1M18C 3REIC 5JRGD 4E44A 4J8VB 3MGSD 3UTAC 2G5HC 2AROD 5DJ9A 4A0FA 2JJHA 5B40A 2CANA 3AV2B 3KGXA 4W1XA 1ARSA 1JFIA 1ZODA 1UU2A 3B0BA 5CPJC 5EFSA 5AY8A 2CJHA 5B2IA 5BT1D 3TQXA 3K28A 2HIOA 1GBNA 1P3KD 1I48A 2YKUA 1AAWA 4WB0A 3X1UB 1Z7DA 1O69A 2BI1A 2XBNA 5IWQA 4A6UA 5KDMB 4LW4A 1AKBA 1M0NA 2YFVB 2D5YA 3PJ0A 3USFA 3AV2D 5GT0B 1AKCA 4ZBJC 3PD6B 5CPID 1MLYA 1TZYC 2ZSMA 4DBCA 2VGSA 3LELC 4PVFA 2OKJA 4H9OB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQ4 A;  4MY5 A;  4L0O A;  3A9Y A;  4WYC A;  1KKJ A;  1QGN A;  1BJO A;  3AEL A;  3CAI A;  9AAT A;  1CQ8 A;  2GMS A;  3E2Z B;  4WXG A;  1B8G A;  1IX6 A;  3N75 A;  1AHF A;  4GSA A;  1SZU A;  4F5L A;  1WST A;  3N5M A;  3FKD A;  2VGZ A;  1VEF A;  1BJO B;  1AMQ A;  2AY5 A;  4XQ2 A;  2VMU A;  1DGE A;  4UQV A;  2E7J A;  1LC7 A;  3FRK A;  1DTY A;  1YIZ A;  3PD6 A;  3FQA A;  4P7Y A;  4BQ0 A;  4IY7 A;  3MAD A;  3G7Q A;  4RJY A;  2BYL A;  3MKJ A;  1AY8 A;  1AMR A;  3BB8 A;  2VMX A;  2ORD A;  1ASD A;  2Z20 A;  1BJ4 A;  4R5F A;  3L8A A;  4Y0H A;  1G4V A;  4JF0 A;  5D5S A;  3OKS A;  4B9B A;  2VIA A;  3ATH A;  3ELP A;  4U1T A;  1QIR A;  1W3U A;  4F5M A;  5G0A A;  3VK2 A;  3QI6 A;  4B98 A;  1TAR A;  1LKC A;  1C4K A;  2OAT A;  3LVM A;  4QGR A;  1ECX A;  4F5F A;  4ADB A;  3RBF A;  4AZJ A;  2HP2 A;  3ASB A;  3P1T A;  5M46 A;  2HOY A;  3FVS A;  3AEM A;  1FG7 A;  2VMP A;  2V1P A;  3E9K A;  3IHJ A;  4FL0 A;  2YCN A;  1OHW A;  3EZS A;  1E5E A;  3QGU A;  3PDB B;  5C6U A;  2E54 A;  4ZDP A;  3OP7 A;  3VK3 A;  1AIC A;  2ZY5 A;  2HUU A;  2R5C B;  4LNJ A;  5M4D A;  3AOV A;  2CTZ A;  2ZC0 A;  3AEJ C;  5FT6 A;  4BMK A;  1DKA A;  1RV3 A;  1RVY A;  2W8J A;  2FN6 A;  4AH3 A;  1M4N A;  2XH1 A;  4F5H A;  2NMP A;  3A8U X;  3CBF A;  2FNU A;  2VGV A;  1C7O A;  3AEJ A;  3BCX A;  2VGU A;  4A0G A;  4WBT A;  4XAU A;  1TOG A;  1GCK A;  5DJ1 A;  3WZF A;  2Z9V A;  2W7L A;  1BJW A;  4F5I A;  3EI6 A;  1I29 A;  4U2H A;  2ZY4 A;  4IX8 A;  4CBR A;  2AY2 A;  1TOK A;  5DX5 A;  1MAP A;  4BA4 A;  4XJM A;  5DB5 A;  1ASN A;  1TOE A;  2EH6 A;  3JWB A;  4WLJ A;  3NYS A;  2WK9 A;  4Q31 A;  1OXP A;  1B9I A;  1N31 A;  2VI8 A;  2AY1 A;  1O61 A;  4W8I A;  1FC4 A;  1V2E A;  3E6G A;  4NOG A;  1GEY A;  3MC6 C;  5TF5 A;  3RCH B;  3LY1 A;  1UU0 A;  3AV7 A;  4ITX A;  2O0R A;  1GC4 A;  3N0L A;  2D64 A;  1IUG A;  3B1D A;  3NU8 A;  1WKH A;  3JW9 A;  1WYU A;  3LV2 A;  1I41 A;  4Y0D A;  1CL1 A;  2AAT A;  2PB0 A;  3GZD C;  4MQR A;  1N2T A;  4XJO A;  4GRX A;  3DC1 A;  3EI7 A;  1VJO A;  2OQX A;  4OCA A;  4PFN A;  2X8U A;  1M0P A;  2ZY2 A;  2R5E A;  1ART A;  1GEW A;  4PIW A;  3BN1 A;  4A0H A;  3EIB A;  3NUB A;  3WX9 A;  1O62 A;  4I8A A;  1ARG A;  2BWO A;  5G4J A;  2D65 A;  3FTB A;  3L44 A;  3PPL A;  4XJP A;  2W7F A;  1IAX A;  2VI9 A;  2CH2 A;  3F9T A;  4M2J A;  3EUC A;  3FVU A;  4E3R A;  4A6R A;  3ZRR A;  1CQ7 A;  4K2B A;  4CBS A;  2W7D A;  4JEW A;  1QZ9 A;  3BWN C;  3KE3 A;  4W5K A;  4ADC A;  3AEM C;  3BC8 A;  3E77 A;  5G09 A;  2CJD A;  1UKJ A;  4ZLV A;  2YHK A;  2EZ1 A;  4F5J A;  3RUY A;  1EQB A;  1RV4 A;  2VMV A;  2FYF A;  1GEX A;  1M0O A;  4ATP A;  4OC9 A;  4ZWM A;  2Z1Z A;  3BCA A;  5EIG B;  3UE8 A;  3FSL A;  3CQ6 A;  4WD2 A;  4E1O A;  3MC6 A;  1ASE A;  3HQT A;  3VOM A;  4XEW A;  1M6S A;  5E3K A;  4E3Q A;  3PDX A;  3WY7 A;  2AY7 A;  1YOO A;  1KKP A;  1ORD A;  4W91 A;  1AMA A;  2Z9X A;  1DFO A;  1JG8 A;  1BJN A;  3FFH A;  4WXB A;  4A6T A;  3RBL A;  1B5P A;  3E2Y A;  2Z9W A;  1TOJ A;  2VMR A;  5J8Q A;  1YAA A;  1MGV A;  3ZRP A;  2O1B A;  3AEN B;  3MAU A;  3NU7 A;  2CB1 A;  1W23 A;  2W7J A;  2CJG A;  2W8T A;  3GR9 A;  4ZDO A;  3EZ1 A;  1SFF A;  2X5F A;  1M0Q A;  3QPG A;  2R0T A;  2X5D A;  4ZSW A;  4DGT A;  2QMA A;  3FFR A;  5HDM A;  1ARI A;  1P3W A;  1CL2 A;  4XK1 A;  2FNI A;  1SPA A;  1DJU A;  3GSB A;  1KL2 A;  1WYV B;  4DQ6 A;  2HOX A;  2VMW A;  2EPJ A;  4R2N A;  3VK4 A;  3GBX A;  4LNM A;  1JS3 A;  2VLF A;  2ZJG A;  2TPL A;  2D63 A;  1DGD A;  1V72 A;  4ADE A;  2DKB A;  4F5K A;  3MBB A;  2VMQ A;  1AKA A;  1CJ0 A;  4F5G A;  1FG3 A;  4HF8 A;  3UWC A;  1IVR A;  4Q75 A;  3MEB A;  4EMY A;  1E5F A;  2DKJ A;  4IYO B;  1S09 A;  3KKI A;  1AAM A;  1W7N A;  3K40 A;  3HL2 A;  4AO4 A;  1LK9 A;  1D7R A;  1MDX A;  3G8M A;  4MKJ A;  2GQN A;  3WGC A;  3AEP A;  5G4I A;  1LS3 A;  3AEO A;  4RKC A;  1AHY A;  4F4E A;  1TPL A;  4WLH A;  4AO9 A;  2Z1Y A;  3A9X A;  2FM1 A;  3NNK A;  3QHX A;  2VMN A;  1KL1 A;  4IXS A;  1JF9 A;  1B5O A;  4MQP A;  1D7U A;  2VIB A;  1AIB A;  2BYJ A;  3A9Z A;  1G7W A;  4LNL A;  1YJZ A;  4WYF A;  1GC3 A;  3FVX A;  4W1W A;  4PFF A;  5EUE A;  3WKR A;  1WYT A;  1LC8 A;  2CY8 A;  3BS8 A;  5FT8 A;  3D6K A;  3NYT A;  1BT4 A;  4CXR A;  1TAS A;  5F9S A;  4WXF A;  4WYE A;  4ATQ A;  3ZZK A;  1M7Y A;  1UU1 A;  3GET A;  4LC3 A;  4A0R A;  2GB3 A;  1H1C A;  2BIE A;  1YJS A;  3ELE A;  1Z3Z A;  4OT8 A;  3QN6 A;  3BV0 A;  5E4Z A;  1MAQ A;  3RI6 A;  3AAT A;  2E7I A;  1KMJ A;  3GJU A;  1AJR A;  1BQD A;  2W7E A;  1B4X A;  4O6Z A;  1D7V A;  1J04 A;  3PA9 A;  4TMR A;  1ZC9 A;  2YCP A;  1DJE A;  1OAT A;  2BI2 A;  3DOD A;  4GE9 A;  2C44 A;  4R5Z A;  5K8B A;  5M49 A;  1ELQ A;  1EG5 A;  3RQ1 A;  1BS0 A;  3BCB A;  3QM2 A;  2Q7W