2ZY5A

R487a mutant of l-aspartate beta-decarboxylase
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
510
structure length
510
Chain Sequence
ELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGAGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-aspartate beta-decarboxylase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
total genus 183
structure length 510
sequence length 510
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy5A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy5A01
4CVQA 1BQAA 4JEWA 1CS1A 3G8MA 2YKYA 2AY3A 1MAPA 3FVXA 3K28A 1MGVA 5J8QA 4GRXA 1TOEA 1BKGA 2OGAA 4DBCA 1QJ5A 1AY8A 2CY8A 4MQQA 1C9CA 1EG5A 1CQ6A 5M46A 5EIGA 2DR1A 2VMNA 1D7SA 1IX7A 1WYVB 1YIZA 4PFNA 4R5FA 4RAEA 4EMYA 2E7JA 3DR4A 3R9AA 4A6UA 1CQ7A 3LVJA 1GC3A 1DJ9A 4WLJA 1ARIA 2ZY4A 1M4NA 2AY9A 1I48A 2BI9A 3PD6B 2DKBA 3CQ5A 2HUFA 2AY8A 2AY6A 4A0GA 1Y4IA 4Q76A 3LVKA 1SZKA 1ASBA 1G7WA 4ZM4A 2W8VA 4F5KA 1EQBA 1TOJA 2CANA 4MKJA 1V2FA 2ZYJA 4CBRA 5BJ3A 2FQ6A 4KAMA 9AATA 4XJMA 1KL1A 3DC1A 2YRIA 2YKUA 1M0QA 1CL1A 1OXPA 4LNJA 3ZZJA 1SFFA 1D2FA 3RCHB 1T3IA 1ASAA 1WYUA 3K7YA 5IWQA 4IXSA 2AY4A 3Q8NA 1GC2A 3T32A 3FDDA 1S06A 3UWCA 3WY7A 2ZY5A 1C4KA 5G0AA 1ELUA 1ARTA 4ZDPA 3MADA 2W8WA 3HQTA 4W91A 4OYTA 1AHFA 1AY5A 1JS3A 1SF2A 2D65A 4WB0B 1KKJA 2EPJA 2VMPA 4EB7A 4MQRA 1IAXA 1ASMA 4EFFA 4A0HA 1YNUA 1TPLA 3FQAA 5M4BA 1ASNA 1ZC9A 3FFHA 2C0RA 4E3QA 1B5OA 2O1BA 2V1PA 4WXBA 5EUDA 1AIAA 1IUGA 2BI1A 2DKJA 2FNUA 3E6GA 4N0WA 2W7IA 3E77A 2AY2A 4ZDLA 1IJIA 2W7FA 2E7IA 3B1EA 2NMPA 4W5KA 4AOAA 1D7RA 1GCKA 1W7NA 2HZPA 3CQ4A 3KKIA 1LW5A 2VMVA 1B8GA 2CJGA 4OT8A 1U08A 3GZDA 3ZRPA 3D6KA 4IW7A 3JTXA 4W8IA 1H1CA 1AMSA 1LW4A 3EZSA 3PA9A 5DX5A 2CH2A 3PPLA 1I41A 3EI5A 2BI5A 1J32A 3FSLA 3DODA 3PJ0A 2D61A 3COGA 3NYSA 3MC6C 4U1TA 4E77A 2YKXA 1ZOBA 3ASAA 1AHEA 1WYVA 2VGWA 1AY4A 2X5DA 2W8TA 3AV7A 4DQ6A 1M0OA 1KL2A 1C7NA 4ATPA 3ISLA 2GSAA 5FT6A 4LW2A 2D7YA 3NDNA 4GE4A 1ELQA 3E2ZA 3H7FA 4ZAHA 5HDMA 3BS8A 1DKAA 2C44A 3LVLB 4PVFA 1MDOA 2HP1A 3NUIA 5G4JA 1V2DA 2BI3A 1FG3A 3GJUA 2FM1A 2ZC0A 2CJHA 2BIEA 3QN6A 3EI9A 2ZJGA 3BCAA 2CFBA 4JEZA 3WLXA 4DGTA 5D5SA 1OATA 1RVYA 3NU7A 4M2KA 1TOKA 3MC6A 1FC4A 3AEJC 3B46A 2HORA 4E1OA 3FKDA 3EIAA 2G6WA 5E5IA 2VMQA 3RCHA 4OC9A 4ZWMA 1YAAA 4M2JA 1CL2A 1M32A 2YCNA 1RVUA 4TMRA 1BT4A 3P6KA 1UKJA 3NUBA 1M7YA 1KMJA 3DR7A 1EJIA 1JF9A 1OHYA 3FVUA 3PDBA 2CTZA 4Q75A 1DJEA 2CJDA 3VOMA 1GDEA 4P3MA 1E5EA 4WB0A 4XK1A 2R5EA 1LC5A 1LS3A 3IHJA 1G7XA 2O0RA 2VGTA 2PB2A 2WK8A 3TCMA 3FQ8A 4F5FA 4W1WA 5DB5A 3NNKA 3DU4A 1OHVA 3L8AA 2EZ2A 2EO5A 3B1DA 3E2ZB 1YOOA 3AEJA 3LG0A 1G4VA 2OGEA 4A00A 3AEMC 2W8JA 1AAWA 4AZJA 3WZFA 1OXOA 2VIBA 1DGEA 1TASA 2F8JA 2W7MA 4B98A 1XI9A 3QPGA 1SZUA 4ITXA 2ZSLA 4UOYA 5E4ZA 4AO9A 4BA4A 1QITA 1CZEA 2Z1ZA 4OCAA 5K8BA 4A6TA 3VK3A 3ELEA 4F5JA 1DFOA 5M4DA 2Z9XA 2HP2A 4JEYA 4XJLA 3ZRRA 1LC7A 1AMQA 3ATHA 4LNLA 2Z9VA 5FT8A 4E3RA 1MAQA 4F5LA 4ADEA 1QISA 3PIUA 5EAVA 2W7DA 1TOGA 2X8UA 1W3UA 2JJFA 4XJOA 3DXVA 3EI8A 3PDBB 3EI7A 1GC4A 3FVSA 3AEMA 1ASLA 5C6UA 1BQDA 5EUEA 2VGZA 4GE7A 1C7OA 1AJSA 3FCRA 1ASDA 4MY5A 4WYGA 2VGVA 3DYDA 3GBXA 5F9SA 3AEPA 1AHXA 3AENA 2BKWA 1YJZA 4WLHA 3L44A 2W7GA 1M6SA 1ASEA 3KGWA 4WXGA 1MDZA 3OKSA 1S09A 1YJYA 3GETA 3EIBA 2WK9A 2BYLA 4UHMA 5EQCA 2JJHA 1B4XA 4XEWA 3RQ1A 1YIYA 1PFFA 4WD2A 1TOIA 2D7ZA 2WK7A 5AX8A 4WYAA 1WSTA 4Q31A 1AMRA 1ORDA 1N8PA 4GE9A 2QB3A 2XBNA 3FTBA 3GZCA 5BJ4A 3MAFB 3QBOA 1Z7DA 2D64A 1SVVA 4PFFA 3NU8A 1QZ9A 4IXZA 2EGYA 1I29A 1X0MA 1Z3ZA 3NYTA 2TPLA 5F8VA 4AO4A 2W7JA 4JEVA 1ASFA 1V2EA 4JEXA 4IYOA 3BCBA 4A0FA 1AHGA 3HDOA 1JG8A 4H51A 2ZUKA 2QBTA 1TARA 1AJRA 4MQPA 4WYDA 1ARSA 1N2TA 4ITGA 1O4SA 2R2NA 4GSAA 2XH1A 2HOZA 1AX4A 1GC0A 1GEWA 1AJSB 1UU1A 1BJOB 1CJ0A 1ZODA 3B8XA 2HOXA 3AENB 1S07A 4GEBA 2JJEA 3BB8A 4UQVA 2QA3A 5EFSA 3RUYA 1AAMA 3ACZA 1E5FA 3TATA 1H0CA 3AEOA 3QGUA 3VAXA 3LY1A 3JWAA 2BIAA 3AOWA 2GMSA 2W7LA 4ADBA 3A2BA 4CXRA 3QM2A 3F0HA 2BI2A 2ORDA 3ECDA 1QGNA 4O6ZA 2JGTA 2Z20A 2D66A 2YOBA 3TFUA 4EU1A 3VK2A 3ELPA 4B9BA 4K2BA 5M49A 3ASBA 3FDBA 2ZP7A 4OMAA 4R5ZA 1D7UA 3BV0A 4R8DA 2VYCA 2YCTA 1AKAA 1X29A 3F9TA 4R2NA 1UU2A 2VMWA 3A9XA 1I43A 2JJGA 3QI6A 4K2IA 4IXOA 3WKSA 2R5CB 2W8UA 4ZDOA 3HLMA 2BWPA 1YJSA 3PGYA 3FRKA 4Y0HA 2C7TA 3HMUA 3R4TA 4FL0A 3OP7A 4IYOB 3FQ7A 1X2AA 2VI8A 3NTJA 1MDXA 2ZY2A 1DGDA 2FN6A 5DJ9A 5EAAA 3HL2A 1MLZA 4IX8A 3A9YA 2VMTA 3BCXA 2VIAA 5FT4A 3WGCA 1CZCA 4XJPA 1GBNA 2GMUA 4WXFA 4F5MA 4BMKA 2GQNA 3CQ6A 3NRAA 4U2HA 5JAYA 1C7GA 3JWBA 4Q6RA 2Q7WA 3JW9A 1WYTA 1IBJA 1OHWA 1GD9A 2Z9WA 3LV2A 4MKKA 4EB5A 3N75A 2V0YA 3WGBA 3MAFA 2VGUA 1W7MA 3AELA 4Y0DA 5HXXA 1ASCA 2EH6A 1O69A 4A72A 5HHYA 3FFRA 4RKDA 5G2PA 4ATQA 2PO3A 5I92A 3CAIA 4M2MA 3P1TA 3NX3A 3E9KA 1IX8A 2CB1A 5D95A 4WP0A 2YCPA 2Z9UA 2R0TA 2AY1A 4P7YA 4FFCA 2AATA 3DRDA 4ZASA 2QB2A 4J5UA 2EZ1A 1GEXA 1DTYA 2D63A 4WYEA 1B9HA 4ZSWA 5G4IA 2VMZA 2VLHA 2AY5A 4TN4A 4OTLA 3BWNC 1S0AA 3DXWA 4ZLVA 3WKRA 1FG7A 1IAYA 4ZM3A 3AATA 3AOVA 1J04A 1SZSA 4LC3A 3VK4A 1BJOA 2Z61A 3WX9A 2AY7A 2HOYA 3E2YA 1JS6A 1W7LA 3MAUA 3A8UX 4GDYA 2W7HA 3G7QA 1AICA 3LWSA 1C0NA 1BJWA 1BJ4A 3M5UA 1LC8A 1ASGA 3EZ1A 1S08A 1B9IA 4A6RA 1AMAA 4L0OA 1WKHA 3CBFA 1AIBA 2D5YA 3GZDC 3UAKA 4JF1A 4KXKA 1SPAA 1WYTB 2X5FA 3RBFA 1VEFA 7AATA 4LW4A 2JG2A 1BS0A 2BYJA 4F5GA 4HVKA 3I5TA 4ZWVA 2VLFA 3GR9A 2VMSA 2RFVA 2VGSA 2VMYA 5EIGB 5G2QA 1UU0A 2YHKA 3II0A 1IVRA 2FYFA 1B5PA 1P3WA 3BWNA 3KE3A 3KGXA 2VMRA 1ECXA 2CSTA 4XQ2A 4CBSA 2O7CA 1RV4A 3A9ZA 1LKCA 2VMOA 2R5CA 5EUNA 3ZRQA 3N0LA 4XAUA 2OQXA 2VMUA 1QIRA 2WKAA 1LK9A 4K2MA 3N5MA 1AHYA 4WYCA 2BIGA 4UHOA 2QMAA 2YKVA 2E7UA 4BA5A 3RI6A 3F6TA 2QLRA 4RJYA 4ZSYA 8AATA 1BJNA 4W1XA 2HUUA 2VI9A 4I8AA 4UHNA 3TFTA 3USFA 4Y0IA 2GB3A 1O62A 3PAAA 3PDXA 1X28A 3BWOA 4ADCA 4ADDA 4W1VA 4F5IA 2FNIA 1CQ8A 1ARHA 3ZZKA 2W7KA 1WYUB 4A0RA 1D7VA 1N31A 4MSOA 1MLYA 3BN1A 1BW0A 4JF0A 1PG8A 5E3KA 3MKJA 4BQ0A 1RV3A 2YRRA 3LVMA 1GEYA 2C81A 2Z1YA 2BHXA 3BC8A 3E2FA 2BWNA 2ZSMA 4AZKA 1AKBA 1V72A 2E54A 2W7EA 5G09A 3PD6A 1DJUA 4HF8A 2BWOA 3QHXA 3EI6A 4PIWA 4AH3A 2ZY3A 1KMKA 4RKCA 3TQXA 1M0NA 1O61A 3DZZA 4KYOA 4NOGA 1QJ3A 3EUCA 4F4EA 3GSBA 1G4XA 2CH1A 3UE8A 4LNMA 4WYFA 2CINA 1VP4A 2PB0A 1IX6A 1W23A 2VMXA 3NYUA 2DOUA 3K40A 4CXQA 4F5HA 4ISYA 5TF5A 4IY7A 3RBLA 1VJOA 1TATA 4WBTA 2HUIA 1WKGA 3MBBA 2OATA 1M0PA 1AKCA 1ARGA 4QGRA 3MEBA 1KKPA 4BHDA 3B1CA 5DJ1A 5FT5A 3I4JA