A;  1CS1 A;  1ASG A;  3ACZ A;  1C0N A;  1PFF A;  2HP1 A;  2JG2 A;  8AAT A;  2VLH A;  2CFB A;  3DRD A;  1G7X A;  2AY6 A;  2WKA A;  4MKK A;  2F8J A;  3T32 A;  4IYO A;  1U08 A;  1D2F A;  2EZ2 A;  1W7M A;  1T3I A;  1IAY A;  2D66 A;  1S06 A;  2JJF A;  5E5I A;  1LW4 A;  4BHD A;  2HUF A;  3DR7 A;  4GDY A;  3JWA A;  4W1V A;  3E2Z A;  4EU1 A;  1CZE A;  2ZYJ A;  2VGT A;  2ZP7 A;  3I5T A;  3LVK A;  3R9A A;  1S07 A;  4ISY A;  1V2F A;  5F8V A;  3NX3 A;  4A72 A;  3A2B A;  3HDO A;  2YRI A;  3HLM A;  3LG0 A;  1RVU A;  1OHY A;  1Y4I A;  2HOZ A;  2BKW A;  2GMU A;  3DYD A;  1O4S A;  3EI8 A;  1AX4 A;  5EUN A;  1I43 A;  2BI5 A;  2OGA A;  3NRA A;  4UHO A;  1YNU A;  2ZY3 A;  4K2M A;  1ASM A;  4IXO A;  5HXX A;  1BW0 A;  3TFU A;  1MDO A;  1ASB A;  4M2K A;  4HVK A;  1CZC A;  2VMS A;  2YKX A;  1ASC A;  4R8D A;  1X2A A;  4ZDL A;  3FDD A;  4ZAS A;  2V0Y A;  3GZC A;  1ASL A;  4EB5 A;  1AY4 A;  1BQA A;  2VMY A;  2QLR A;  1IBJ A;  4EFF A;  4UOY A;  2W8W A;  2AY8 A;  2YKY A;  3EIA A;  3NDN A;  2D7Y A;  2CIN A;  2GSA A;  1ELU A;  4AOA A;  1ASA A;  1SF2 A;  1C7G A;  3ZZJ A;  1AJS B;  2W7K A;  4Q76 A;  2OGE A;  3DZZ A;  1WYT B;  1BKG A;  1WYU B;  2BHX A;  2DOU A;  2VYC A;  2YOB A;  4LW2 A;  1S0A A;  2W7M A;  1GC2 A;  2W8U A;  3DXW A;  4A00 A;  5D95 A;  1QJ5 A;  3R4T A;  5EIG A;  2PB2 A;  4MQQ A;  1X29 A;  3TAT A;  3VAX A;  1PG8 A;  3F0H A;  1X0M A;  2BWP A;  1AMS A;  1IX7 A;  3LVJ A;  2BI3 A;  4ITG A;  4K2I A;  3H7F A;  3TCM A;  4EB7 A;  1WKG A;  1YJY A;  2D61 A;  1TAT A;  1N8P A;  2VMZ A;  2R2N A;  2VMT A;  4RKD A;  1C9C A;  1ASF A;  2DR1 A;  1GD9 A;  3AOW A;  5I92 A;  7AAT A;  4OTL A;  3EI9 A;  1ARH A;  2G6W A;  2C7T A;  5EUD A;  1X28 A;  3B1C A;  3BWO A;  2W8V A;  3UAK A;  3BWN A;  4UHM A;  2WK8 A;  1YIY A;  2W7G A;  3ECD A;  1GC0 A;  1EJI A;  4WP0 A;  4JEZ A;  2CST A;  3FQ7 A;  2BIG A;  4M2M A;  4UHN A;  2BI9 A;  2CH1 A;  3DU4 A;  3DR4 A;  4KYO A;  4Y0I A;  2C0R A;  1LC5 A;  3ZRQ A;  1ZOB A;  2JJG A;  3MAF B;  1S08 A;  1AHG A;  3LWS A;  2YRR A;  1AHE A;  3PDB A;  4GE7 A;  2E7U A;  4MSO A;  3WLX A;  4JEX A;  1SVV A;  3B46 A;  4ZAH A;  3DXV A;  3M5U A;  4KAM A;  2JJE A;  3FCR A;  2WK7 A;  2AY9 A;  1CQ6 A;  4JEY A;  2VMO A;  1OXO A;  4GEB A;  5BJ4 A;  1M32 A;  4GE4 A;  2O7C A;  5HHY A;  3EI5 A;  1XI9 A;  2W7I A;  2JGT A;  4ZWV A;  3II0 A;  3PGY A;  4FFC A;  3QBO A;  1W7L A;  1TOI A;  2RFV A;  5G2Q A;  1MLZ A;  1V2D A;  4RAE A;  2Z61 A;  3K7Y A;  3P6K A;  4OYT A;  5EAV A;  4XJL A;  2PO3 A;  3MAF A;  2AY3 A;  3FDB A;  3WKS A;  5AX8 A;  3ISL A;  4KXK A;  2AY4 A;  2VGW A;  4JEV A;  3JTX A;  1QJ3 A;  1G4X A;  3NYU A;  1GDE A;  3Q8N A;  5DJ9 A;  4ZM3 A;  2BIA A;  4A0F A;  3NUI A;  2BWN A;  3ASA A;  3GZD A;  2JJH A;  1KMK A;  2FQ6 A;  4N0W A;  1VP4 A;  1LW5 A;  3NTJ A;  2CAN A;  1JS6 A;  3PAA A;  3I4J A;  3PIU A;  1MDZ A;  1IJI A;  2QBT A;  3CQ5 A;  3COG A;  3KGX A;  4W1X A;  1ARS A;  2QB3 A;  1ZOD A;  1AIA A;  1UU2 A;  4WYA A;  5FT5 A;  3WGB A;  4CXQ A;  5EFS A;  5M4B A;  1AY5 A;  2CJH A;  1DJ9 A;  3AEN A;  2EO5 A;  4IXZ A;  4Q6R A;  1QIT A;  4ZSY A;  4P3M A;  3TQX A;  3K28 A;  1QIS A;  2QA3 A;  1GBN A;  1C7N A;  2HZP A;  1I48 A;  1AAW A;  2YKU A;  1H0C A;  4WB0 A;  3KGW A;  1Z7D A;  1O69 A;  2BI1 A;  2XBN A;  5IWQ A;  5EAA A;  4ADD A;  4A6U A;  1D7S A;  5FT4 A;  2R5C A;  2EGY A;  1IX8 A;  2D7Z A;  3E2F A;  4J5U A;  1J32 A;  5JAY A;  1AJS A;  4LW4 A;  4ZM4 A;  1AKB A;  3HMU A;  4OMA A;  5EQC A;  4BA5 A;  2QB2 A;  1M0N A;  2YCT A;  3TFT A;  1SZS A;  1SZK A;  5BJ3 A;  3LVL B;  3RCH A;  2D5Y A;  4E77 A;  2ZSL A;  2C81 A;  1WYV A;  1OHV A;  2HUI A;  3PJ0 A;  2Z9U A;  3USF A;  4H51 A;  1AKC A;  3F6T A;  4WYG A;  3PD6 B;  3B1E A;  2W7H A;  1MLY A;  2HOR A;  5G2P A;  4AZK A;  2ZSM A;  4DBC A;  2VGS A;  2YKV A;  4JF1 A;  1B9H A;  4WB0 B;  3FQ8 A;  4TN4 A;  1AHX A;  4WYD A;  4PVF A;  4IW7 A;  4CVQ A;  2ZUK A;  3B8X A; 
#chains in the Genus database with same CATH topology
 4WNN A;  5AV6 A;  3A9Y A;  1M19 D;  1QGN A;  3N4R A;  4WXG A;  1B8G A;  1IX6 A;  5F99 B;  1ZLA B;  3H0L C;  4F5L A;  3N5M A;  4Z66 A;  3FKD A;  5GT3 A;  3W96 C;  3MGQ B;  1LC7 A;  1DTY A;  1YIZ A;  4BQ0 A;  3MKJ A;  3BB8 A;  2VMX A;  3WKJ B;  1BJ4 A;  4Y0H A;  4JF0 A;  3A1I A;  2Y2Q A;  4NE3 A;  5G0A A;  3C1C C;  2OAT A;  4QGR A;  4AZJ A;  2HP2 A;  5GXQ A;  5AV6 C;  3ASB A;  3X1T D;  3FVS A;  3LJA B;  3E9K A;  4R8P D;  3IHJ A;  4EO5 B;  1HTA A;  4ZDP A;  3VK3 A;  3LZ0 A;  1TZY A;  2R5C B;  4LNJ A;  3AOV A;  3AEJ C;  2ZC0 A;  2FN6 A;  4AH3 A;  2NMP A;  2NZD D;  1P3O B;  4OBV A;  5F99 A;  3AEJ A;  4A0G A;  1GCK A;  3WZF A;  1U35 C;  2Z9V A;  2NQB C;  1BJW A;  4F5I A;  4U2H A;  4IX8 A;  4YM6 B;  5DB5 A;  2FFF B;  3NYS A;  3MNN C;  5AV5 D;  3E6G A;  4NOG A;  1GEY A;  4J8W D;  4ITX A;  2D64 A;  1IUG A;  4WJ3 C;  2HUE C;  4WU8 C;  2NZD B;  5B40 C;  1CL1 A;  3GZD C;  2Y2M A;  5JA4 B;  1WWS A;  5F99 C;  3BN1 A;  3LZ0 D;  3REI A;  4I8A A;  5G4J A;  4XJP A;  3EPH A;  2W7F A;  4J8V A;  4XZQ D;  1IAX A;  4M2J A;  2CH2 A;  3I16 A;  3VP6 A;  3X1S C;  1P3K A;  5B31 A;  5GXQ D;  1CQ7 A;  3X1U A;  4JEW A;  4J8X B;  3KE3 A;  3E77 A;  1TAF B;  4WU9 A;  1EQB A;  4OC9 