chains in the Genus database with same CATH superfamily
1BQAA 2Y2PA 2AY3A 1MAPA 3FVXA 5B0YC 4KHAA 1BKGA 2F8NA 2PYOD 1CQ6A 2VMNA 1ID3C 1YIZA 3MGSD 5GXQA 4A6UA 1CQ7A 2JISA 1WWSA 5GT3A 2ZY4A 5BS7C 1SZKA 2W8VA 2CANA 5BJ3A 1TAFB 2OKKA 3KXBC 5B0YA 3B6FB 4KAMA 3KUYC 1CL1A 2AROD 3ZZJA 1ID3A 5B2IA 1WYUA 4IXSA 3Q8NA 3WY7A 4X23C 3MNND 4WJ3C 1ELUA 4ZDPA 3MADA 2CV5B 1ASMA 1BH8A 2F8ND 3LELC 2HIOC 3KXBA 1B5OA 2O1BA 3TU4D 3AL0C 3E77A 5GXQD 3VH6W 1ZLAD 2NMPA 3RELC 1D7RA 2HZPA 3KKIA 2VMVA 4X23A 3X1SC 1AMSA 4Z66C 5B24B 5B0YD 1J32A 2F8NH 3DODA 2D61A 3LELA 3COGA 3N7NA 3NYSA 4UPKA 2HIOA 4U1TA 1AY4A 3AV7A 4K05A 3ISLA 1ELQA 5B32C 3C1CB 2BG1A 3X1SA 3LVLB 4PVFA 5G4JA 1V2DA 2BI3A 5G49B 2ZC0A 2CJHA 1P3OC 3BCAA 2CFBA 3B6FA 3WLXA 3VH5A 1OATA 3KUYD 4M2KA 3UT9B 4E1OA 2HORA 3EIAA 5CPKC 1P3GC 2VMQA 5E5IA 4M2JA 1UKJA 3NUBA 4X23D 3DR7A 3FVUA 2CV5A 4H9PB 3W1HA 4XK1A 5BT1C 3LELD 3IHJA 1G7XA 2HIOD 4LD9B 1P3OA 3KFUG 1TZYB 1P3IC 1AOIB 3DU4A 3RELD 1P3GA 1OXOA 1TASA 3C1CC 3W99D 3X1SD 2ZSLA 1QITA 2IO5B 4OCAA 4Z66D 1A7WA 2HP2A 4CAYB 2LY8A 1P3PB 4F5LA 1KX5C 1TOGA 1P3IA 3DXVA 3LJAB 3PDBB 1GC4A 5EUEA 3W98C 3MGRB 3VH6T 5B32D 1ASDA 3B0CW 3C1CA 2FJ7B 3GBXA 4NFTA 3AEPA 1AHXA 2BKWA 1YJZA 4WLHA 3L44A 1M6SA 3KGWA 1YJYA 3GETA 4J8UC 4KUDB 4UHMA 3AFAB 4WD2A 3REHB 5AX8A 3H9XA 3UT9A 1AMRA 5CPKD 1ORDA 1N8PA 2XBNA 3WKJC 3FTBA 5BJ4A 1SVVA 3NU8A 4IXZA 4HGAB 1I29A 3I16A 2IO5C 3AYWC 2W7JA 4A0FA 5CP6B 4H51A 5BT1D 4WYDA 1P3ID 1N2TA 4ITGA 1TZYA 1AOIA 2HOZA 1F1EA 1AJSB 1BJOB 1S32C 3WKJA 3MGRC 3UTBB 3TATA 1H0CA 3AOWA 2GMSA 2W7LA 5FUGB 3AYWA 3F0HA 2BI2A 1QGNA 3LZ1B 2YOBA 4CAYA 5M49A 3FDBA 1KX5D 1D7UA 4R8DA 2VYCA 1I43A 2JJGA 3WTPB 2W8UA 3HLMA 1S32A 3W98D 3OP7A 3MGRA 3FQ7A 4IYOB 1M18B 3BCXA 3JZLA 5FT4A 1CZCA 1Q9CA 4J8UD 4KUDA 1Z2CB 2Q7WA 3JW9A 1WYTA 1IBJA 3N75A 2V0YA 3WKJD 4H63Q 1P3LD 1W7MA 3UTBC 3AZLC 3FFRA 3P1TA 3AYWD 3AZEB 2Y2HA 5D95A 3AZNB 2Z9UA 5CP6A 3LZ1C 2R0TA 3B0CT 2QB2A 2EZ1A 4ZSWA 2VLHA 4ZLVA 1WWIA 3DXWA 3WKRA 1FG7A 4ZM3A 3AATA 1J04A 3AV2C 1U35B 1BJOA 3E2YA 1JS6A 4GDYA 1C0NA 3UTBA 3AZLA 4WZSB 4KXKA 2AEUA 3LZ1A 3RBFA 4F5GA 4HVKA 3I5TA 5B31B 3MVDC 5JA4B 4G91B 3UTAC 1ECXA 2CSTA 4H9OB 2O7CA 5B2JD 1RV4A 1KX4C 5AY8C 3N0LA 4XAUA 5CHLB 3REKD 3AZJC 4WYCA 3AZEC 1M18A 2QLRA 2F2AC 3REJB 2VI9A 5AV8D 2GB3A 3PAAA 5JRGC 4ADCA 1P3MC 4W1VA 4F5IA 3MVDA 2FNIA 2ZM5A 1P3AC 3UTAA 4H9QB 5BNXB 5AY8A 2NZDC 3AZLD 2BWNA 2ZSMA 3AZEA 5G09A 1V72A 4XUJB 3AZNA 2NQBB 3QHXA 4PIWA 5AV5B 3EI6A 3DZZA 1O61A 1QJ3A 3AZHC 5JRGA 1G4XA 1HQ3B 5CPIC 3AV2D 4WYFA 2PB0A 3NYUA 1P3AA 4F5HA 4G92B 4IY7A 2RVQC 3W96C 2OATA 2NZDA 4J8WD 4BHDA 5FT5A 3I4JA 1CS1A 5KTBA 4Z2MH 2PYOB 4AWLB 5J8QA 1H3OB 2HUEB 2CY8A 3X1VD 5B31A 3MVDD 3MGSB 5DNMC 2DR1A 1WYVB 5JA4A 4RAEA 4EMYA 3O62C 3DR4A 1KX4D 5AY8D 4WLJA 1DJ9A 1ARIA 1M4NA 2AY9A 3AZJD 3PD6B 2Y2GA 4KGCC 3WA9C 4A0GA 4ZM4A 4MKJA 1V2FA 2ZYJA 2FQ6A 5JRGD 3IP4C 1P3MD 2YRIA 2YKUA 1OXPA 5DNMA 1P3AD 5BO0A 4G92C 4H9RB 1D2FA 3MNNB 1T3IA 4H9QA 5BNXA 2NZDD 1S06A 5G0AA 4KGCA 4KHAB 3HQTA 1AHFA 2F8NB 1JS3A 4XUJA 2VMPA 5AV5A 2HUEC 3TU4B 1JFIA 1M19C 1ZC9A 5GXQB 2C0RA 3AZHD 1IUGA 5CPID 1HQ3A 2FNUA 3E6GA 2W7IA 2OKJA 4ZDLA 2W7FA 3B1EA 1W7NA 2RVQD 3W96D 1B8GA 4OT8A 3GZDA 2Y2LA 3ZRPA 4OBVA 3EZSA 5B0YB 5C3IB 3PPLA 1I41A 4DRBA 3EI5A 1H3OA 3FSLA 2AROC 3PJ0A 3X1TC 1M19A 3MGSA 5DNMD 4ZUXC 1EQZC 1ZOBA 3ASAA 1AHEA 1WYVA 4J8XC 3O62D 3WTPE 1M0OA 2W8SA 3AN2C 4ATPA 2GSAA 4LW2A 2D7YA 2QSRA 4GE4A 4KGCD 3WA9D 4ZAHA 5B40C 3KXBB 1MDOA 3NUIA 5B1LC 2FFFB 2Y2OA 2RIQA 3KUYB 3EI9A 1ZLAC 2AROA 5D5SA 1RVYA 1TOKA 4ZUXA 1EQZA 5B0ZC 4X23B 2G6WA 4OC9A 4ZWMA 3FZ8A 1M7YA 4RJ0A 4Q75A 1DJEA 2CJDA 3VOMA 3EPHA 5C3IC 2JE5A 3LELB 2HIOB 2R5EA 4Z5TD 5B31G 5B1LA 3TU4A 1LS3A 3WAAC 1M19D 2O0RA 2WK8A 4F5FA 3FQ8A 2Y2QA 1ZLAA 3RELB 3NNKA 1OHVA 2EO5A 3KWQC 1YOOA 5B0ZA 4A00A 4AZJA 3X1SB 4B98A 1DGEA 2W7MA 3AV1C 4Z66B 1SZUA 4H9SC 2BYKA 3VK3A 5M4DA 2Z9XA 4JEYA 4XJLA 1F66C 4LNLA 3X1TD 3WAAA 5EAVA 2W7DA 4ZUXD 2X8UA 1EQZD 1W3UA 4J8XD 5BS7A 3EI8A 3AN2D 3N4RA 5B32B 3KSYA 1ASLA 2VGZA 3HT4A 5B40D 4R8PC 2G5HC 3AV1A 2VGVA 2VQRA 3AENA 1P3OB 1MDZA 3OKSA 5B1LD 5BNVA 3KUYA 4ZBJC 1F66A 2JJHA 5CPKB 1P3GB 3AZMD 1TOIA 2D7ZA 1WSTA 5B0ZD 4GE9A 2QB3A 3GZCA 3W99C 1Z7DA 2J8PA 5CPJC 4PFFA 1QZ9A 2EGYA 3N4SA 1Z3ZA 4R8PA 3NYTA 4JEVA 1V2EA 4JEXA 5F99C 1AHGA 1P3IB 2ZUKA 2WB6A 5GT0D 3WAAD 3RELA 3KWQD 1UU1A 3W1JA 2Y2JA 1CJ0A 1ZODA 3W99A 2QA3A 3RUYA 3AV1D 4Z66A 2BIAA 3N4XA 5E5AD 3ECDA 5F99A 1KX5B 1F66D 2JGTA 2Z20A 2D66A 3TFUA 4EU1A 3VK2A 3ELPA 4B9BA 2KFPA 4K2BA 3ASBA 2VMWA 3A9XA 3FD0A 3W98B 5B32A 2BWPA 3FRKA 2VI8A 4R8PD 2F8NG 4J8UB 1MLZA 3HL2A 2VIAA 2Y2KA 4BMKA 1C7GA 5CPKA 3WKJB 1OHWA 3LV2A 4MKKA 3HVYA 4EB5A 4WNNA 4Y0DA 5CPJD 3AYWB 1O69A 1IX8A 4WP0A 5F99D 2YCPA 3G0TA 1P3KC 2D63A 4TN4A 1S32B 2Z61A 1W7LA 3MAUA 1AICA 1BJWA 1B9IA 4A6RA 1AMAA 1WKHA 3CBFA 1WYTB 1KX5A 2X5FA 3A6ND 4ZWVA 1P3KA 5B2JB 2RFVA 2VMYA 1P3LC 5EIGB 1P3WA 3KE3A 3KGXA 3VP6A 3W98A 3REKB 2VMOA 1QIRA 2XD1A 1LK9A 3N5MA 2BIGA 4J8UA 2QMAA 4BA5A 3F6TA 4RIZA 4RJYA 1BJNA 4UHNA 4JJNC 3TFTA 5AV9D 3AZIC 3C1BC 4ADDA 1P3LA 3ZZKA 4WU8C 4A0RA 1N31A 3AZLB 3BN1A 1BW0A 1BH9B 3BC8A 4AZKA 1AKBA 1DJUA 2ZY3A 4JJNA 1P3KD 3TQXA 3AV2B 5B2JC 2DGMA 4NOGA 3AZIA 3C1BA 3UE8A 5B32G 5AVCC 3REKC 3W97D 1VP4A 4CXQA 4WU8A 4ISYA 