A;  2Z1Z A;  2DGL A;  3C1B B;  3TU4 B;  5B31 B;  3HQT A;  2ARO A;  3LZ0 B;  4E3Q A;  3AZH D;  1YOO A;  3O62 C;  5GT0 C;  5B31 G;  1JG8 A;  4Z5T D;  4WXB A;  3E2Y A;  5G49 B;  3AZJ A;  5B33 D;  1F66 B;  3AEN B;  4H9S C;  2CB1 A;  1W23 A;  3GR9 A;  3W1I A;  5FUG B;  5DNN B;  2R0T A;  4DGT A;  2BG1 A;  4G91 C;  1ARI A;  4XK1 A;  1DJU A;  4YM6 C;  1P3A A;  3GBX A;  4LNM A;  1JS3 A;  2VLF A;  4ADE A;  1DGD A;  1V72 A;  5B24 A;  3UTA A;  1FG3 A;  3UWC A;  4RIZ A;  3WA9 A;  1P34 A;  1S09 A;  3KKI A;  1AAM A;  1W7N A;  4AO4 A;  1P3L A;  1LS3 A;  4RKC A;  4WLH A;  4J8V C;  4AO9 A;  5KTB A;  2VMN A;  3A9Z A;  5BNX B;  1G7W A;  4W1W A;  4LD9 C;  3AL0 C;  4J8U C;  3UT9 A;  1M7Y A;  4QLC C;  3GET A;  4CAY B;  2BIE A;  1YJS A;  5E4Z A;  3A1K A;  2E7I A;  3GJU A;  1BQD A;  2W7E A;  1B4X A;  5B0Y C;  1J04 A;  3MNN A;  5JRG A;  2BI2 A;  1OAT A;  4R5Z A;  5K8B A;  2C44 A;  1ELQ A;  3QM2 A;  3AZJ C;  3REH A;  2RVQ C;  1G7X A;  3B6G D;  2Y2G A;  1D2F A;  1BH8 A;  2D66 A;  5E5I A;  3WCN A;  1P3G D;  4GDY A;  3JWA A;  3E2Z A;  2VGT A;  1F66 D;  2ZP7 A;  3LVK A;  5AV9 B;  4ISY A;  4WU9 C;  2YRI A;  5AVB D;  1Y4I A;  1O4S A;  3NRA A;  1YNU A;  4UUZ B;  3REK C;  1BW0 A;  5JA4 A;  1ASB A;  4HVK A;  1CZC A;  1X2A A;  3UTB A;  4RJ0 A;  3EIA A;  1KX4 D;  2CIN A;  4H9S A;  1SF2 A;  4G92 B;  1P3L D;  3AZK D;  1WYT B;  2YOB A;  4LW2 A;  3REI D;  5JRG C;  2FJ7 D;  3X1V B;  3DXW A;  1P34 D;  5B2I C;  5D95 A;  3MGS C;  1KX5 C;  3WA9 D;  1X29 A;  2PB2 A;  5EIG A;  3TAT A;  3VAX A;  1P3A B;  3UTA D;  4EB7 A;  3AZE C;  2CV5 D;  2R2N A;  2AEU A;  1GD9 A;  3AOW A;  5I92 A;  3EI9 A;  1ARH A;  2C7T A;  5EUD A;  5CPI B;  3UAK A;  2W8V A;  2W7G A;  3ECD A;  1GC0 A;  4WP0 A;  1N1J A;  2CST A;  2BYK A;  2CH1 A;  3DU4 A;  3DR4 A;  4KYO A;  2C0R A;  3B0C W;  1ZOB A;  4Z5T A;  3PDB A;  3WLX A;  2ARO B;  5KDM A;  3B6F C;  4JEX A;  3B46 A;  5GSU C;  3AZH A;  3W97 C;  2AY9 A;  4JEY A;  4GEB A;  5BJ4 A;  5B0Z D;  3W96 B;  3MGQ D;  3AV1 D;  1W7L A;  1TZY D;  4ZUX C;  2RFV A;  4RAE A;  1HQ3 C;  5EAV A;  2JSS A;  5B40 B;  3X1U D;  3FDB A;  3WKS A;  4LD9 A;  5B24 B;  5AX8 A;  3KWQ D;  1M19 C;  2AY4 A;  4JEV A;  3JTX A;  1P3I B;  1G4X A;  3NYU A;  1M1A D;  4Z2M H;  2BWN A;  1KMK A;  2FQ6 A;  4AWL B;  3AZN B;  1VP4 A;  3NTJ A;  1JS6 A;  3PIU A;  2QBT A;  4KUD B;  4EO5 C;  3WGB A;  4CXQ A;  1DJ9 A;  4HGA B;  3AEN A;  4IXZ A;  4Q6R A;  4ZSY A;  4P3M A;  2FJ7 B;  1H0C A;  3X1V C;  1P34 B;  2DGK A;  1D7S A;  1P3A C;  1T3U A;  4OMA A;  2QB2 A;  3WCO A;  2YCT A;  3C1B C;  1AOI D;  5AV6 D;  3LVL B;  3EPK A;  4E77 A;  2C81 A;  4K05 A;  4H51 A;  3F6T A;  4WYG A;  4WV4 B;  5CPK A;  3B1E A;  1H3O A;  3AV2 A;  3FQ8 A;  4WYD A;  5AV9 C;  4IW7 A;  3B8X A;  5BO0 A;  5CHL B;  3AZL A;  2PYO C;  4WYC A;  3AEL A;  9AAT A;  2GMS A;  3E2Z B;  4R8P A;  3N75 A;  1AHF A;  2HIO D;  2KFP A;  3AZI C;  1AMQ A;  5AV5 C;  4P7Y A;  4RJY A;  2OKK A;  4KHA B;  5B40 D;  4R5F A;  5JRG B;  3X1S A;  1G4V A;  3L8A A;  5D5S A;  3OKS A;  4B9B A;  1P3F B;  3ELP A;  3AZF D;  1W3U A;  1ZLA A;  3HVY A;  1ECX A;  4Z66 D;  3MGS A;  5M46 A;  3P1T A;  1ZLA D;  1W2E A;  3LZ0 C;  4JJN A;  3AEM A;  4DRB A;  3KXB C;  3AZF A;  1OHW A;  1E5E A;  3A6N D;  5C6U A;  3KUY B;  3X1S D;  1AIC A;  4QLC B;  5M4D A;  5FT6 A;  4BMK A;  3O62 A;  5AV8 B;  3B0D C;  5DNN C;  5B0Y B;  4WBT A;  5CPI A;  3AYW B;  5B32 B;  1P3P A;  1AOI B;  2ZY4 A;  3LJA D;  3W99 B;  4KGC B;  1OXP A;  5GT0 D;  1B9I A;  4ZBJ B;  3MGP D;  1B6W A;  4Z5T C;  3MC6 C;  1UU0 A;  1GC4 A;  4H9P A;  3B1D A;  1WKH A;  5CPK D;  1JFI B;  5B24 C;  4XJO A;  3W1H A;  3DC1 A;  3EI7 A;  2ZY2 A;  3N4S A;  5B1M B;  1ART A;  1AOI A;  3TU4 D;  4A0H A;  3EIB A;  3AZN C;  1ARG A;  3R45 B;  3G0T A;  3EUC A;  3ZRR A;  4CBS A;  2W7D A;  1F1E A;  3AEM C;  1PZR A;  4ZLV A;  2CWE A;  4F5J A;  3WTP D;  1U35 A;  1RV4 A;  3AZG D;  1GEX A;  2F2A C;  4ZWM A;  3BCA A;  3CQ6 A;  4WD2 A;  3VOM A;  1M6S A;  3KWQ A;  4LD9 D;  1BJN A;  5CPJ D;  4A6T A;  3NQU A;  4QLC D;  4CSR A;  5B2J C;  5BT1 C;  1YAA A;  3ZRP A;  2O1B A;  3MAU A;  2IO5 C;  1P3K C;  4XUJ B;  2W8T A;  3EZ1 A;  2X5F A;  5B0Y D;  3EG5 B;  3V9R B;  3FFR A;  3C1C A;  1SPA A;  1KL2 A;  2EPJ A;  2ZJG A;  2QSR A;  2TPL A;  2D63 A;  2DKB A;  4F5K A;  3MGP B;  1CJ0 A;  4F5G A;  4YM6 A;  4J8W B;  4Q75 A;  1P3G C;  3MEB A;  4EMY A;  1E5F A;  2DKJ A;  3LEL D;  3K40 A;  3HL2 A;  3W98 B;  1P3M C;  4OBU A;  1LK9 A;  4MKJ A;  3WAA B;  1PMO A;  3AN2 A;  2Z1Y A;  3NNK A;  3REL B;  5DNM A;  1KL1 A;  1B5O A;  3REK D;  3AZE B;  3FVX A;  3WKR A;  4PFF A;  1LC8 A;  5GSU A;  3BS8 A;  5FT8 A;  3LZ1 A;  3D6K A;  3REJ B;  5F9S A;  4ATQ A;  3ZZK A;  2F8N A;  5GXQ B;  4A0R A;  1Z3Z A;  1P3L C;  3QN6 A;  3BV0 A;  1MAQ A;  3AAT A;  2FJ7 C;  5E5A A;  1P34 C;  4TMR A;  1BFM A;  3WTP B;  3NQU B;  3C1C D;  3REJ A;  3B6F B;  3X1T C;  1C0N A;  3MGQ A;  1PFF A;  2HP1 A;  2VLH A;  2CFB A;  3DRD A;  1KU5 A;  5B0Z A;  1HQ3 A;  4Z5T B;  4XUJ A;  2HUF A;  3DR7 A;  1CZE A;  5E5A D;  3I5T A;  2NZD C;  4J8X A;  1V2F A;  1M18 B;  3NX3 A;  3A2B A;  2GMU A;  3MGR C;  5EUN A;  4WZS B;  4UHO A;  3WTP A;  1U35 D;  5HXX A;  3B6F D;  3R45 A;  1ID3 D;  5GSU D;  3TFU A;  2X3L A;  2VMS A;  2YKX A;  3B6G B;  1ASL A;  5B1M A;  1AY4 A;  3MNN D;  5B0Z C;  1BQA A;  4CSR B;  1IBJ A;  4KUD C;  4UOY A;  4EFF A;  1P3B A;  3MGQ C;  2BYK B;  4J8W C;  4ZUX D;  4AOA A;  3X1V A;  3ZZJ A;  4WU8 D;  2OGE A;  1P3M B;  3DZZ A;  2DOU A;  1P3B C;  2W8U A;  3X1U C;  3AZE A;  3R4T A;  4ITG A;  3AFA B;  4K2I A;  1M1A C;  3H7F A;  3TCM A;  1WKG A;  2VMZ A;  1N8P A;  4RKD A;  3REH C;  1BH8 B;  2FKI A;  3FZ6 A;  7AAT A;  2G6W A;  4XZQ C;  1X28 A;  5GXQ C;  3MGP A;  1YIY A;  3AFA A;  4XUJ C;  2BIG A;  4M2M A;  3ZRQ A;  1KX3 B;  1AHG A;  1P3A D;  1F66 A;  4ZAH A;  3M5U A;  3FCR A;  3W99 C;  3AZI B;  3O62 D;  3B6G A;  3EI5 A;  3VH5 T;  1M18 A;  3QBO A;  1TOI A;  5CP6 A;  1P3G B;  3K7Y A;  5AV9 D;  4XJL A;  4NE5 A;  3MAF A;  3WKJ D;  3WAA C;  1P3F C;  4YS3 A;  3HT4 A;  2PYO D;  3ISL A;  1QJ3 A;  3MGR A;  4ZM3 A;  2BIA A;  4WNN B;  5AV6 B;  3GZD A;  3W99 A;  4N0W A;  1LW5 A;  4R8P B;  3AZM D;  3PAA A;  3AN2 C;  1AIA A;  4WYA A;  3X1S B;  5M4B A;  1AY5 A;  1KX5 A;  2JE5 A;  3HBX A;  1QIS A;  2QA3 A;  2HZP A;  1C7N A;  1P3O D;  4J8V D;  5FT4 A;  4J5U A;  3E2F A;  5JAY A;  1J32 A;  1AJS A;  3AYW D;  1KX3 A;  5EQC A;  3W97 A;  3TFT A;  1SZK A;  5BJ3 A;  3REL A;  2ZSL A;  3KFU G;  2Z9U A;  5BO0 B;  3AZL B;  5G2P A;  4JF1 A;  5B32 G;  3MVD D;  4TN4 A;  1AHX A;  4WU9 B;  3N7N A;  2ZUK A;  4MY5 A;  3A6N A;  1BJO A;  3AZJ D;  5AVC A;  3W97 B;  4GSA A;  1SZU A;  3B6G C;  2VGZ A;  1VEF A;  3A6N B;  3MGP C;  1BJO B;  4XQ2 A;  2E7J A;  3PD6 A;  3FQA A;  3N4X A;  4WU9 D;  1ASD A;  2Z20 A;  2ORD A;  5AVB C;  3FD0 A;  3MGS B;  4U1T A;  1QIR A;  1M19 B;  3VK2 A;  3QI6 A;  4B98 A;  4F5F A;  5B31 D;  2HIO B;  2VMP A;  2V1P A;  4H9Q B;  2ZM5 A;  3EZS A;  5B2J A;  3REJ C;  1EQZ D;  3PDB B;  2E54 A;  1S32 B;  3OP7 A;  2HUU A;  2ZY5 A;  4H9N A;  3VH6 W;  2CTZ A;  5B33 B;  1DKA A;  1RV3 A;  1M4N A;  4F5H A;  4Z2M G;  2IO5 B;  3A8U X;  2FNU A;  1P3K B;  2XD1 A;  5GT3 D;  5AVC B;  1C7O A;  3BCX A;  4H9O A;  1KX3 C;  4XAU A;  5DJ1 A;  3EI6 A;  1I29 A;  2CV5 C;  4CBR A;  4BA4 A;  2F8N H;  1ASN A;  3JWB A;  4WLJ A;  4Q31 A;  2WK9 A;  1N31 A;  1O61 A;  4W8I A;  4JJN B;  1V2E A;  5AY8 C;  5TF5 A;  3RCH B;  3AV7 A;  2RIQ A;  3MVD B;  3JW9 A;  1WYU A;  3LV2 A;  1I41 A;  4Y0D A;  2AAT A;  2PB0 A;  4MQR A;  3UT9 C;  4GRX A;  2OQX A;  4OCA A;  3REL D;  4PFN A;  2X8U A;  1M0P A;  2R5E A;  4YS3 C;  3W97 D;  2FJ7 A;  4AWL C;  3WX9 A;  3WAA A;  3AYW A;  3AZK A;  3AZH B;  2BWO A;  3FTB A;  3F9T A;  2BYM B;  5CPJ B;  3AV1 C;  3WTP E;  1P3O A;  3FVU A;  4E3R A;  3X1T A;  4J8L A;  2Y2P A;  1QZ9 A;  4G92 C;  3BWN C;  4ADC A;  3BC8 A;  5G09 A;  1P3B B;  3AZF B;  2YHK A;  3AZM A;  1P3P C;  2FYF A;  1M0O A;  2VQR A;  5EIG B;  3X1T B;  3MC6 A;  1H3O B;  3H0R C;  2AY7 A;  3KXB B;  3AZL C;  2Z9X A;  1DFO A;  1EQZ B;  3FFH A;  3RBL A;  1B5P A;  5AV9 A;  1TOJ A;  2VMR A;  1MGV A;  3VH5 A;  3W98 D;  3NU7 A;  5CP6 D;  1M19 A;  2W7J A;  1M18 D;  4ZDO A;  1SFF A;  1M0Q A;  3JZL A;  2X5D A;  4ZSW A;  3AZG B;  1CL2 A;  2ARO C;  4UPK A;  3C1B D;  1AOI C;  3GSB A;  4DQ6 A;  2HOX A;  4KGC C;  2L5A A;  3MBB A;  4JJN C;  1PMM A;  1IVR A;  1XEY A;  5BNV A;  3G8M A;  3AZK B;  5G4I A;  3AEO A;  3UT9 B;  1AHY A;  1TPL A;  5B2I B;  3WA9 B;  3QHX A;  1KX4 A;  3EPJ A;  1JF9 A;  3UTA B;  4MQP A;  1ID3 C;  5B1L C;  2BYJ A;  3REH B;  2HIO C;  4WYF A;  5EUE A;  1WYT A;  2CY8 A;  3NYT A;  3AV2 C;  1TAS A;  4WYE A;  2F8N G;  1S32 C;  5CPI C;  1UU1 A;  4LC3 A;  4WU8 A;  5AVB A;  5AV8 C;  1KMJ A;  1P3B D;  4O6Z A;  1D7V A;  3AZF C;  3PA9 A;  1ZC9 A;  1A7W A;  1N1J B;  4DQY B;  3DOD A;  5B32 C;  4GE9 A;  5M49 A;  1EG5 A;  3RQ1 A;  1BS0 A;  3BCB A;  5GSU B;  1ASG A;  3NQJ A;  3REH D;  3ACZ A;  3KXB D;  4NFT A;  3O62 B;  2F8J A;  3T32 A;  1U08 A;  5B33 A;  2JJF A;  3AZN A;  1S06 A;  3W96 D;  1LW4 A;  4BHD A;  4W1V A;  1HQ3 B;  3LZ1 C;  3R9A A;  4WU8 B;  1S07 A;  4XUJ D;  3HDO A;  5DNN D;  3LG0 A;  1OHY A;  2HOZ A;  2BKW A;  3EI8 A;  1AX4 A;  2PYO B;  1I43 A;  2BI5 A;  2OGA A;  5DNM C;  3AFA D;  1ASM A;  4IXO A;  5B1M C;  4X23 A;  3NQJ B;  4ZDL A;  3FDD A;  4R8P C;  4ZAS A;  3GZC A;  2VMY A;  2QLR A;  2W8W A;  2AY8 A;  2LY8 A;  2D7Y A;  1ELU A;  1ASA A;  1AJS B;  2W7K A;  4J8X C;  1BKG A;  2W7M A;  2VYC A;  3WAA D;  1GC2 A;  3VH6 A;  1R4V A;  1QJ5 A;  4MQQ A;  3UTB C;  2A1V A;  1AMS A;  1IX7 A;  2BI3 A;  1YJY A;  3TU4 C;  1TAT A;  1C9C A;  4DRA A;  2DR1 A;  3AN2 D;  4J8W A;  3BWN A;  5AV5 A;  2WK8 A;  1EJI A;  3W98 A;  3FQ7 A;  4UHN A;  2BI9 A;  4Y0I A;  3MAF B;  3WTP C;  3KWQ B;  3AZG C;  3LWS A;  1AHE A;  1P3I D;  3AYW C;  4MSO A;  2E7U A;  1SVV A;  3DXV A;  5F99 D;  4KAM A;  2WK7 A;  5B32 A;  3VH6 T;  2NZD A;  5HHY A;  2W7I A;  2JGT A;  3II0 A;  3PGY A;  5AV8 A;  2Z61 A;  5B2J D;  4QLC A;  3FZ7 A;  5CPJ A;  5AVB B;  4H9P B;  2AY3 A;  3MGR B;  4KXK A;  2VGW A;  4XZQ A;  1GDE A;  3Q8N A;  4YS3 B;  3NUI A;  2F8N D;  2NQB A;  3ASA A;  3AZG A;  3I4J A;  4RLG A;  1MDZ A;  5B0Z B;  1IJI A;  3CQ5 A;  3COG A;  5FT5 A;  2QB3 A;  4X23 C;  3KUY D;  3AV1 B;  2EO5 A;  1QIT A;  1P3M D;  3KGW A;  5AVC D;  2G5I C;  5EAA A;  4ADD A;  2R5C A;  