2HUIA 1M0PA 1AKCA 5DJ1A 5AV8C 4CVQA 3G8MA 2YKYA 3X1VB 3MVDB 3K28A 1MGVA 4GRXA 2OGAA 1QJ5A 1AY8A 3UTAB 4MQQA 1C9CA 5B2JA 5M46A 1KX4B 5EIGA 5AY8B 1D7SA 4PFNA 4R5FA 3AZJB 4J8VC 3REKA 4LD9D 1I48A 2DKBA 3CQ5A 2AY8A 1Y4IA 5AV8A 5JRGB 4F5KA 1P3MB 4JJND 4CBRA 3AZID 1P3AB 3C1BD 1KL1A 1M0QA 3GWPA 4WU8D 4LNJA 2NZDB 1SFFA 1P34C 3RCHB 4J8WC 3K7YA 4H9NB 2AY4A 3T32A 3UWCA 1C4KA 4EO5C 4QLCC 1BH9A 4OYTA 5AV6C 1AY5A 1SF2A 4WB0B 3X1VC 1KKJA 4EB7A 1B6WA 4MQRA 1IAXA 3W1IA 3AZHB 5CPIB 4EFFA 3FQAA 5M4BA 1ASNA 3AV2A 3FFHA 4E3QA 4WXBA 1AIAA 5B33D 2DKJA 5AVCD 4N0WA 3W96B 4AOAA 4J8WA 3CQ4A 2BYMA 5B1MC 3MGPC 2CJGA 3VH5W 4QLCA 3D6KA 1H1CA 2CH2A 5AV6A 3X1VA 2BI5A 2AEVA 5DNMB 5BO0B 3O62B 1KX4A 2VGWA 2X5DA 2W8TA 4DQ6A 1KL2A 1KX3C 4J8VD 3AZJA 3WA9B 4KGCB 1C7NA 3NDNA 3B6GC 3E2ZA 5B1MA 5HDMA 1JFIB 2C44A 2HP1A 3VH6A 1M1AC 3GJUA 1P3MA 2FM1A 2BIEA 3QN6A 2ZJGA 4JEZA 3NU7A 3AEJC 3B46A 1P34D 3RCHA 1KX3A 1CL2A 1M32A 4H9NA 3P6KA 1KMJA 4WU9C 1EJIA 4QLCD 1P3BC 2CTZA 5AV6D 1E5EA 4WB0A 1M19B 1P3FC 5DNND 1M1AA 3AZHA 5CPIA 3P5JB 2VGTA 2PB2A 3TCMA 4W1WA 5DB5A 3L8AA 2EZ2A 3AEJA 2CWEA 3W96A 3H0RC 3AEMC 3NQJA 3WZFA 5B1MD 3MGPD 2VIBA 2F8JA 1XI9A 1KU5A 4WU9A 4ITXA 4AO9A 1P3BA 2AROB 4F5JA 3X1TB 3ZRRA 4ZUXB 3X1UC 1P3FA 1EQZB 5FT8A 4ADEA 4J8XB 3O62A 3AN2B 3V9RB 1KX3D 3WA9A 3EI7A 3FVSA 3AZFC 3AEMA 5B40B 5C6UA 1BQDA 3B6GD 4GE7A 3FCRA 4Z2MG 4Z5TC 3DYDA 5B1LB 4WXGA 1M1AD 1S09A 1ZLAB 3EIBA 3B0DC 2WK9A 2BYLA 4OBUA 1B4XA 3X1UA 3EPKA 5B0ZB 1YIYA 2XD5A 4DQYB 3AZKC 1PMMA 3QBOA 3AZFA 2BYKB 4WU9D 4YM6C 1P3BD 4Z5TA 5F8VA 2FKIA 3NQUB 5GT0B 3BCBA 3WAAB 3HDOA 1P3FD 1JG8A 1AJRA 4MQPA 3KWQB 1ARSA 2R2NA 4GSAA 4YS3C 2XH1A 1GEWA 3EPLA 3AV1B 3B8XA 2HOXA 3AENB 4GEBA 2JJEA 4UQVA 5EFSA 5BNVB 3ACZA 3QGUA 3AEOA 4YM6A 3LY1A 1F66B 3JWAA 4ADBA 3MGQD 3A2BA 2ORDA 3X1TA 4O6ZA 3LZ0C 3AZMC 3X1UD 4UUZB 2ZP7A 4J8XA 4OMAA 2YCTA 1X29A 3AN2A 4R2NA 3V9RA 4K2IA 2NQBD 3QI6A 3FZ7A 4IXOA 3WKSA 3WCNA 3AZFD 4Y0HA 3PGYA 4R8PB 5B40A 2C7TA 3HMUA 3R4TA 3NTJA 1MDXA 4CSRA 3REIC 5GT0C 2VMTA 4ZBJB 3A9YA 4XJPA 3LZ0A 3AZMA 2GQNA 3AZGD 5JAYA 3JWBA 4Q6RA 1KAFA 2F8NK 3W99B 1GD9A 2Z9WA 3AZKD 5GSUD 5CPJB 3WGBA 5AVBC 5E5AC 5B2IC 2EH6A 2X3LA 4A72A 4YM6D 5F99B 5HHYA 5G2PA 4RKDA 2G7JA 4M2MA 3NX3A 2CB1A 3NQUA 3REIA 2Y2IA 5GT0A 2AY1A 4P7YA 2AATA 4J5UA 4WYEA 3KWQA 1B9HA 5G4IA 2VMZA 2AY5A 3BWNC 4YS3D 4XZQD 4LC3A 2AY7A 2HOYA 3A8UX 3LWSA 4H9SA 2YFWB 5E5AA 5AVBA 1AIBA 3UAKA 3A6NB 1SPAA 3LZ0D 1VEFA 7AATA 4LW4A 2JG2A 2BYJA 4UUZA 3GR9A 1W2EA 2VMSA 5G2QA 2YHKA 4WNNB 3BWNA 2VMRA 3A9ZA 1LKCA 5EUNA 3ZRQA 4K2MA 5GT3D 3REID 2E7UA 8AATA 5AV9B 3H0LC 1X28A 3BWOA 1ULYA 1ARHA 3B6FC 5CPJA 1N1JB 4MSOA 1ID3D 3MKJA 5AVBD 4BQ0A 5B2ID 3EPJA 3LVMA 2BHXA 2E54A 3A6NC 2W7EA 1P3KB 2CV5C 1KMKA 4RKCA 1M0NA 3W97B 3GSBA 3KXBD 1TAFA 1W23A 3RBLA 1TATA 4WBTA 4QGRA 2YFWA 3MEBA 4JEWA 5AV9C 3A6NA 1P3LB 1TOEA 4DBCA 5B24C 1EG5A 2DGLA 3WCOA 1IX7A 2DQNC 2E7JA 3R9AA 3LVJA 1GC3A 2BI9A 3A1KA 2HUFA 2AY6A 4Q76A 3LVKA 4JJNB 1ASBA 1G7WA 3AZIB 5AV9A 1EQBA 3C1BB 1TOJA 2G5IC 3W97C 4WU8B 9AATA 4XJMA 3DC1A 5B24A 3B6FD 1ASAA 5IWQA 1N1JA 3UT9C 1GC2A 3FDDA 2ZY5A 4DRAA 1ARTA 2W8WA 4W91A 2D65A 2EPJA 2DGKA 3B0BA 2CV5D 4RM1A 5B33B 4A0HA 1YNUA 5AVCB 1TPLA 3W97A 5EUDA 2V1PA 5G49A 2BI1A 1P3OD 4LD9C 2AY2A 1IJIA 1TZYC 2E7IA 1AOIC 4W5KA 1GCKA 1LW5A 5AV8B 1P3GD 1U08A 1R4VA 4IW7A 3JTXA 4W8IA 1LW4A 3PA9A 5DX5A 4M6BA 4H9PA 5B24D 2DF4C 4J8VB 3MC6C 4E77A 2YKXA 1P3PC 2YFVB 4LD9A 5FT6A 3LJAC 3H7FA 3BS8A 1DKAA 3C1CD 2FJ7C 2EYQA 1FG3A 5B33C 4DGTA 1P34B 3R45B 4J8WB 4KUDC 3MC6A 1FC4A 2BYMB 3AFAC 1P3PA 3FKDA 1YAAA 3REHC 4EO5B 4QLCB 3UT9D 2YCNA 1RVUA 4TMRA 1BT4A 1JF9A 5AV6B 1OHYA 3LJAA 3PDBA 4RLGA 5DNNB 1GDEA 1BFMA 4P3MA 4HGAC 2FJ7A 1LC5A 3A1IA 3H0MC 5B33A 5CP6C 5AVCA 2L5AA 3B1DA 3E2ZB 1TZYD 3LG0A 5B1MB 3AFAA 1AOID 3MGPB 1G4VA 2OGEA 2W8JA 3REHA 1AAWA 3QPGA 4UOYA 5E4ZA 4BA4A 1CZEA 2Z1ZA 5K8BA 4A6TA 3ELEA 1DFOA 2Y2NA 1LC7A 1AMQA 3ATHA 2Z9VA 4E3RA 1MAQA 1QISA 3PIUA 2JSSA 1KX3B 4J8VA 1P3PD 2JJFA 4XJOA 2YFVA 3B6GB 3LJAD 1C7OA 3WTPC 1AJSA 1S32D 4MY5A 4WYGA 1M1AB 5F9SA 5DNNC 3MGRD 2FJ7D 2W7GA 1ASEA 2A1VA 1M18C 5EQCA 5FUGA 4XEWA 3RQ1A 1P34A 3R45A 1PFFA 3NQJB 4KUDD 2WK7A 4WYAA 3AFAD 4Q31A 3REHD 4WU9B 3MAFB 1P3BB 1B67A 2D64A 3WTPA 1P3FB 1X0MA 2TPLA 5DNNA 4AO4A 1ASFA 4IYOA 2QBTA 1TARA 3AZNC 5CP6D 2UWXA 1O4SA 1AX4A 1GC0A 3MGPA 1S07A 1U35C 3BB8A 3MGQB 1AAMA 1E5FA 3VAXA 3X1UB 3UTBD 3QM2A 4CXRA 3HBXA 4R5ZA 3LZ1D 3BV0A 1AKAA 3F9TA 4NE5A 1UU2A 3AZFB 5B31C 3B6GA 2R5CB 4ZDOA 1YJSA 1HTAA 4Z5TB 4G91C 4FL0A 5KDMB 3WTPD 1X2AA 1U35A 2ZY2A 1DGDA 2FN6A 5DJ9A 5EAAA 4IX8A 3B0DB 3AZGB 3WGCA 4F5MA 1GBNA 2GMUA 4WXFA 1XEYA 1M18D 3CQ6A 3NRAA 4U2HA 3AZKB 3REJC 5GSUB 4WV4B 4YM6B 3MAFA 4RITA 2VGUA 3AELA 3MGQC 3UTAD 5HXXA 1ASCA 4H9OA 4ATQA 2PO3A 5I92A 3CAIA 3E9KA 4E44A 4NE3A 4FFCA 3DRDA 3AZED 4ZASA 4YS3B 3AZND 1GEXA 4XUJC 1DTYA 2NQBC 4XZQB 5AV5C 3REJA 4OTLA 1T3UA 1S0AA 1IAYA 3AOVA 1SZSA 3VK4A 4CSRB 3WX9A 1HQ3C 2W7HA 3G7QA 1U35D 1BJ4A 3M5UA 3VH5T 3MGQA 1LC8A 1ASGA 3EZ1A 1S08A 3LZ0B 3AZMB 4L0OA 3AZGC 2D5YA 3GZDC 4JF1A 1BS0A 5GSUC 2VLFA 2NQBA 2PYOC 4AWLC 2VGSA 1UU0A 3II0A 1IVRA 2FYFA 1B5PA 5B31D 4NE6A 4XQ2A 4CBSA 3MGSC 2R5CA 5GT3B 2OQXA 2VMUA 5KDMA 2WKAA 3REIB 1AHYA 2JCHA 4J8LA 4UHOA 2YKVA 3RI6A 4ZSYA 3AZGA 4W1XA 2HUUA 4I8AA 3USFA 4Y0IA 4XZQC 1O62A 3PDXA 3REJD 3AZKA 5GSUA 3EG5B 2PYOA 3FZ6A 1CQ8A 2W7KA 1ID3B 5E5AB 5AVBB 5B2IB 1WYUB 1D7VA 1MLYA 4JF0A 1PG8A 5E3KA 2Y2MA 3MNNC 1RV3A 2YRRA 1GEYA 2C81A 2Z1YA 3E2FA 3PD6A 4HF8A 2BWOA 4AH3A 1BH8B 1PMOA 4XUJD 4YS3A 1PZRA 4XZQA 4KYOA 5AV5D 3EUCA 4F4EA 2CH1A 3TU4C 4LNMA 2CINA 2VMXA 5GXQC 1IX6A 2DOUA 3K40A 5GT3C 1HQ3D 5TF5A 1VJOA 1WKGA 3MBBA 4H9RA 1ARGA 3MNNA 1KKPA 4E45A 3B1CA
chains in the Genus database with same CATH topology