1IX8 A;  2D7Z A;  2EGY A;  4ZM4 A;  4BA5 A;  3HMU A;  5BNX A;  5BS7 C;  2CV5 B;  3AZJ B;  1SZS A;  2F8N B;  3GWP A;  4YM6 D;  3RCH A;  1WYV A;  1OHV A;  3AZM B;  2HUI A;  2W8S A;  1BH9 B;  2W7H A;  2HOR A;  4AZK A;  2YKV A;  1B9H A;  4WB0 B;  2HUE B;  4NE6 A;  5CPK B;  1TAF A;  3CQ4 A;  5GT0 A;  2J8P A;  4L0O A;  1KX3 D;  1KKJ A;  1EQZ A;  3CAI A;  4G91 B;  1CQ8 A;  4Z66 B;  1S32 A;  1WST A;  5FUG A;  2AY5 A;  4J8U D;  2VMU A;  1DGE A;  4UQV A;  5AY8 D;  5B1L A;  3FRK A;  5E5A C;  4IY7 A;  4RIT A;  3MAD A;  3G7Q A;  2BYL A;  2G7J A;  1AY8 A;  1AMR A;  2XD5 A;  2VIA A;  4KUD A;  3MGR D;  3ATH A;  4F5M A;  4H63 Q;  1TAR A;  1LKC A;  1C4K A;  4H9R B;  1M1A B;  3LVM A;  4H9Q A;  4YS3 D;  3RBF A;  4ADB A;  5B1L B;  2HOY A;  3WKJ A;  1FG7 A;  2RVQ D;  4FL0 A;  3EPL A;  2YCN A;  4KUD D;  3QGU A;  4J8U B;  3TU4 A;  2Y2J A;  2W8J A;  1RVY A;  3FZ8 A;  1F66 C;  2XH1 A;  3CBF A;  2VGV A;  3MVD A;  4J8U A;  2VGU A;  1TOG A;  2W7L A;  2AY2 A;  1TOK A;  5DX5 A;  1MAP A;  5C3I C;  4XJM A;  1TOE A;  2EH6 A;  3AZL D;  1B67 A;  2VI8 A;  2AY1 A;  1FC4 A;  3LJA A;  4CAY A;  3LY1 A;  2Y2I A;  2O0R A;  3N0L A;  3NU8 A;  5CP6 C;  1N2T A;  5B2I D;  1KX5 D;  3WA9 C;  1VJO A;  3REK B;  1GEW A;  4PIW A;  3AZE D;  3NUB A;  3W99 D;  1O62 A;  2D65 A;  3L44 A;  3PPL A;  4KGC D;  4LD9 B;  2WB6 A;  2VI9 A;  3W1J A;  5AV5 B;  4JJN D;  2PYO A;  4A6R A;  4K2B A;  4W5K A;  2YFW A;  3WKJ C;  1P3F D;  2CJD A;  1UKJ A;  1ID3 A;  3B6F A;  1KX5 B;  2EZ1 A;  1KAF A;  3RUY A;  2VMV A;  4ATP A;  2NQB D;  3UE8 A;  3FSL A;  5B1L D;  4E1O A;  3VH5 W;  1ASE A;  4XEW A;  4H9R A;  1M1A A;  5E3K A;  3PDX A;  3WY7 A;  2BYM A;  3AZM C;  1KKP A;  1ORD A;  4W91 A;  1AMA A;  1S32 D;  1Z2C B;  2Z9W A;  1HQ3 D;  3LEL B;  5J8Q A;  3LZ1 B;  5AV8 D;  3B0D B;  2CJG A;  3AV1 A;  1P3O C;  2DF4 C;  5GT3 B;  3KSY A;  3QPG A;  1BH9 A;  3KWQ C;  2QMA A;  5DNM B;  5B32 D;  5HDM A;  1U35 B;  2NQB B;  1P3W A;  2FNI A;  1WYV B;  2VMW A;  4R2N A;  3VK4 A;  2VMQ A;  1AKA A;  4HF8 A;  1KX4 B;  4ZUX B;  3MVD C;  3LZ1 D;  4IYO B;  5CP6 B;  1D7R A;  1MDX A;  4RM1 A;  3WGC A;  2GQN A;  3AEP A;  3REI B;  4F4E A;  5BNV B;  4M6B A;  3X1V D;  5BS7 A;  3A9X A;  4ZUX A;  2FM1 A;  2AEV A;  3UTB B;  1P3M A;  3C1C B;  5DNM D;  4IXS A;  3AFA C;  3V9R A;  3H0M C;  5B1M D;  1D7U A;  2CV5 A;  2VIB A;  1AIB A;  4H9N B;  4LNL A;  4UUZ A;  1YJZ A;  1GC3 A;  3KUY A;  2DGM A;  3AZH C;  4XZQ B;  1BT4 A;  4CXR A;  4WXF A;  4HGA C;  5B33 C;  2GB3 A;  2YFV A;  1H1C A;  3ELE A;  4J8X D;  4OT8 A;  3RI6 A;  2EYQ A;  1AJR A;  2YCP A;  3UTB D;  4KHA A;  1DJE A;  3AZI A;  5B0Y A;  2Q7W A;  5B31 C;  1CS1 A;  2JG2 A;  8AAT A;  3P5J B;  3IP4 C;  3AZI D;  2AY6 A;  2WKA A;  4MKK A;  4IYO A;  3MNN B;  3H9X A;  3REJ D;  1EQZ C;  5DNN A;  2EZ2 A;  1W7M A;  1T3I A;  1IAY A;  1TZY B;  2DQN C;  2F8N K;  4EU1 A;  2ZYJ A;  1P3I A;  4CVQ A;  5F8V A;  4A72 A;  5GT3 C;  3HLM A;  2Y2N A;  1RVU A;  3DYD A;  2ZY3 A;  1P3I C;  4K2M A;  2Y2H A;  4Z66 C;  1MDO A;  4M2K A;  1P3F A;  1ZLA C;  1ASC A;  4R8D A;  2V0Y A;  2JIS A;  4EB5 A;  3REK A;  3AN2 B;  3A6N C;  2YKY A;  4X23 B;  3NDN A;  2GSA A;  4KGC A;  1C7G A;  4Q76 A;  2Y2O A;  1WYU B;  2BHX A;  1S0A A;  3UT9 D;  3LEL A;  4A00 A;  5G49 A;  1P3P B;  1PG8 A;  3F0H A;  1X0M A;  3REL C;  2BWP A;  3LVJ A;  2UWX A;  2D61 A;  1ID3 B;  2VMT A;  1ASF A;  3LJA C;  2YFW B;  3B0C T;  1WWI A;  1Q9C A;  4OTL A;  4X23 D;  3KUY C;  3B1C A;  3BWO A;  4UHM A;  2Y2L A;  1ULY A;  5B2J B;  1P3L B;  4JEZ A;  2JCH A;  5CPK C;  1LC5 A;  5AVC C;  5B24 D;  2JJG A;  1P3P D;  1S08 A;  2YRR A;  4GE7 A;  2Y2K A;  3C1B A;  1P3G A;  2JJE A;  1CQ6 A;  3W96 A;  3AZN D;  2VMO A;  1OXO A;  5C3I B;  1M32 A;  4GE4 A;  2O7C A;  3KXB A;  4E45 A;  1XI9 A;  1KX4 C;  4ZWV A;  4FFC A;  5AY8 B;  5G2Q A;  1MLZ A;  1V2D A;  3P6K A;  5E5A B;  3W98 C;  4OYT A;  3AZK C;  2PO3 A;  1M18 C;  3REI C;  5JRG D;  4E44 A;  4J8V B;  3MGS D;  3UTA C;  2G5H C;  2ARO D;  5DJ9 A;  4A0F A;  2JJH A;  5B40 A;  2CAN A;  3AV2 B;  3KGX A;  4W1X A;  1ARS A;  1JFI A;  1ZOD A;  1UU2 A;  3B0B A;  5CPJ C;  5EFS A;  5AY8 A;  2CJH A;  5B2I A;  5BT1 D;  3TQX A;  3K28 A;  2HIO A;  1GBN A;  1P3K D;  1I48 A;  2YKU A;  1AAW A;  4WB0 A;  3X1U B;  1Z7D A;  1O69 A;  2BI1 A;  2XBN A;  5IWQ A;  4A6U A;  5KDM B;  4LW4 A;  1AKB A;  1M0N A;  2YFV B;  2D5Y A;  3PJ0 A;  3USF A;  3AV2 D;  5GT0 B;  1AKC A;  4ZBJ C;  3PD6 B;  5CPI D;  1MLY A;  1TZY C;  2ZSM A;  4DBC A;  2VGS A;  3LEL C;  4PVF A;  2OKJ A;  4H9O B; 
#chains in the Genus database with same CATH homology
 4WNN A;  5AV6 A;  3A9Y A;  1M19 D;  1QGN A;  3N4R A;  4WXG A;  1B8G A;  1IX6 A;  5F99 B;  1ZLA B;  3H0L C;  4F5L A;  3N5M A;  4Z66 A;  3FKD A;  5GT3 A;  3W96 C;  3MGQ B;  1LC7 A;  1DTY A;  1YIZ A;  4BQ0 A;  3MKJ A;  3BB8 A;  2VMX A;  3WKJ B;  1BJ4 A;  4Y0H A;  4JF0 A;  3A1I A;  2Y2Q A;  4NE3 A;  5G0A A;  3C1C C;  2OAT A;  4QGR A;  4AZJ A;  2HP2 A;  5GXQ A;  5AV6 C;  3ASB A;  3X1T D;  3FVS A;  3LJA B;  3E9K A;  4R8P D;  3IHJ A;  4EO5 B;  1HTA A;  4ZDP A;  3VK3 A;  3LZ0 A;  1TZY A;  2R5C B;  4LNJ A;  3AOV A;  3AEJ C;  2ZC0 A;  2FN6 A;  4AH3 A;  2NMP A;  2NZD D;  1P3O B;  4OBV A;  5F99 A;  3AEJ A;  4A0G A;  1GCK A;  3WZF A;  1U35 C;  2Z9V A;  2NQB C;  1BJW A;  4F5I A;  4U2H A;  4IX8 A;  4YM6 B;  5DB5 A;  2FFF B;  3NYS A;  3MNN C;  5AV5 D;  3E6G A;  4NOG A;  1GEY A;  4J8W D;  4ITX A;  2D64 A;  1IUG A;  4WJ3 C;  2HUE C;  4WU8 C;  2NZD B;  5B40 C;  1CL1 A;  3GZD C;  2Y2M A;  5JA4 B;  1WWS A;  5F99 C;  3BN1 A;  3LZ0 D;  3REI A;  4I8A A;  5G4J A;  4XJP A;  3EPH A;  2W7F A;  4J8V A;  4XZQ D;  1IAX A;  4M2J A;  2CH2 A;  3I16 A;  3VP6 A;  3X1S C;  1P3K A;  5B31 A;  5GXQ D;  1CQ7 A;  3X1U A;  4JEW A;  4J8X B;  3KE3 A;  3E77 A;  1TAF B;  4WU9 A;  1EQB A;  4OC9 A;  2Z1Z A;  2DGL A;  3C1B B;  3TU4 B;  5B31 B;  3HQT A;  2ARO A;  3LZ0 B;  4E3Q A;  3AZH D;  1YOO A;  3O62 C;  5GT0 C;  5B31 G;  1JG8 A;  4Z5T D;  4WXB A;  3E2Y A;  5G49 B;  3AZJ A;  5B33 D;  1F66 B;  3AEN B;  4H9S C;  2CB1 A;  1W23 A;  3GR9 A;  3W1I A;  5FUG B;  5DNN B;  2R0T A;  4DGT A;  2BG1 A;  4G91 C;  1ARI A;  4XK1 A;  1DJU A;  4YM6 C;  1P3A A;  3GBX A;  4LNM A;  1JS3 A;  2VLF A;  4ADE A;  1DGD A;  1V72 A;  5B24 A;  3UTA A;  1FG3 A;  3UWC A;  4RIZ A;  3WA9 A;  1P34 A;  1S09 A;  3KKI A;  1AAM A;  1W7N A;  4AO4 A;  1P3L A;  1LS3 A;  4RKC A;  4WLH A;  4J8V C;  4AO9 A;  5KTB A;  2VMN A;  3A9Z A;  5BNX B;  1G7W A;  4W1W A;  4LD9 C;  3AL0 C;  4J8U C;  3UT9 A;  1M7Y A;  4QLC C;  3GET A;  4CAY B;  2BIE A;  1YJS A;  5E4Z A;  3A1K A;  2E7I A;  3GJU A;  1BQD A;  2W7E A;  1B4X A;  5B0Y C;  1J04 A;  3MNN A;  5JRG A;  2BI2 A;  1OAT A;  4R5Z A;  5K8B A;  2C44 A;  1ELQ A;  3QM2 A;  3AZJ C;  3REH A;  2RVQ C;  1G7X A;  3B6G D;  2Y2G A;  1D2F A;  1BH8 A;  2D66 A;  5E5I A;  3WCN A;  1P3G D;  4GDY A;  3JWA A;  3E2Z A;  2VGT A;  1F66 D;  2ZP7 A;  3LVK A;  5AV9 B;  4ISY A;  4WU9 C;  2YRI A;  5AVB D;  1Y4I A;  1O4S A;  3NRA A;  1YNU A;  4UUZ B;  3REK C;  1BW0 A;  5JA4 A;  1ASB A;  4HVK A;  1CZC A;  1X2A A;  3UTB A;  4RJ0 A;  3EIA A;  1KX4 D;  2CIN A;  4H9S A;  1SF2 A;  4G92 B;  1P3L D;  3AZK D;  1WYT B;  2YOB A;  4LW2 A;  3REI D;  5JRG C;  2FJ7 D;  3X1V B;  3DXW A;  1P34 D;  5B2I C;  5D95 A;  3MGS C;  1KX5 C;  3WA9 D;  1X29 A;  2PB2 A;  5EIG A;  3TAT A;  3VAX A;  1P3A B;  3UTA D;  4EB7 A;  3AZE C;  2CV5 D;  2R2N A;  2AEU A;  1GD9 A;  3AOW A;  5I92 A;  3EI9 A;  1ARH A;  2C7T A;  5EUD A;  5CPI B;  3UAK A;  2W8V A;  2W7G A;  3ECD A;  1GC0 A;  4WP0 A;  1N1J A;  2CST A;  2BYK A;  2CH1 A;  3DU4 A;  3DR4 A;  4KYO A;  2C0R A;  3B0C W;  1ZOB A;  4Z5T A;  3PDB A;  3WLX A;  2ARO B;  5KDM A;  3B6F C;  4JEX A;  3B46 A;  5GSU C;  3AZH A;  3W97 C;  2AY9 A;  4JEY A;  4GEB A;  5BJ4 A;  5B0Z D;  3W96 B;  3MGQ D;  3AV1 D;  1W7L A;  1TZY D;  4ZUX C;  2RFV A;  4RAE A;  1HQ3 C;  5EAV A;  2JSS A;  5B40 B;  3X1U D;  3FDB A;  3WKS A;  4LD9 A;  5B24 B;  5AX8 A;  3KWQ D;  1M19 C;  2AY4 A;  4JEV A;  3JTX A;  1P3I B;  1G4X A;  3NYU A;  1M1A D;  4Z2M H;  2BWN A;  1KMK A;  2FQ6 A;  4AWL B;  3AZN B;  1VP4 A;  3NTJ A;  1JS6 A;  3PIU A;  2QBT A;  4KUD B;  4EO5 C;  3WGB A;  4CXQ A;  1DJ9 A;  4HGA B;  3AEN A;  4IXZ A;  4Q6R A;  4ZSY A;  4P3M A;  2FJ7 B;  1H0C A;  3X1V C;  1P34 B;  2DGK A;  1D7S A;  1P3A C;  1T3U A;  4OMA A;  2QB2 A;  3WCO A;  2YCT A;  3C1B C;  1AOI D;  5AV6 D;  3LVL B;  3EPK A;  4E77 A;  2C81 A;  4K05 A;  4H51 A;  3F6T A;  4WYG A;  4WV4 B;  5CPK A;  3B1E A;  1H3O A;  3AV2 A;  3FQ8 A;  4WYD A;  5AV9 C;  4IW7 A;  3B8X A;  5BO0 A;  5CHL B;  3AZL A;  2PYO C;  4WYC A;  3AEL A;  9AAT A;  2GMS A;  3E2Z B;  4R8P A;  3N75 A;  1AHF A;  2HIO D;  2KFP A;  3AZI C;  1AMQ A;  5AV5 C;  4P7Y A;  4RJY A;  2OKK A;  4KHA B;  5B40 D;  4R5F A;  5JRG B;  3X1S A;  1G4V A;  3L8A A;  5D5S A;  3OKS A;  4B9B A;  1P3F B;  3ELP A;  3AZF D;  1W3U A;  1ZLA A;  3HVY A;  1ECX A;  4Z66 D;  3MGS A;  5M46 A;  3P1T A;  1ZLA D;  1W2E A;  3LZ0 C;  4JJN A;  3AEM A;  4DRB A;  3KXB C;  3AZF A;  1OHW A;  1E5E A;  3A6N D;  5C6U A;  3KUY B;  3X1S D;  1AIC A;  4QLC B;  5M4D A;  5FT6 A;  4BMK A;  3O62 A;  5AV8 B;  3B0D C;  5DNN C;  5B0Y B;  4WBT A;  5CPI A;  3AYW B;  5B32 B;  1P3P A;  1AOI B;  2ZY4 A;  3LJA D;  3W99 B;  4KGC B;  1OXP A;  5GT0 D;  1B9I A;  4ZBJ B;  3MGP D;  1B6W A;  4Z5T C;  3MC6 C;  1UU0 A;  1GC4 A;  4H9P A;  3B1D A;  1WKH A;  5CPK D;  1JFI B;  5B24 C;  4XJO A;  3W1H A;  3DC1 A;  3EI7 A;  2ZY2 A;  3N4S A;  5B1M B;  1ART A;  1AOI A;  3TU4 D;  4A0H A;  3EIB A;  3AZN C;  1ARG A;  3R45 B;  3G0T A;  3EUC A;  3ZRR A;  4CBS A;  2W7D A;  1F1E A;  3AEM C;  1PZR A;  4ZLV A;  2CWE A;  4F5J A;  3WTP D;  1U35 A;  1RV4 A;  3AZG D;  1GEX A;  2F2A C;  4ZWM A;  3BCA A;  3CQ6 A;  4WD2 A;  3VOM A;  1M6S A;  3KWQ A;  4LD9 D;  1BJN A;  5CPJ D;  4A6T A;  3NQU A;  4QLC D;  4CSR A;  5B2J C;  5BT1 C;  1YAA A;  3ZRP A;  2O1B A;  3MAU A;  2IO5 C;  1P3K C;  4XUJ B;  2W8T A;  3EZ1 A;  2X5F A;  5B0Y D;  3EG5 B;  3V9R B;  3FFR A;  3C1C A;  1SPA A;  1KL2 A;  2EPJ A;  2ZJG A;  2QSR A;  2TPL A;  2D63 A;  2DKB A;  4F5K A;  3MGP B;  1CJ0 A;  4F5G A;  4YM6 A;  4J8W B;  4Q75 A;  1P3G C;  3MEB A;  4EMY A;  1E5F A;  2DKJ A;  3LEL D;  3K40 A;  3HL2 A;  3W98 B;  1P3M C;  4OBU A;  1LK9 A;  4MKJ A;  3WAA B;  1PMO A;  3AN2 A;  2Z1Y A;  3NNK A;  3REL B;  5DNM A;  1KL1 A;  1B5O A;  3REK D;  3AZE B;  3FVX A;  