1BQAA 2Y2PA 2AY3A 1MAPA 3FVXA 5B0YC 4KHAA 1BKGA 2F8NA 2PYOD 1CQ6A 2VMNA 1ID3C 1YIZA 3MGSD 5GXQA 4A6UA 1CQ7A 2JISA 1WWSA 5GT3A 2ZY4A 5BS7C 1SZKA 2W8VA 2CANA 5BJ3A 1TAFB 2OKKA 3KXBC 5B0YA 3B6FB 4KAMA 3KUYC 1CL1A 2AROD 3ZZJA 1ID3A 5B2IA 1WYUA 4IXSA 3Q8NA 3WY7A 4X23C 3MNND 4WJ3C 1ELUA 4ZDPA 3MADA 2CV5B 1ASMA 1BH8A 2F8ND 3LELC 2HIOC 3KXBA 1B5OA 2O1BA 3TU4D 3AL0C 3E77A 5GXQD 3VH6W 1ZLAD 2NMPA 3RELC 1D7RA 2HZPA 3KKIA 2VMVA 4X23A 3X1SC 1AMSA 4Z66C 5B24B 5B0YD 1J32A 2F8NH 3DODA 2D61A 3LELA 3COGA 3N7NA 3NYSA 4UPKA 2HIOA 4U1TA 1AY4A 3AV7A 4K05A 3ISLA 1ELQA 5B32C 3C1CB 2BG1A 3X1SA 3LVLB 4PVFA 5G4JA 1V2DA 2BI3A 5G49B 2ZC0A 2CJHA 1P3OC 3BCAA 2CFBA 3B6FA 3WLXA 3VH5A 1OATA 3KUYD 4M2KA 3UT9B 4E1OA 2HORA 3EIAA 5CPKC 1P3GC 2VMQA 5E5IA 4M2JA 1UKJA 3NUBA 4X23D 3DR7A 3FVUA 2CV5A 4H9PB 3W1HA 4XK1A 5BT1C 3LELD 3IHJA 1G7XA 2HIOD 4LD9B 1P3OA 3KFUG 1TZYB 1P3IC 1AOIB 3DU4A 3RELD 1P3GA 1OXOA 1TASA 3C1CC 3W99D 3X1SD 2ZSLA 1QITA 2IO5B 4OCAA 4Z66D 1A7WA 2HP2A 4CAYB 2LY8A 1P3PB 4F5LA 1KX5C 1TOGA 1P3IA 3DXVA 3LJAB 3PDBB 1GC4A 5EUEA 3W98C 3MGRB 3VH6T 5B32D 1ASDA 3B0CW 3C1CA 2FJ7B 3GBXA 4NFTA 3AEPA 1AHXA 2BKWA 1YJZA 4WLHA 3L44A 1M6SA 3KGWA 1YJYA 3GETA 4J8UC 4KUDB 4UHMA 3AFAB 4WD2A 3REHB 5AX8A 3H9XA 3UT9A 1AMRA 5CPKD 1ORDA 1N8PA 2XBNA 3WKJC 3FTBA 5BJ4A 1SVVA 3NU8A 4IXZA 4HGAB 1I29A 3I16A 2IO5C 3AYWC 2W7JA 4A0FA 5CP6B 4H51A 5BT1D 4WYDA 1P3ID 1N2TA 4ITGA 1TZYA 1AOIA 2HOZA 1F1EA 1AJSB 1BJOB 1S32C 3WKJA 3MGRC 3UTBB 3TATA 1H0CA 3AOWA 2GMSA 2W7LA 5FUGB 3AYWA 3F0HA 2BI2A 1QGNA 3LZ1B 2YOBA 4CAYA 5M49A 3FDBA 1KX5D 1D7UA 4R8DA 2VYCA 1I43A 2JJGA 3WTPB 2W8UA 3HLMA 1S32A 3W98D 3OP7A 3MGRA 3FQ7A 4IYOB 1M18B 3BCXA 3JZLA 5FT4A 1CZCA 1Q9CA 4J8UD 4KUDA 1Z2CB 2Q7WA 3JW9A 1WYTA 1IBJA 3N75A 2V0YA 3WKJD 4H63Q 1P3LD 1W7MA 3UTBC 3AZLC 3FFRA 3P1TA 3AYWD 3AZEB 2Y2HA 5D95A 3AZNB 2Z9UA 5CP6A 3LZ1C 2R0TA 3B0CT 2QB2A 2EZ1A 4ZSWA 2VLHA 4ZLVA 1WWIA 3DXWA 3WKRA 1FG7A 4ZM3A 3AATA 1J04A 3AV2C 1U35B 1BJOA 3E2YA 1JS6A 4GDYA 1C0NA 3UTBA 3AZLA 4WZSB 4KXKA 2AEUA 3LZ1A 3RBFA 4F5GA 4HVKA 3I5TA 5B31B 3MVDC 5JA4B 4G91B 3UTAC 1ECXA 2CSTA 4H9OB 2O7CA 5B2JD 1RV4A 1KX4C 5AY8C 3N0LA 4XAUA 5CHLB 3REKD 3AZJC 4WYCA 3AZEC 1M18A 2QLRA 2F2AC 3REJB 2VI9A 5AV8D 2GB3A 3PAAA 5JRGC 4ADCA 1P3MC 4W1VA 4F5IA 3MVDA 2FNIA 2ZM5A 1P3AC 3UTAA 4H9QB 5BNXB 5AY8A 2NZDC 3AZLD 2BWNA 2ZSMA 3AZEA 5G09A 1V72A 4XUJB 3AZNA 2NQBB 3QHXA 4PIWA 5AV5B 3EI6A 3DZZA 1O61A 1QJ3A 3AZHC 5JRGA 1G4XA 1HQ3B 5CPIC 3AV2D 4WYFA 2PB0A 3NYUA 1P3AA 4F5HA 4G92B 4IY7A 2RVQC 3W96C 2OATA 2NZDA 4J8WD 4BHDA 5FT5A 3I4JA 1CS1A 5KTBA 4Z2MH 2PYOB 4AWLB 5J8QA 1H3OB 2HUEB 2CY8A 3X1VD 5B31A 3MVDD 3MGSB 5DNMC 2DR1A 1WYVB 5JA4A 4RAEA 4EMYA 3O62C 3DR4A 1KX4D 5AY8D 4WLJA 1DJ9A 1ARIA 1M4NA 2AY9A 3AZJD 3PD6B 2Y2GA 4KGCC 3WA9C 4A0GA 4ZM4A 4MKJA 1V2FA 2ZYJA 2FQ6A 5JRGD 3IP4C 1P3MD 2YRIA 2YKUA 1OXPA 5DNMA 1P3AD 5BO0A 4G92C 4H9RB 1D2FA 3MNNB 1T3IA 4H9QA 5BNXA 2NZDD 1S06A 5G0AA 4KGCA 4KHAB 3HQTA 1AHFA 2F8NB 1JS3A 4XUJA 2VMPA 5AV5A 2HUEC 3TU4B 1JFIA 1M19C 1ZC9A 5GXQB 2C0RA 3AZHD 1IUGA 5CPID 1HQ3A 2FNUA 3E6GA 2W7IA 2OKJA 4ZDLA 2W7FA 3B1EA 1W7NA 2RVQD 3W96D 1B8GA 4OT8A 3GZDA 2Y2LA 3ZRPA 4OBVA 3EZSA 5B0YB 5C3IB 3PPLA 1I41A 4DRBA 3EI5A 1H3OA 3FSLA 2AROC 3PJ0A 3X1TC 1M19A 3MGSA 5DNMD 4ZUXC 1EQZC 1ZOBA 3ASAA 1AHEA 1WYVA 4J8XC 3O62D 3WTPE 1M0OA 2W8SA 3AN2C 4ATPA 2GSAA 4LW2A 2D7YA 2QSRA 4GE4A 4KGCD 3WA9D 4ZAHA 5B40C 3KXBB 1MDOA 3NUIA 5B1LC 2FFFB 2Y2OA 2RIQA 3KUYB 3EI9A 1ZLAC 2AROA 5D5SA 1RVYA 1TOKA 4ZUXA 1EQZA 5B0ZC 4X23B 2G6WA 4OC9A 4ZWMA 3FZ8A 1M7YA 4RJ0A 4Q75A 1DJEA 2CJDA 3VOMA 3EPHA 5C3IC 2JE5A 3LELB 2HIOB 2R5EA 4Z5TD 5B31G 5B1LA 3TU4A 1LS3A 3WAAC 1M19D 2O0RA 2WK8A 4F5FA 3FQ8A 2Y2QA 1ZLAA 3RELB 3NNKA 1OHVA 2EO5A 3KWQC 1YOOA 5B0ZA 4A00A 4AZJA 3X1SB 4B98A 1DGEA 2W7MA 3AV1C 4Z66B 1SZUA 4H9SC 2BYKA 3VK3A 5M4DA 2Z9XA 4JEYA 4XJLA 1F66C 4LNLA 3X1TD 3WAAA 5EAVA 2W7DA 4ZUXD 2X8UA 1EQZD 1W3UA 4J8XD 5BS7A 3EI8A 3AN2D 3N4RA 5B32B 3KSYA 1ASLA 2VGZA 3HT4A 5B40D 4R8PC 2G5HC 3AV1A 2VGVA 2VQRA 3AENA 1P3OB 1MDZA 3OKSA 5B1LD 5BNVA 3KUYA 4ZBJC 1F66A 2JJHA 5CPKB 1P3GB 3AZMD 1TOIA 2D7ZA 1WSTA 5B0ZD 4GE9A 2QB3A 3GZCA 3W99C 1Z7DA 2J8PA 5CPJC 4PFFA 1QZ9A 2EGYA 3N4SA 1Z3ZA 4R8PA 3NYTA 4JEVA 1V2EA 4JEXA 5F99C 1AHGA 1P3IB 2ZUKA 2WB6A 5GT0D 3WAAD 3RELA 3KWQD 1UU1A 3W1JA 2Y2JA 1CJ0A 1ZODA 3W99A 2QA3A 3RUYA 3AV1D 4Z66A 2BIAA 3N4XA 5E5AD 3ECDA 5F99A 1KX5B 1F66D 2JGTA 2Z20A 2D66A 3TFUA 4EU1A 3VK2A 3ELPA 4B9BA 2KFPA 4K2BA 3ASBA 2VMWA 3A9XA 3FD0A 3W98B 5B32A 2BWPA 3FRKA 2VI8A 4R8PD 2F8NG 4J8UB 1MLZA 3HL2A 2VIAA 2Y2KA 4BMKA 1C7GA 5CPKA 3WKJB 1OHWA 3LV2A 4MKKA 3HVYA 4EB5A 4WNNA 4Y0DA 5CPJD 3AYWB 1O69A 1IX8A 4WP0A 5F99D 2YCPA 3G0TA 1P3KC 2D63A 4TN4A 1S32B 2Z61A 1W7LA 3MAUA 1AICA 1BJWA 1B9IA 4A6RA 1AMAA 1WKHA 3CBFA 1WYTB 1KX5A 2X5FA 3A6ND 4ZWVA 1P3KA 5B2JB 2RFVA 2VMYA 1P3LC 5EIGB 1P3WA 3KE3A 3KGXA 3VP6A 3W98A 3REKB 2VMOA 1QIRA 2XD1A 1LK9A 3N5MA 2BIGA 4J8UA 2QMAA 4BA5A 3F6TA 4RIZA 4RJYA 1BJNA 4UHNA 4JJNC 3TFTA 5AV9D 3AZIC 3C1BC 4ADDA 1P3LA 3ZZKA 4WU8C 4A0RA 1N31A 3AZLB 3BN1A 1BW0A 1BH9B 3BC8A 4AZKA 1AKBA 1DJUA 2ZY3A 4JJNA 1P3KD 3TQXA 3AV2B 5B2JC 2DGMA 4NOGA 3AZIA 3C1BA 3UE8A 5B32G 5AVCC 3REKC 3W97D 1VP4A 4CXQA 4WU8A 4ISYA 2HUIA 1M0PA 1AKCA 5DJ1A 5AV8C 4CVQA 3G8MA 2YKYA 3X1VB 3MVDB 3K28A 1MGVA 4GRXA 2OGAA 1QJ5A 1AY8A 3UTAB 4MQQA 1C9CA 5B2JA 5M46A 1KX4B 5EIGA 5AY8B 1D7SA 4PFNA 4R5FA 3AZJB 4J8VC 3REKA 4LD9D 1I48A 2DKBA 3CQ5A 2AY8A 1Y4IA 5AV8A 5JRGB 4F5KA 1P3MB 4JJND 4CBRA 3AZID 1P3AB 3C1BD 1KL1A 1M0QA 3GWPA 4WU8D 4LNJA 2NZDB 1SFFA 1P34C 3RCHB 4J8WC 3K7YA 4H9NB 2AY4A 3T32A 3UWCA 1C4KA 4EO5C 4QLCC 1BH9A 4OYTA 5AV6C 1AY5A 1SF2A 4WB0B 3X1VC 1KKJA 4EB7A 1B6WA 4MQRA 1IAXA 3W1IA 3AZHB 5CPIB 4EFFA 3FQAA 5M4BA 1ASNA 3AV2A 3FFHA 4E3QA 4WXBA 1AIAA 5B33D 2DKJA 5AVCD 4N0WA 3W96B 4AOAA 4J8WA 3CQ4A 2BYMA 5B1MC 3MGPC 2CJGA 3VH5W 4QLCA 3D6KA 1H1CA 2CH2A 5AV6A 3X1VA 2BI5A 2AEVA 5DNMB 5BO0B 3O62B 1KX4A 2VGWA 2X5DA 2W8TA 4DQ6A 1KL2A 1KX3C 4J8VD 3AZJA 3WA9B 4KGCB 1C7NA 3NDNA 3B6GC 3E2ZA 5B1MA 5HDMA 1JFIB 2C44A 2HP1A 3VH6A 1M1AC 3GJUA 1P3MA 2FM1A 2BIEA 3QN6A 2ZJGA 4JEZA 3NU7A 3AEJC 3B46A 1P34D 3RCHA 1KX3A 1CL2A 1M32A 4H9NA 3P6KA 1KMJA 4WU9C 1EJIA 4QLCD 1P3BC 2CTZA 5AV6D 1E5EA 4WB0A 1M19B 1P3FC 5DNND 1M1AA 3AZHA 5CPIA 3P5JB 2VGTA 2PB2A 3TCMA 4W1WA 5DB5A 3L8AA 2EZ2A 3AEJA 2CWEA 3W96A 3H0RC 3AEMC 3NQJA 3WZFA 5B1MD 3MGPD 2VIBA 2F8JA 1XI9A 1KU5A 4WU9A 4ITXA 4AO9A 1P3BA 2AROB 4F5JA 3X1TB 3ZRRA 4ZUXB 3X1UC 1P3FA 1EQZB 5FT8A 4ADEA 4J8XB 3O62A 3AN2B 3V9RB 1KX3D 3WA9A 3EI7A 3FVSA 3AZFC 3AEMA 5B40B 5C6UA 1BQDA 3B6GD 4GE7A 3FCRA 4Z2MG 4Z5TC 3DYDA 5B1LB 4WXGA 1M1AD 1S09A 1ZLAB 3EIBA 3B0DC 2WK9A 2BYLA 4OBUA 1B4XA 3X1UA 3EPKA 5B0ZB 1YIYA 2XD5A 4DQYB 3AZKC 1PMMA 3QBOA 3AZFA 2BYKB 4WU9D 4YM6C 1P3BD 4Z5TA 5F8VA 2FKIA 3NQUB 5GT0B 3BCBA 3WAAB 3HDOA 1P3FD 1JG8A 1AJRA 4MQPA 3KWQB 1ARSA 2R2NA 4GSAA 4YS3C 2XH1A 1GEWA 3EPLA 3AV1B 3B8XA 2HOXA 3AENB 4GEBA 2JJEA 4UQVA 5EFSA 5BNVB 3ACZA 3QGUA 3AEOA 4YM6A 3LY1A 1F66B 3JWAA 4ADBA 3MGQD 3A2BA 2ORDA 3X1TA 4O6ZA 3LZ0C 3AZMC 3X1UD 4UUZB 2ZP7A 4J8XA 4OMAA 2YCTA 1X29A 3AN2A 4R2NA 3V9RA 4K2IA 2NQBD 3QI6A 3FZ7A 4IXOA 3WKSA 3WCNA 3AZFD 4Y0HA 3PGYA 4R8PB 5B40A 2C7TA 3HMUA 3R4TA 3NTJA 1MDXA 4CSRA 3REIC 5GT0C 2VMTA 4ZBJB 3A9YA 4XJPA 3LZ0A 3AZMA 2GQNA 3AZGD 5JAYA 3JWBA 4Q6RA 2F8NK 3W99B 1GD9A 2Z9WA 3AZKD 5GSUD 5CPJB 3WGBA 5AVBC 5E5AC 5B2IC 2EH6A 2X3LA 4A72A 4YM6D 5F99B 5HHYA 5G2PA 4RKDA 2G7JA 4M2MA 3NX3A 2CB1A 3NQUA 3REIA 2Y2IA 5GT0A 2AY1A 4P7YA 2AATA 4J5UA 4WYEA 3KWQA 1B9HA 5G4IA 2VMZA 2AY5A 3BWNC 4YS3D 4XZQD 4LC3A 2AY7A 2HOYA 3A8UX 3LWSA 4H9SA 2YFWB 5E5AA 5AVBA 1AIBA 3UAKA 3A6NB 1SPAA 3LZ0D 1VEFA 7AATA 4LW4A 2JG2A 2BYJA 4UUZA 3GR9A 1W2EA 2VMSA 5G2QA 2YHKA 4WNNB 3BWNA 2VMRA 3A9ZA 1LKCA 5EUNA 3ZRQA 4K2MA 5GT3D 3REID 2E7UA 8AATA 5AV9B 3H0LC 1X28A 3BWOA 1ULYA 1ARHA 3B6FC 5CPJA 1N1JB 4MSOA 1ID3D 3MKJA 5AVBD 4BQ0A 5B2ID 3EPJA 3LVMA 2BHXA 2E54A 3A6NC 2W7EA 1P3KB 2CV5C 1KMKA 4RKCA 1M0NA 3W97B 3GSBA 3KXBD 1TAFA 1W23A 3RBLA 1TATA 4WBTA 4QGRA 2YFWA 3MEBA 4JEWA 5AV9C 3A6NA 1P3LB 1TOEA 4DBCA 5B24C 1EG5A 2DGLA 3WCOA 1IX7A 2DQNC 2E7JA 3R9AA 3LVJA 1GC3A 2BI9A 3A1KA 2HUFA 2AY6A 4Q76A 3LVKA 4JJNB 1ASBA 1G7WA 3AZIB 5AV9A 1EQBA 3C1BB 1TOJA 2G5IC 3W97C 4WU8B 9AATA 4XJMA 3DC1A 5B24A 3B6FD 1ASAA 5IWQA 1N1JA 3UT9C 1GC2A 3FDDA 2ZY5A 4DRAA 1ARTA 2W8WA 4W91A 2D65A 2EPJA 2DGKA 3B0BA 2CV5D 4RM1A 5B33B 4A0HA 1YNUA 5AVCB 1TPLA 3W97A 5EUDA 2V1PA 5G49A 2BI1A 1P3OD 4LD9C 2AY2A 1IJIA 1TZYC 2E7IA 1AOIC 4W5KA 1GCKA 1LW5A 5AV8B 1P3GD 1U08A 1R4VA 4IW7A 3JTXA 4W8IA 1LW4A 3PA9A 5DX5A 4M6BA 4H9PA 5B24D 2DF4C 4J8VB 3MC6C 4E77A 2YKXA 1P3PC 2YFVB 4LD9A 5FT6A 3LJAC 3H7FA 3BS8A 1DKAA 3C1CD 2FJ7C 2EYQA 1FG3A 5B33C 4DGTA 1P34B 3R45B 4J8WB 4KUDC 3MC6A 1FC4A 2BYMB 3AFAC 1P3PA 3FKDA 1YAAA 3REHC 4EO5B 4QLCB 3UT9D 2YCNA 1RVUA 4TMRA 1BT4A 1JF9A 5AV6B 1OHYA 3LJAA 3PDBA 4RLGA 5DNNB 1GDEA 1BFMA 4P3MA 4HGAC 2FJ7A 1LC5A 3A1IA 3H0MC 5B33A 5CP6C 5AVCA 2L5AA 3B1DA 3E2ZB 1TZYD 3LG0A 5B1MB 3AFAA 1AOID 3MGPB 1G4VA 2OGEA 2W8JA 3REHA 1AAWA 3QPGA 4UOYA 5E4ZA 4BA4A 1CZEA 2Z1ZA 5K8BA 4A6TA 3ELEA 1DFOA 2Y2NA 1LC7A 1AMQA 3ATHA 2Z9VA 4E3RA 1MAQA 1QISA 3PIUA 2JSSA 1KX3B 4J8VA 1P3PD 2JJFA 4XJOA 2YFVA 3B6GB 3LJAD 1C7OA 3WTPC 1AJSA 1S32D 4MY5A 4WYGA 1M1AB 5F9SA 5DNNC 3MGRD 2FJ7D 2W7GA 1ASEA 2A1VA 1M18C 5EQCA 5FUGA 4XEWA 3RQ1A 1P34A 3R45A 1PFFA 3NQJB 4KUDD 2WK7A 4WYAA 3AFAD 4Q31A 3REHD 4WU9B 3MAFB 1P3BB 1B67A 2D64A 3WTPA 1P3FB 1X0MA 2TPLA 5DNNA 4AO4A 1ASFA 4IYOA 2QBTA 1TARA 3AZNC 5CP6D 2UWXA 1O4SA 1AX4A 1GC0A 3MGPA 1S07A 1U35C 3BB8A 3MGQB 1AAMA 1E5FA 3VAXA 3X1UB 3UTBD 3QM2A 4CXRA 3HBXA 4R5ZA 3LZ1D 3BV0A 1AKAA 3F9TA 4NE5A 1UU2A 3AZFB 5B31C 3B6GA 2R5CB 4ZDOA 1YJSA 1HTAA 4Z5TB 4G91C 4FL0A 5KDMB 3WTPD 1X2AA 1U35A 2ZY2A 1DGDA 2FN6A 5DJ9A 5EAAA 4IX8A 3B0DB 3AZGB 3WGCA 4F5MA 1GBNA 2GMUA 4WXFA 1XEYA 1M18D 3CQ6A 3NRAA 4U2HA 3AZKB 3REJC 5GSUB 4WV4B 4YM6B 3MAFA 4RITA 2VGUA 3AELA 3MGQC 3UTAD 5HXXA 1ASCA 4H9OA 4ATQA 2PO3A 5I92A 3CAIA 3E9KA 4E44A 4NE3A 4FFCA 3DRDA 3AZED 4ZASA 4YS3B 3AZND 1GEXA 4XUJC 1DTYA 2NQBC 4XZQB 5AV5C 3REJA 4OTLA 1T3UA 1S0AA 1IAYA 3AOVA 1SZSA 3VK4A 4CSRB 3WX9A 1HQ3C 2W7HA 3G7QA 1U35D 1BJ4A 3M5UA 3VH5T 3MGQA 1LC8A 1ASGA 3EZ1A 1S08A 3LZ0B 3AZMB 4L0OA 3AZGC 2D5YA 3GZDC 4JF1A 1BS0A 5GSUC 2VLFA 2NQBA 2PYOC 4AWLC 2VGSA 1UU0A 3II0A 1IVRA 2FYFA 1B5PA 5B31D 4NE6A 4XQ2A 4CBSA 3MGSC 2R5CA 5GT3B 2OQXA 2VMUA 5KDMA 2WKAA 3REIB 1AHYA 2JCHA 4J8LA 4UHOA 2YKVA 3RI6A 4ZSYA 3AZGA 4W1XA 2HUUA 4I8AA 3USFA 4Y0IA 4XZQC 1O62A 3PDXA 3REJD 3AZKA 5GSUA 3EG5B 2PYOA 3FZ6A 1CQ8A 2W7KA 1ID3B 5E5AB 5AVBB 5B2IB 1WYUB 1D7VA 1MLYA 4JF0A 1PG8A 5E3KA 2Y2MA 3MNNC 1RV3A 2YRRA 1GEYA 2C81A 2Z1YA 3E2FA 3PD6A 4HF8A 2BWOA 4AH3A 1BH8B 1PMOA 4XUJD 4YS3A 1PZRA 4XZQA 4KYOA 5AV5D 3EUCA 4F4EA 2CH1A 3TU4C 4LNMA 2CINA 2VMXA 5GXQC 1IX6A 2DOUA 3K40A 5GT3C 1HQ3D 5TF5A 1VJOA 1WKGA 3MBBA 4H9RA 1ARGA 3MNNA 1KKPA 4E45A 3B1CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CVQ A;  1BQA A;  4JEW A;  1CS1 A;  3G8M A;  2YKY A;  2AY3 A;  1MAP A;  3FVX A;  3K28 A;  1MGV A;  5J8Q A;  4GRX A;  1TOE A;  1BKG A;  2OGA A;  4DBC A;  1QJ5 A;  1AY8 A;  2CY8 A;  4MQQ A;  1C9C A;  1EG5 A;  1CQ6 A;  5M46 A;  5EIG A;  2DR1 A;  2VMN A;  1D7S A;  1IX7 A;  1WYV B;  1YIZ A;  4PFN A;  4R5F A;  4RAE A;  4EMY A;  2E7J A;  3DR4 A;  3R9A A;  4A6U A;  1CQ7 A;  3LVJ A;  1GC3 A;  1DJ9 A;  4WLJ A;  1ARI A;  2ZY4 A;  1M4N A;  2AY9 A;  1I48 A;  2BI9 A;  3PD6 B;  2DKB A;  3CQ5 A;  2HUF A;  2AY8 A;  2AY6 A;  4A0G A;  1Y4I A;  4Q76 A;  3LVK A;  1SZK A;  1ASB A;  1G7W A;  4ZM4 A;  2W8V A;  4F5K A;  1EQB A;  1TOJ A;  2CAN A;  4MKJ A;  1V2F A;  2ZYJ A;  4CBR A;  5BJ3 A;  2FQ6 A;  4KAM A;  9AAT A;  4XJM A;  1KL1 A;  3DC1 A;  