3WKR A;  4PFF A;  1LC8 A;  5GSU A;  3BS8 A;  5FT8 A;  3LZ1 A;  3D6K A;  3REJ B;  5F9S A;  4ATQ A;  3ZZK A;  2F8N A;  5GXQ B;  4A0R A;  1Z3Z A;  1P3L C;  3QN6 A;  3BV0 A;  1MAQ A;  3AAT A;  2FJ7 C;  5E5A A;  1P34 C;  4TMR A;  1BFM A;  3WTP B;  3NQU B;  3C1C D;  3REJ A;  3B6F B;  3X1T C;  1C0N A;  3MGQ A;  1PFF A;  2HP1 A;  2VLH A;  2CFB A;  3DRD A;  1KU5 A;  5B0Z A;  1HQ3 A;  4Z5T B;  4XUJ A;  2HUF A;  3DR7 A;  1CZE A;  5E5A D;  3I5T A;  2NZD C;  4J8X A;  1V2F A;  1M18 B;  3NX3 A;  3A2B A;  2GMU A;  3MGR C;  5EUN A;  4WZS B;  4UHO A;  3WTP A;  1U35 D;  5HXX A;  3B6F D;  3R45 A;  1ID3 D;  5GSU D;  3TFU A;  2X3L A;  2VMS A;  2YKX A;  3B6G B;  1ASL A;  5B1M A;  1AY4 A;  3MNN D;  5B0Z C;  1BQA A;  4CSR B;  1IBJ A;  4KUD C;  4UOY A;  4EFF A;  1P3B A;  3MGQ C;  2BYK B;  4J8W C;  4ZUX D;  4AOA A;  3X1V A;  3ZZJ A;  4WU8 D;  2OGE A;  1P3M B;  3DZZ A;  2DOU A;  1P3B C;  2W8U A;  3X1U C;  3AZE A;  3R4T A;  4ITG A;  3AFA B;  4K2I A;  1M1A C;  3H7F A;  3TCM A;  1WKG A;  2VMZ A;  1N8P A;  4RKD A;  3REH C;  1BH8 B;  2FKI A;  3FZ6 A;  7AAT A;  2G6W A;  4XZQ C;  1X28 A;  5GXQ C;  3MGP A;  1YIY A;  3AFA A;  4XUJ C;  2BIG A;  4M2M A;  3ZRQ A;  1KX3 B;  1AHG A;  1P3A D;  1F66 A;  4ZAH A;  3M5U A;  3FCR A;  3W99 C;  3AZI B;  3O62 D;  3B6G A;  3EI5 A;  3VH5 T;  1M18 A;  3QBO A;  1TOI A;  5CP6 A;  1P3G B;  3K7Y A;  5AV9 D;  4XJL A;  4NE5 A;  3MAF A;  3WKJ D;  3WAA C;  1P3F C;  4YS3 A;  3HT4 A;  2PYO D;  3ISL A;  1QJ3 A;  3MGR A;  4ZM3 A;  2BIA A;  4WNN B;  5AV6 B;  3GZD A;  3W99 A;  4N0W A;  1LW5 A;  4R8P B;  3AZM D;  3PAA A;  3AN2 C;  1AIA A;  4WYA A;  3X1S B;  5M4B A;  1AY5 A;  1KX5 A;  2JE5 A;  3HBX A;  1QIS A;  2QA3 A;  2HZP A;  1C7N A;  1P3O D;  4J8V D;  5FT4 A;  4J5U A;  3E2F A;  5JAY A;  1J32 A;  1AJS A;  3AYW D;  1KX3 A;  5EQC A;  3W97 A;  3TFT A;  1SZK A;  5BJ3 A;  3REL A;  2ZSL A;  3KFU G;  2Z9U A;  5BO0 B;  3AZL B;  5G2P A;  4JF1 A;  5B32 G;  3MVD D;  4TN4 A;  1AHX A;  4WU9 B;  3N7N A;  2ZUK A;  4MY5 A;  3A6N A;  1BJO A;  3AZJ D;  5AVC A;  3W97 B;  4GSA A;  1SZU A;  3B6G C;  2VGZ A;  1VEF A;  3A6N B;  3MGP C;  1BJO B;  4XQ2 A;  2E7J A;  3PD6 A;  3FQA A;  3N4X A;  4WU9 D;  1ASD A;  2Z20 A;  2ORD A;  5AVB C;  3FD0 A;  3MGS B;  4U1T A;  1QIR A;  1M19 B;  3VK2 A;  3QI6 A;  4B98 A;  4F5F A;  5B31 D;  2HIO B;  2VMP A;  2V1P A;  4H9Q B;  2ZM5 A;  3EZS A;  5B2J A;  3REJ C;  1EQZ D;  3PDB B;  2E54 A;  1S32 B;  3OP7 A;  2HUU A;  2ZY5 A;  4H9N A;  3VH6 W;  2CTZ A;  5B33 B;  1DKA A;  1RV3 A;  1M4N A;  4F5H A;  4Z2M G;  2IO5 B;  3A8U X;  2FNU A;  1P3K B;  2XD1 A;  5GT3 D;  5AVC B;  1C7O A;  3BCX A;  4H9O A;  1KX3 C;  4XAU A;  5DJ1 A;  3EI6 A;  1I29 A;  2CV5 C;  4CBR A;  4BA4 A;  2F8N H;  1ASN A;  3JWB A;  4WLJ A;  4Q31 A;  2WK9 A;  1N31 A;  1O61 A;  4W8I A;  4JJN B;  1V2E A;  5AY8 C;  5TF5 A;  3RCH B;  3AV7 A;  2RIQ A;  3MVD B;  3JW9 A;  1WYU A;  3LV2 A;  1I41 A;  4Y0D A;  2AAT A;  2PB0 A;  4MQR A;  3UT9 C;  4GRX A;  2OQX A;  4OCA A;  3REL D;  4PFN A;  2X8U A;  1M0P A;  2R5E A;  4YS3 C;  3W97 D;  2FJ7 A;  4AWL C;  3WX9 A;  3WAA A;  3AYW A;  3AZK A;  3AZH B;  2BWO A;  3FTB A;  3F9T A;  2BYM B;  5CPJ B;  3AV1 C;  3WTP E;  1P3O A;  3FVU A;  4E3R A;  3X1T A;  4J8L A;  2Y2P A;  1QZ9 A;  4G92 C;  3BWN C;  4ADC A;  3BC8 A;  5G09 A;  1P3B B;  3AZF B;  2YHK A;  3AZM A;  1P3P C;  2FYF A;  1M0O A;  2VQR A;  5EIG B;  3X1T B;  3MC6 A;  1H3O B;  3H0R C;  2AY7 A;  3KXB B;  3AZL C;  2Z9X A;  1DFO A;  1EQZ B;  3FFH A;  3RBL A;  1B5P A;  5AV9 A;  1TOJ A;  2VMR A;  1MGV A;  3VH5 A;  3W98 D;  3NU7 A;  5CP6 D;  1M19 A;  2W7J A;  1M18 D;  4ZDO A;  1SFF A;  1M0Q A;  3JZL A;  2X5D A;  4ZSW A;  3AZG B;  1CL2 A;  2ARO C;  4UPK A;  3C1B D;  1AOI C;  3GSB A;  4DQ6 A;  2HOX A;  4KGC C;  2L5A A;  3MBB A;  4JJN C;  1PMM A;  1IVR A;  1XEY A;  5BNV A;  3G8M A;  3AZK B;  5G4I A;  3AEO A;  3UT9 B;  1AHY A;  1TPL A;  5B2I B;  3WA9 B;  3QHX A;  1KX4 A;  3EPJ A;  1JF9 A;  3UTA B;  4MQP A;  1ID3 C;  5B1L C;  2BYJ A;  3REH B;  2HIO C;  4WYF A;  5EUE A;  1WYT A;  2CY8 A;  3NYT A;  3AV2 C;  1TAS A;  4WYE A;  2F8N G;  1S32 C;  5CPI C;  1UU1 A;  4LC3 A;  4WU8 A;  5AVB A;  5AV8 C;  1KMJ A;  1P3B D;  4O6Z A;  1D7V A;  3AZF C;  3PA9 A;  1ZC9 A;  1A7W A;  1N1J B;  4DQY B;  3DOD A;  5B32 C;  4GE9 A;  5M49 A;  1EG5 A;  3RQ1 A;  1BS0 A;  3BCB A;  5GSU B;  1ASG A;  3NQJ A;  3REH D;  3ACZ A;  3KXB D;  4NFT A;  3O62 B;  2F8J A;  3T32 A;  1U08 A;  5B33 A;  2JJF A;  3AZN A;  1S06 A;  3W96 D;  1LW4 A;  4BHD A;  4W1V A;  1HQ3 B;  3LZ1 C;  3R9A A;  4WU8 B;  1S07 A;  4XUJ D;  3HDO A;  5DNN D;  3LG0 A;  1OHY A;  2HOZ A;  2BKW A;  3EI8 A;  1AX4 A;  2PYO B;  1I43 A;  2BI5 A;  2OGA A;  5DNM C;  3AFA D;  1ASM A;  4IXO A;  5B1M C;  4X23 A;  3NQJ B;  4ZDL A;  3FDD A;  4R8P C;  4ZAS A;  3GZC A;  2VMY A;  2QLR A;  2W8W A;  2AY8 A;  2LY8 A;  2D7Y A;  1ELU A;  1ASA A;  1AJS B;  2W7K A;  4J8X C;  1BKG A;  2W7M A;  2VYC A;  3WAA D;  1GC2 A;  3VH6 A;  1R4V A;  1QJ5 A;  4MQQ A;  3UTB C;  2A1V A;  1AMS A;  1IX7 A;  2BI3 A;  1YJY A;  3TU4 C;  1TAT A;  1C9C A;  4DRA A;  2DR1 A;  3AN2 D;  4J8W A;  3BWN A;  5AV5 A;  2WK8 A;  1EJI A;  3W98 A;  3FQ7 A;  4UHN A;  2BI9 A;  4Y0I