2YRI A;  2YKU A;  1M0Q A;  1CL1 A;  1OXP A;  4LNJ A;  3ZZJ A;  1SFF A;  1D2F A;  3RCH B;  1T3I A;  1ASA A;  1WYU A;  3K7Y A;  5IWQ A;  4IXS A;  2AY4 A;  3Q8N A;  1GC2 A;  3T32 A;  3FDD A;  1S06 A;  3UWC A;  3WY7 A;  2ZY5 A;  1C4K A;  5G0A A;  1ELU A;  1ART A;  4ZDP A;  3MAD A;  2W8W A;  3HQT A;  4W91 A;  4OYT A;  1AHF A;  1AY5 A;  1JS3 A;  1SF2 A;  2D65 A;  4WB0 B;  1KKJ A;  2EPJ A;  2VMP A;  4EB7 A;  4MQR A;  1IAX A;  1ASM A;  4EFF A;  4A0H A;  1YNU A;  1TPL A;  3FQA A;  5M4B A;  1ASN A;  1ZC9 A;  3FFH A;  2C0R A;  4E3Q A;  1B5O A;  2O1B A;  2V1P A;  4WXB A;  5EUD A;  1AIA A;  1IUG A;  2BI1 A;  2DKJ A;  2FNU A;  3E6G A;  4N0W A;  2W7I A;  3E77 A;  2AY2 A;  4ZDL A;  1IJI A;  2W7F A;  2E7I A;  3B1E A;  2NMP A;  4W5K A;  4AOA A;  1D7R A;  1GCK A;  1W7N A;  2HZP A;  3CQ4 A;  3KKI A;  1LW5 A;  2VMV A;  1B8G A;  2CJG A;  4OT8 A;  1U08 A;  3GZD A;  3ZRP A;  3D6K A;  4IW7 A;  3JTX A;  4W8I A;  1H1C A;  1AMS A;  1LW4 A;  3EZS A;  3PA9 A;  5DX5 A;  2CH2 A;  3PPL A;  1I41 A;  3EI5 A;  2BI5 A;  1J32 A;  3FSL A;  3DOD A;  3PJ0 A;  2D61 A;  3COG A;  3NYS A;  3MC6 C;  4U1T A;  4E77 A;  2YKX A;  1ZOB A;  3ASA A;  1AHE A;  1WYV A;  2VGW A;  1AY4 A;  2X5D A;  2W8T A;  3AV7 A;  4DQ6 A;  1M0O A;  1KL2 A;  1C7N A;  4ATP A;  3ISL A;  2GSA A;  5FT6 A;  4LW2 A;  2D7Y A;  3NDN A;  4GE4 A;  1ELQ A;  3E2Z A;  3H7F A;  4ZAH A;  5HDM A;  3BS8 A;  1DKA A;  2C44 A;  3LVL B;  4PVF A;  1MDO A;  2HP1 A;  3NUI A;  5G4J A;  1V2D A;  2BI3 A;  1FG3 A;  3GJU A;  2FM1 A;  2ZC0 A;  2CJH A;  2BIE A;  3QN6 A;  3EI9 A;  2ZJG A;  3BCA A;  2CFB A;  4JEZ A;  3WLX A;  4DGT A;  5D5S A;  1OAT A;  1RVY A;  3NU7 A;  4M2K A;  1TOK A;  3MC6 A;  1FC4 A;  3AEJ C;  3B46 A;  2HOR A;  4E1O A;  3FKD A;  3EIA A;  2G6W A;  5E5I A;  2VMQ A;  3RCH A;  4OC9 A;  4ZWM A;  1YAA A;  4M2J A;  1CL2 A;  1M32 A;  2YCN A;  1RVU A;  4TMR A;  1BT4 A;  3P6K A;  1UKJ A;  3NUB A;  1M7Y A;  1KMJ A;  3DR7 A;  1EJI A;  1JF9 A;  1OHY A;  3FVU A;  3PDB A;  2CTZ A;  4Q75 A;  1DJE A;  2CJD A;  3VOM A;  1GDE A;  4P3M A;  1E5E A;  4WB0 A;  4XK1 A;  2R5E A;  1LC5 A;  1LS3 A;  3IHJ A;  1G7X A;  2O0R A;  2VGT A;  2PB2 A;  2WK8 A;  3TCM A;  3FQ8 A;  4F5F A;  4W1W A;  5DB5 A;  3NNK A;  3DU4 A;  1OHV A;  3L8A A;  2EZ2 A;  2EO5 A;  3B1D A;  3E2Z B;  1YOO A;  3AEJ A;  3LG0 A;  1G4V A;  2OGE A;  4A00 A;  3AEM C;  2W8J A;  1AAW A;  4AZJ A;  3WZF A;  1OXO A;  2VIB A;  1DGE A;  1TAS A;  2F8J A;  2W7M A;  4B98 A;  1XI9 A;  3QPG A;  1SZU A;  4ITX A;  2ZSL A;  4UOY A;  5E4Z A;  4AO9 A;  4BA4 A;  1QIT A;  1CZE A;  2Z1Z A;  4OCA A;  5K8B A;  4A6T A;  3VK3 A;  3ELE A;  4F5J A;  1DFO A;  5M4D A;  2Z9X A;  2HP2 A;  4JEY A;  4XJL A;  3ZRR A;  1LC7 A;  1AMQ A;  3ATH A;  4LNL A;  2Z9V A;  5FT8 A;  4E3R A;  1MAQ A;  4F5L A;  4ADE A;  1QIS A;  3PIU A;  5EAV A;  2W7D A;  1TOG A;  2X8U A;  1W3U A;  2JJF A;  4XJO A;  3DXV A;  3EI8 A;  3PDB B;  3EI7 A;  1GC4 A;  3FVS A;  3AEM A;  1ASL A;  5C6U A;  1BQD A;  5EUE A;  2VGZ A;  4GE7 A;  1C7O A;  1AJS A;  3FCR A;  1ASD A;  4MY5 A;  4WYG A;  2VGV A;  3DYD A;  3GBX A;  5F9S A;  3AEP A;  1AHX A;  3AEN A;  2BKW A;  1YJZ A;  4WLH A;  3L44 A;  2W7G A;  1M6S A;  1ASE A;  3KGW A;  4WXG A;  1MDZ A;  3OKS A;  1S09 A;  1YJY A;  3GET A;  3EIB A;  2WK9 A;  2BYL A;  4UHM A;  5EQC A;  2JJH A;  1B4X A;  4XEW A;  3RQ1 A;  1YIY A;  1PFF A;  4WD2 A;  1TOI A;  2D7Z A;  2WK7 A;  5AX8 A;  4WYA A;  1WST A;  4Q31 A;  1AMR A;  1ORD A;  1N8P A;  4GE9 A;  2QB3 A;  2XBN A;  3FTB A;  3GZC A;  5BJ4 A;  3MAF B;  3QBO A;  1Z7D A;  2D64 A;  1SVV A;  4PFF A;  3NU8 A;  1QZ9 A;  4IXZ A;  2EGY A;  1I29 A;  1X0M A;  1Z3Z A;  3NYT A;  2TPL A;  5F8V A;  4AO4 A;  2W7J A;  4JEV A;  1ASF A;  1V2E A;  4JEX A;  4IYO A;  3BCB A;  4A0F A;  1AHG A;  3HDO A;  1JG8 A;  4H51 A;  2ZUK A;  2QBT A;  1TAR A;  1AJR A;  4MQP A;  4WYD A;  1ARS A;  1N2T A;  4ITG A;  1O4S A;  2R2N A;  4GSA A;  2XH1 A;  2HOZ A;  1AX4 A;  1GC0 A;  1GEW A;  1AJS B;  1UU1 A;  1BJO B;  1CJ0 A;  1ZOD A;  3B8X A;  2HOX A;  3AEN B;  1S07 A;  4GEB A;  2JJE A;  3BB8 A;  4UQV A;  2QA3 A;  5EFS A;  3RUY A;  1AAM A;  3ACZ A;  1E5F A;  3TAT A;  1H0C A;  3AEO A;  3QGU A;  3VAX A;  3LY1 A;  3JWA A;  2BIA A;  3AOW A;  2GMS A;  2W7L A;  4ADB A;  3A2B A;  4CXR A;  3QM2 A;  3F0H A;  2BI2 A;  2ORD A;  3ECD A;  1QGN A;  4O6Z A;  2JGT A;  2Z20 A;  2D66 A;  2YOB A;  3TFU A;  4EU1 A;  3VK2 A;  3ELP A;  4B9B A;  4K2B A;  5M49 A;  3ASB A;  3FDB A;  2ZP7 A;  4OMA A;  4R5Z A;  1D7U A;  3BV0 A;  4R8D A;  2VYC A;  2YCT A;  1AKA A;  1X29 A;  3F9T A;  4R2N A;  1UU2 A;  2VMW A;  3A9X A;  1I43 A;  2JJG A;  3QI6 A;  4K2I A;  4IXO A;  3WKS A;  2R5C B;  2W8U A;  4ZDO A;  3HLM A;  2BWP A;  1YJS A;  3PGY A;  3FRK A;  4Y0H A;  2C7T A;  3HMU A;  3R4T A;  4FL0 A;  3OP7 A;  4IYO B;  3FQ7 A;  1X2A A;  2VI8 A;  3NTJ A;  1MDX A;  2ZY2 A;  1DGD A;  2FN6 A;  5DJ9 A;  5EAA A;  3HL2 A;  1MLZ A;  4IX8 A;  3A9Y A;  2VMT A;  3BCX A;  2VIA A;  5FT4 A;  3WGC A;  1CZC A;  4XJP A;  1GBN A;  2GMU A;  4WXF A;  4F5M A;  4BMK A;  2GQN A;  3CQ6 A;  3NRA A;  4U2H A;  5JAY A;  1C7G A;  3JWB A;  4Q6R A;  2Q7W A;  3JW9 A;  1WYT A;  1IBJ A;  1OHW A;  1GD9 A;  2Z9W A;  3LV2 A;  4MKK A;  4EB5 A;  3N75 A;  2V0Y A;  3WGB A;  3MAF A;  2VGU A;  1W7M A;  3AEL A;  4Y0D A;  5HXX A;  1ASC A;  2EH6 A;  1O69 A;  4A72 A;  5HHY A;  3FFR A;  4RKD A;  5G2P A;  4ATQ A;  2PO3 A;  5I92 A;  3CAI A;  4M2M A;  3P1T A;  3NX3 A;  3E9K A;  1IX8 A;  2CB1 A;  5D95 A;  4WP0 A;  2YCP A;  2Z9U A;  2R0T A;  2AY1 A;  4P7Y A;  4FFC A;  2AAT A;  3DRD A;  4ZAS A;  2QB2 A;  4J5U A;  2EZ1 A;  1GEX A;  1DTY A;  2D63 A;  4WYE A;  1B9H A;  4ZSW A;  5G4I A;  2VMZ A;  2VLH A;  2AY5 A;  4TN4 A;  4OTL A;  3BWN C;  1S0A A;  3DXW A;  4ZLV A;  3WKR A;  1FG7 A;  1IAY A;  4ZM3 A;  3AAT A;  3AOV A;  1J04 A;  1SZS A;  4LC3 A;  3VK4 A;  1BJO A;  2Z61 A;  3WX9 A;  2AY7 A;  2HOY A;  3E2Y A;  1JS6 A;  1W7L A;  3MAU A;  3A8U X;  4GDY A;  2W7H A;  3G7Q A;  1AIC A;  3LWS A;  1C0N A;  1BJW A;  1BJ4 A;  3M5U A;  1LC8 A;  1ASG A;  3EZ1 A;  1S08 A;  1B9I A;  4A6R A;  1AMA A;  4L0O A;  1WKH A;  3CBF A;  1AIB A;  2D5Y A;  3GZD C;  3UAK A;  4JF1 A;  4KXK A;  1SPA A;  1WYT B;  2X5F A;  3RBF A;  1VEF A;  7AAT A;  4LW4 A;  2JG2 A;  1BS0 A;  2BYJ A;  4F5G A;  4HVK A;  3I5T A;  4ZWV A;  2VLF A;  3GR9 A;  2VMS A;  2RFV A;  2VGS A;  2VMY A;  5EIG B;  5G2Q A;  1UU0 A;  2YHK A;  3II0 A;  1IVR A;  2FYF A;  1B5P A;  1P3W A;  3BWN A;  3KE3 A;  3KGX A;  2VMR A;  1ECX A;  2CST A;  4XQ2 A;  4CBS A;  2O7C A;  1RV4 A;  3A9Z A;  1LKC A;  2VMO A;  2R5C A;  5EUN A;  3ZRQ A;  3N0L A;  4XAU A;  2OQX A;  2VMU A;  1QIR A;  2WKA A;  1LK9 A;  4K2M A;  3N5M A;  1AHY A;  4WYC A;  2BIG A;  4UHO A;  2QMA A;  2YKV A;  2E7U A;  4BA5 A;  3RI6 A;  3F6T A;  2QLR A;  4RJY A;  4ZSY A;  8AAT A;  1BJN A;  4W1X A;  2HUU A;  2VI9 A;  4I8A A;  4UHN A;  3TFT A;  3USF A;  4Y0I A;  2GB3 A;  1O62 A;  3PAA A;  3PDX A;  1X28 A;  3BWO A;  4ADC A;  4ADD A;  4W1V A;  4F5I A;  2FNI A;  1CQ8 A;  1ARH A;  3ZZK A;  2W7K A;  1WYU B;  4A0R A;  1D7V A;  1N31 A;  4MSO A;  1MLY A;  3BN1 A;  1BW0 A;  4JF0 A;  1PG8 A;  5E3K A;  3MKJ A;  4BQ0 A;  1RV3 A;  2YRR A;  3LVM A;  1GEY A;  2C81 A;  2Z1Y A;  2BHX A;  3BC8 A;  3E2F A;  2BWN A;  2ZSM A;  4AZK A;  1AKB A;  1V72 A;  2E54 A;  2W7E A;  5G09 A;  3PD6 A;  1DJU A;  4HF8 A;  2BWO A;  3QHX A;  3EI6 A;  4PIW A;  4AH3 A;  2ZY3 A;  1KMK A;  4RKC A;  3TQX A;  1M0N A;  1O61 A;  3DZZ A;  4KYO A;  4NOG A;  1QJ3 A;  3EUC A;  4F4E A;  3GSB A;  1G4X A;  2CH1 A;  3UE8 A;  4LNM A;  4WYF A;  2CIN A;  1VP4 A;  2PB0 A;  1IX6 A;  1W23 A;  2VMX A;  3NYU A;  2DOU A;  3K40 A;  4CXQ A;  4F5H A;  4ISY A;  5TF5 A;  4IY7 A;  3RBL A;  1VJO A;  1TAT A;  4WBT A;  2HUI A;  1WKG A;  3MBB A;  2OAT A;  1M0P A;  1AKC A;  1ARG A;  4QGR A;  3MEB A;  1KKP A;  4BHD A;  3B1C A;  5DJ1 A;  5FT5 A;  3I4J A; 
#chains in the Genus database with same CATH topology
 1BQA A;  2Y2P A;  2AY3 A;  1MAP A;  3FVX A;  5B0Y C;  4KHA A;  1BKG A;  2F8N A;  2PYO D;  1CQ6 A;  2VMN A;  1ID3 C;  1YIZ A;  3MGS D;  5GXQ A;  4A6U A;  1CQ7 A;  2JIS A;  1WWS A;  5GT3 A;  2ZY4 A;  5BS7 C;  1SZK A;  2W8V A;  2CAN A;  5BJ3 A;  1TAF B;  2OKK A;  3KXB C;  5B0Y A;  3B6F B;  4KAM A;  3KUY C;  1CL1 A;  2ARO D;  3ZZJ A;  1ID3 A;  5B2I A;  1WYU A;  4IXS A;  3Q8N A;  3WY7 A;  4X23 C;  3MNN D;  4WJ3 C;  1ELU A;  4ZDP A;  3MAD A;  2CV5 B;  1ASM A;  1BH8 A;  2F8N D;  3LEL C;  2HIO C;  3KXB A;  1B5O A;  2O1B A;  3TU4 D;  3AL0 C;  3E77 A;  5GXQ D;  3VH6 W;  1ZLA D;  2NMP A;  3REL C;  1D7R A;  2HZP A;  3KKI A;  2VMV A;  4X23 A;  3X1S C;  1AMS A;  4Z66 C;  5B24 B;  5B0Y D;  1J32 A;  2F8N H;  3DOD A;  2D61 A;  3LEL A;  3COG A;  3N7N A;  3NYS A;  4UPK A;  2HIO A;  4U1T A;  1AY4 A;  3AV7 A;  4K05 A;  3ISL A;  1ELQ A;  5B32 C;  3C1C B;  2BG1 A;  3X1S A;  3LVL B;  4PVF A;  5G4J A;  1V2D A;  2BI3 A;  5G49 B;  2ZC0 A;  2CJH A;  1P3O C;  3BCA A;  2CFB A;  3B6F A;  3WLX A;  3VH5 A;  1OAT A;  3KUY D;  4M2K A;  3UT9 B;  4E1O A;  2HOR A;  3EIA A;  5CPK C;  1P3G C;  2VMQ A;  5E5I A;  4M2J A;  1UKJ A;  3NUB A;  4X23 D;  3DR7 A;  3FVU A;  2CV5 A;  4H9P B;  3W1H A;  4XK1 A;  5BT1 C;  3LEL D;  3IHJ A;  1G7X A;  2HIO D;  4LD9 B;  1P3O A;  3KFU G;  1TZY B;  1P3I C;  1AOI B;  3DU4 A;  3REL D;  1P3G A;  1OXO A;  1TAS A;  3C1C C;  3W99 D;  3X1S D;  2ZSL A;  1QIT A;  2IO5 B;  4OCA A;  4Z66 D;  1A7W A;  2HP2 A;  4CAY B;  2LY8 A;  1P3P B;  4F5L A;  1KX5 C;  1TOG A;  1P3I A;  3DXV A;  3LJA B;  3PDB B;  1GC4 A;  5EUE A;  3W98 C;  3MGR B;  3VH6 T;  5B32 D;  1ASD A;  3B0C W;  3C1C A;  2FJ7 B;  3GBX A;  4NFT A;  3AEP A;  1AHX A;  2BKW A;  1YJZ A;  4WLH A;  3L44 A;  1M6S A;  3KGW A;  1YJY A;  3GET A;  4J8U C;  4KUD B;  4UHM A;  3AFA B;  4WD2 A;  3REH B;  5AX8 A;  3H9X A;  3UT9 A;  1AMR A;  5CPK D;  1ORD A;  1N8P A;  2XBN A;  3WKJ C;  3FTB A;  5BJ4 A;  1SVV A;  3NU8 A;  4IXZ A;  4HGA B;  1I29 A;  3I16 A;  2IO5 C;  3AYW C;  2W7J A;  4A0F A;  5CP6 B;  4H51 A;  5BT1 D;  4WYD A;  1P3I D;  1N2T A;  4ITG A;  1TZY A;  1AOI A;  2HOZ A;  1F1E A;  1AJS B;  1BJO B;  1S32 C;  3WKJ A;  3MGR C;  3UTB B;  3TAT A;  1H0C A;  3AOW A;  2GMS A;  2W7L A;  5FUG B;  3AYW A;  3F0H A;  2BI2 A;  1QGN A;  3LZ1 B;  2YOB A;  4CAY A;  5M49 A;  3FDB A;  1KX5 D;  1D7U A;  4R8D A;  2VYC A;  1I43 A;  2JJG A;  3WTP B;  2W8U A;  3HLM A;  1S32 A;  3W98 D;  3OP7 A;  3MGR A;  3FQ7 A;  4IYO B;  1M18 B;  3BCX A;  3JZL A;  5FT4 A;  1CZC A;  1Q9C A;  4J8U D;  4KUD A;  1Z2C B;  2Q7W A;  3JW9 A;  1WYT A;  1IBJ A;  3N75 A;  2V0Y A;  3WKJ D;  4H63 Q;  1P3L D;  1W7M A;  3UTB C;  3AZL C;  3FFR A;  3P1T A;  3AYW D;  3AZE B;  2Y2H A;  5D95 A;  3AZN B;  2Z9U A;  5CP6 A;  3LZ1 C;  2R0T A;  3B0C T;  2QB2 A;  2EZ1 A;  4ZSW A;  2VLH A;  4ZLV A;  1WWI A;  3DXW A;  3WKR A;  1FG7 A;  4ZM3 A;  3AAT A;  1J04 A;  3AV2 C;  1U35 B;  1BJO A;  3E2Y A;  1JS6 A;  4GDY A;  1C0N A;  3UTB A;  3AZL A;  4WZS B;  4KXK A;  2AEU A;  3LZ1 A;  3RBF A;  4F5G A;  4HVK A;  3I5T A;  5B31 B;  3MVD C;  5JA4 B;  4G91 B;  3UTA C;  1ECX A;  2CST A;  4H9O B;  2O7C A;  5B2J D;  1RV4 A;  1KX4 C;  5AY8 C;  3N0L A;  4XAU A;  5CHL B;  3REK D;  3AZJ C;  4WYC A;  3AZE C;  1M18 A;  2QLR A;  2F2A C;  3REJ B;  2VI9 A;  5AV8 D;  2GB3 A;  3PAA A;  5JRG C;  4ADC A;  1P3M C;  4W1V A;  4F5I A;  3MVD A;  2FNI A;  2ZM5 A;  1P3A C;  3UTA A;  4H9Q B;  5BNX B;  5AY8 A;  2NZD C;  3AZL D;  2BWN A;  2ZSM A;  3AZE A;  5G09 A;  1V72 A;  4XUJ B;  3AZN A;  2NQB B;  3QHX A;  4PIW A;  5AV5 