A;  3MAF B;  3WTP C;  3KWQ B;  3AZG C;  3LWS A;  1AHE A;  1P3I D;  3AYW C;  4MSO A;  2E7U A;  1SVV A;  3DXV A;  5F99 D;  4KAM A;  2WK7 A;  5B32 A;  3VH6 T;  2NZD A;  5HHY A;  2W7I A;  2JGT A;  3II0 A;  3PGY A;  5AV8 A;  2Z61 A;  5B2J D;  4QLC A;  3FZ7 A;  5CPJ A;  5AVB B;  4H9P B;  2AY3 A;  3MGR B;  4KXK A;  2VGW A;  4XZQ A;  1GDE A;  3Q8N A;  4YS3 B;  3NUI A;  2F8N D;  2NQB A;  3ASA A;  3AZG A;  3I4J A;  4RLG A;  1MDZ A;  5B0Z B;  1IJI A;  3CQ5 A;  3COG A;  5FT5 A;  2QB3 A;  4X23 C;  3KUY D;  3AV1 B;  2EO5 A;  1QIT A;  1P3M D;  3KGW A;  5AVC D;  2G5I C;  5EAA A;  4ADD A;  2R5C A;  1IX8 A;  2D7Z A;  2EGY A;  4ZM4 A;  4BA5 A;  3HMU A;  5BNX A;  5BS7 C;  2CV5 B;  3AZJ B;  1SZS A;  2F8N B;  3GWP A;  4YM6 D;  3RCH A;  1WYV A;  1OHV A;  3AZM B;  2HUI A;  2W8S A;  1BH9 B;  2W7H A;  2HOR A;  4AZK A;  2YKV A;  1B9H A;  4WB0 B;  2HUE B;  4NE6 A;  5CPK B;  1TAF A;  3CQ4 A;  5GT0 A;  2J8P A;  4L0O A;  1KX3 D;  1KKJ A;  1EQZ A;  3CAI A;  4G91 B;  1CQ8 A;  4Z66 B;  1S32 A;  1WST A;  5FUG A;  2AY5 A;  4J8U D;  2VMU A;  1DGE A;  4UQV A;  5AY8 D;  5B1L A;  3FRK A;  5E5A C;  4IY7 A;  4RIT A;  3MAD A;  3G7Q A;  2BYL A;  2G7J A;  1AY8 A;  1AMR A;  2XD5 A;  2VIA A;  4KUD A;  3MGR D;  3ATH A;  4F5M A;  4H63 Q;  1TAR A;  1LKC A;  1C4K A;  4H9R B;  1M1A B;  3LVM A;  4H9Q A;  4YS3 D;  3RBF A;  4ADB A;  5B1L B;  2HOY A;  3WKJ A;  1FG7 A;  2RVQ D;  4FL0 A;  3EPL A;  2YCN A;  4KUD D;  3QGU A;  4J8U B;  3TU4 A;  2Y2J A;  2W8J A;  1RVY A;  3FZ8 A;  1F66 C;  2XH1 A;  3CBF A;  2VGV A;  3MVD A;  4J8U A;  2VGU A;  1TOG A;  2W7L A;  2AY2 A;  1TOK A;  5DX5 A;  1MAP A;  5C3I C;  4XJM A;  1TOE A;  2EH6 A;  3AZL D;  1B67 A;  2VI8 A;  2AY1 A;  1FC4 A;  3LJA A;  4CAY A;  3LY1 A;  2Y2I A;  2O0R A;  3N0L A;  3NU8 A;  5CP6 C;  1N2T A;  5B2I D;  1KX5 D;  3WA9 C;  1VJO A;  3REK B;  1GEW A;  4PIW A;  3AZE D;  3NUB A;  3W99 D;  1O62 A;  2D65 A;  3L44 A;  3PPL A;  4KGC D;  4LD9 B;  2WB6 A;  2VI9 A;  3W1J A;  5AV5 B;  4JJN D;  2PYO A;  4A6R A;  4K2B A;  4W5K A;  2YFW A;  3WKJ C;  1P3F D;  2CJD A;  1UKJ A;  1ID3 A;  3B6F A;  1KX5 B;  2EZ1 A;  3RUY A;  2VMV A;  4ATP A;  2NQB D;  3UE8 A;  3FSL A;  5B1L D;  4E1O A;  3VH5 W;  1ASE A;  4XEW A;  4H9R A;  1M1A A;  5E3K A;  3PDX A;  3WY7 A;  2BYM A;  3AZM C;  1KKP A;  1ORD A;  4W91 A;  1AMA A;  1S32 D;  1Z2C B;  2Z9W A;  1HQ3 D;  3LEL B;  5J8Q A;  3LZ1 B;  5AV8 D;  3B0D B;  2CJG A;  3AV1 A;  1P3O C;  2DF4 C;  5GT3 B;  3KSY A;  3QPG A;  1BH9 A;  3KWQ C;  2QMA A;  5DNM B;  5B32 D;  5HDM A;  1U35 B;  2NQB B;  1P3W A;  2FNI A;  1WYV B;  2VMW A;  4R2N A;  3VK4 A;  2VMQ A;  1AKA A;  4HF8 A;  1KX4 B;  4ZUX B;  3MVD C;  3LZ1 D;  4IYO B;  5CP6 B;  1D7R A;  1MDX A;  4RM1 A;  3WGC A;  2GQN A;  3AEP A;  3REI B;  4F4E A;  5BNV B;  4M6B A;  3X1V D;  5BS7 A;  3A9X A;  4ZUX A;  2FM1 A;  2AEV A;  3UTB B;  1P3M A;  3C1C B;  5DNM D;  4IXS A;  3AFA C;  3V9R A;  3H0M C;  5B1M D;  1D7U A;  2CV5 A;  2VIB A;  1AIB A;  4H9N B;  4LNL A;  4UUZ A;  1YJZ A;  1GC3 A;  3KUY A;  2DGM A;  3AZH C;  4XZQ B;  1BT4 A;  4CXR A;  4WXF A;  4HGA C;  5B33 C;  2GB3 A;  2YFV A;  1H1C A;  3ELE A;  4J8X D;  4OT8 A;  3RI6 A;  2EYQ A;  1AJR A;  2YCP A;  3UTB D;  4KHA A;  1DJE A;  3AZI A;  5B0Y A;  2Q7W A;  5B31 C;  1CS1 A;  2JG2 A;  8AAT A;  3P5J B;  3IP4 C;  3AZI D;  2AY6 A;  2WKA A;  4MKK A;  4IYO A;  3MNN B;  3H9X A;  3REJ D;  1EQZ C;  5DNN A;  2EZ2 A;  1W7M A;  1T3I A;  1IAY A;  1TZY B;  2DQN C;  2F8N K;  4EU1 A;  2ZYJ A;  1P3I A;  4CVQ A;  5F8V A;  4A72 A;  5GT3 C;  3HLM A;  2Y2N A;  1RVU A;  3DYD A;  2ZY3 A;  1P3I C;  4K2M A;  2Y2H A;  4Z66 C;  1MDO A;  4M2K A;  1P3F A;  1ZLA C;  1ASC A;  4R8D A;  2V0Y A;  2JIS A;  4EB5 A;  3REK A;  3AN2 B;  3A6N C;  2YKY A;  4X23 B;  3NDN A;  2GSA A;  4KGC A;  1C7G A;  4Q76 A;  2Y2O A;  1WYU B;  2BHX A;  1S0A A;  3UT9 D;  3LEL A;  4A00 A;  5G49 A;  1P3P B;  1PG8 A;  3F0H A;  1X0M A;  3REL C;  2BWP A;  3LVJ A;  2UWX A;  2D61 A;  1ID3 B;  2VMT A;  1ASF A;  3LJA C;  2YFW B;  3B0C T;  1WWI A;  1Q9C A;  4OTL A;  4X23 D;  3KUY C;  3B1C A;  3BWO A;  4UHM A;  2Y2L A;  1ULY A;  5B2J B;  1P3L B;  4JEZ A;  2JCH A;  5CPK C;  1LC5 A;  5AVC C;  5B24 D;  2JJG A;  1P3P D;  1S08 A;  2YRR A;  4GE7 A;  2Y2K A;  3C1B A;  1P3G A;  2JJE A;  1CQ6 A;  3W96 A;  3AZN D;  2VMO A;  1OXO A;  5C3I B;  1M32 A;  4GE4 A;  2O7C A;  3KXB A;  4E45 A;  1XI9 A;  1KX4 C;  4ZWV A;  4FFC A;  5AY8 B;  5G2Q A;  1MLZ A;  1V2D A;  3P6K A;  5E5A B;  3W98 C;  4OYT A;  3AZK C;  2PO3 A;  1M18 C;  3REI C;  5JRG D;  4E44 A;  4J8V B;  3MGS D;  3UTA C;  2G5H C;  2ARO D;  5DJ9 A;  4A0F A;  2JJH A;  5B40 A;  2CAN A;  3AV2 B;  3KGX A;  4W1X A;  1ARS A;  1JFI A;  1ZOD A;  1UU2 A;  3B0B A;  5CPJ C;  5EFS A;  5AY8 A;  2CJH A;  5B2I A;  5BT1 D;  3TQX A;  3K28 A;  2HIO A;  1GBN A;  1P3K D;  1I48 A;  2YKU A;  1AAW A;  4WB0 A;  3X1U B;  1Z7D A;  1O69 A;  2BI1 A;  2XBN A;  5IWQ A;  4A6U A;  5KDM B;  4LW4 A;  1AKB A;  1M0N A;  2YFV B;  2D5Y A;  3PJ0 A;  3USF A;  3AV2 D;  5GT0 B;  1AKC A;  4ZBJ C;  3PD6 B;  5CPI D;  1MLY A;  1TZY C;  2ZSM A;  4DBC A;  2VGS A;  3LEL C;  4PVF A;  2OKJ A;  4H9O B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...