B;  3EI6 A;  3DZZ A;  1O61 A;  1QJ3 A;  3AZH C;  5JRG A;  1G4X A;  1HQ3 B;  5CPI C;  3AV2 D;  4WYF A;  2PB0 A;  3NYU A;  1P3A A;  4F5H A;  4G92 B;  4IY7 A;  2RVQ C;  3W96 C;  2OAT A;  2NZD A;  4J8W D;  4BHD A;  5FT5 A;  3I4J A;  1CS1 A;  5KTB A;  4Z2M H;  2PYO B;  4AWL B;  5J8Q A;  1H3O B;  2HUE B;  2CY8 A;  3X1V D;  5B31 A;  3MVD D;  3MGS B;  5DNM C;  2DR1 A;  1WYV B;  5JA4 A;  4RAE A;  4EMY A;  3O62 C;  3DR4 A;  1KX4 D;  5AY8 D;  4WLJ A;  1DJ9 A;  1ARI A;  1M4N A;  2AY9 A;  3AZJ D;  3PD6 B;  2Y2G A;  4KGC C;  3WA9 C;  4A0G A;  4ZM4 A;  4MKJ A;  1V2F A;  2ZYJ A;  2FQ6 A;  5JRG D;  3IP4 C;  1P3M D;  2YRI A;  2YKU A;  1OXP A;  5DNM A;  1P3A D;  5BO0 A;  4G92 C;  4H9R B;  1D2F A;  3MNN B;  1T3I A;  4H9Q A;  5BNX A;  2NZD D;  1S06 A;  5G0A A;  4KGC A;  4KHA B;  3HQT A;  1AHF A;  2F8N B;  1JS3 A;  4XUJ A;  2VMP A;  5AV5 A;  2HUE C;  3TU4 B;  1JFI A;  1M19 C;  1ZC9 A;  5GXQ B;  2C0R A;  3AZH D;  1IUG A;  5CPI D;  1HQ3 A;  2FNU A;  3E6G A;  2W7I A;  2OKJ A;  4ZDL A;  2W7F A;  3B1E A;  1W7N A;  2RVQ D;  3W96 D;  1B8G A;  4OT8 A;  3GZD A;  2Y2L A;  3ZRP A;  4OBV A;  3EZS A;  5B0Y B;  5C3I B;  3PPL A;  1I41 A;  4DRB A;  3EI5 A;  1H3O A;  3FSL A;  2ARO C;  3PJ0 A;  3X1T C;  1M19 A;  3MGS A;  5DNM D;  4ZUX C;  1EQZ C;  1ZOB A;  3ASA A;  1AHE A;  1WYV A;  4J8X C;  3O62 D;  3WTP E;  1M0O A;  2W8S A;  3AN2 C;  4ATP A;  2GSA A;  4LW2 A;  2D7Y A;  2QSR A;  4GE4 A;  4KGC D;  3WA9 D;  4ZAH A;  5B40 C;  3KXB B;  1MDO A;  3NUI A;  5B1L C;  2FFF B;  2Y2O A;  2RIQ A;  3KUY B;  3EI9 A;  1ZLA C;  2ARO A;  5D5S A;  1RVY A;  1TOK A;  4ZUX A;  1EQZ A;  5B0Z C;  4X23 B;  2G6W A;  4OC9 A;  4ZWM A;  3FZ8 A;  1M7Y A;  4RJ0 A;  4Q75 A;  1DJE A;  2CJD A;  3VOM A;  3EPH A;  5C3I C;  2JE5 A;  3LEL B;  2HIO B;  2R5E A;  4Z5T D;  5B31 G;  5B1L A;  3TU4 A;  1LS3 A;  3WAA C;  1M19 D;  2O0R A;  2WK8 A;  4F5F A;  3FQ8 A;  2Y2Q A;  1ZLA A;  3REL B;  3NNK A;  1OHV A;  2EO5 A;  3KWQ C;  1YOO A;  5B0Z A;  4A00 A;  4AZJ A;  3X1S B;  4B98 A;  1DGE A;  2W7M A;  3AV1 C;  4Z66 B;  1SZU A;  4H9S C;  2BYK A;  3VK3 A;  5M4D A;  2Z9X A;  4JEY A;  4XJL A;  1F66 C;  4LNL A;  3X1T D;  3WAA A;  5EAV A;  2W7D A;  4ZUX D;  2X8U A;  1EQZ D;  1W3U A;  4J8X D;  5BS7 A;  3EI8 A;  3AN2 D;  3N4R A;  5B32 B;  3KSY A;  1ASL A;  2VGZ A;  3HT4 A;  5B40 D;  4R8P C;  2G5H C;  3AV1 A;  2VGV A;  2VQR A;  3AEN A;  1P3O B;  1MDZ A;  3OKS A;  5B1L D;  5BNV A;  3KUY A;  4ZBJ C;  1F66 A;  2JJH A;  5CPK B;  1P3G B;  3AZM D;  1TOI A;  2D7Z A;  1WST A;  5B0Z D;  4GE9 A;  2QB3 A;  3GZC A;  3W99 C;  1Z7D A;  2J8P A;  5CPJ C;  4PFF A;  1QZ9 A;  2EGY A;  3N4S A;  1Z3Z A;  4R8P A;  3NYT A;  4JEV A;  1V2E A;  4JEX A;  5F99 C;  1AHG A;  1P3I B;  2ZUK A;  2WB6 A;  5GT0 D;  3WAA D;  3REL A;  3KWQ D;  1UU1 A;  3W1J A;  2Y2J A;  1CJ0 A;  1ZOD A;  3W99 A;  2QA3 A;  3RUY A;  3AV1 D;  4Z66 A;  2BIA A;  3N4X A;  5E5A D;  3ECD A;  5F99 A;  1KX5 B;  1F66 D;  2JGT A;  2Z20 A;  2D66 A;  3TFU A;  4EU1 A;  3VK2 A;  3ELP A;  4B9B A;  2KFP A;  4K2B A;  3ASB A;  2VMW A;  3A9X A;  3FD0 A;  3W98 B;  5B32 A;  2BWP A;  3FRK A;  2VI8 A;  4R8P D;  2F8N G;  4J8U B;  1MLZ A;  3HL2 A;  2VIA A;  2Y2K A;  4BMK A;  1C7G A;  5CPK A;  3WKJ B;  1OHW A;  3LV2 A;  4MKK A;  3HVY A;  4EB5 A;  4WNN A;  4Y0D A;  5CPJ D;  3AYW B;  1O69 A;  1IX8 A;  4WP0 A;  5F99 D;  2YCP A;  3G0T A;  1P3K C;  2D63 A;  4TN4 A;  1S32 B;  2Z61 A;  1W7L A;  3MAU A;  1AIC A;  1BJW A;  1B9I A;  4A6R A;  1AMA A;  1WKH A;  3CBF A;  1WYT B;  1KX5 A;  2X5F A;  3A6N D;  4ZWV A;  1P3K A;  5B2J B;  2RFV A;  2VMY A;  1P3L C;  5EIG B;  1P3W A;  3KE3 A;  3KGX A;  3VP6 A;  3W98 A;  3REK B;  2VMO A;  1QIR A;  2XD1 A;  1LK9 A;  3N5M A;  2BIG A;  4J8U A;  2QMA A;  4BA5 A;  3F6T A;  4RIZ A;  4RJY A;  1BJN A;  4UHN A;  4JJN C;  3TFT A;  5AV9 D;  3AZI C;  3C1B C;  4ADD A;  1P3L A;  3ZZK A;  4WU8 C;  4A0R A;  1N31 A;  3AZL B;  3BN1 A;  1BW0 A;  1BH9 B;  3BC8 A;  4AZK A;  1AKB A;  1DJU A;  2ZY3 A;  4JJN A;  1P3K D;  3TQX A;  3AV2 B;  5B2J C;  2DGM A;  4NOG A;  3AZI A;  3C1B A;  3UE8 A;  5B32 G;  5AVC C;  3REK C;  3W97 D;  1VP4 A;  4CXQ A;  4WU8 A;  4ISY A;  2HUI A;  1M0P A;  1AKC A;  5DJ1 A;  5AV8 C;  4CVQ A;  3G8M A;  2YKY A;  3X1V B;  3MVD B;  3K28 A;  1MGV A;  4GRX A;  2OGA A;  1QJ5 A;  1AY8 A;  3UTA B;  4MQQ A;  1C9C A;  5B2J A;  5M46 A;  1KX4 B;  5EIG A;  5AY8 B;  1D7S A;  4PFN A;  4R5F A;  3AZJ B;  4J8V C;  3REK A;  4LD9 D;  1I48 A;  2DKB A;  3CQ5 A;  2AY8 A;  1Y4I A;  5AV8 A;  5JRG B;  4F5K A;  1P3M B;  4JJN D;  4CBR A;  3AZI D;  1P3A B;  3C1B D;  1KL1 A;  1M0Q A;  3GWP A;  4WU8 D;  4LNJ A;  2NZD B;  1SFF A;  1P34 C;  3RCH B;  4J8W C;  3K7Y A;  4H9N B;  2AY4 A;  3T32 A;  3UWC A;  1C4K A;  4EO5 C;  4QLC C;  1BH9 A;  4OYT A;  5AV6 C;  1AY5 A;  1SF2 A;  4WB0 B;  3X1V C;  1KKJ A;  4EB7 A;  1B6W A;  4MQR A;  1IAX A;  3W1I A;  3AZH B;  5CPI B;  4EFF A;  3FQA A;  5M4B A;  1ASN A;  3AV2 A;  3FFH A;  4E3Q A;  4WXB A;  1AIA A;  5B33 D;  2DKJ A;  5AVC D;  4N0W A;  3W96 B;  4AOA A;  4J8W A;  3CQ4 A;  2BYM A;  5B1M C;  3MGP C;  2CJG A;  3VH5 W;  4QLC A;  3D6K A;  1H1C A;  2CH2 A;  5AV6 A;  3X1V A;  2BI5 A;  2AEV A;  5DNM B;  5BO0 B;  3O62 B;  1KX4 A;  2VGW A;  2X5D A;  2W8T A;  4DQ6 A;  1KL2 A;  1KX3 C;  4J8V D;  3AZJ A;  3WA9 B;  4KGC B;  1C7N A;  3NDN A;  3B6G C;  3E2Z A;  5B1M A;  5HDM A;  1JFI B;  2C44 A;  2HP1 A;  3VH6 A;  1M1A C;  3GJU A;  1P3M A;  2FM1 A;  2BIE A;  3QN6 A;  2ZJG A;  4JEZ A;  3NU7 A;  3AEJ C;  3B46 A;  1P34 D;  3RCH A;  1KX3 A;  1CL2 A;  1M32 A;  4H9N A;  3P6K A;  1KMJ A;  4WU9 C;  1EJI A;  4QLC D;  1P3B C;  2CTZ A;  5AV6 D;  1E5E A;  4WB0 A;  1M19 B;  1P3F C;  5DNN D;  1M1A A;  3AZH A;  5CPI A;  3P5J B;  2VGT A;  2PB2 A;  3TCM A;  4W1W A;  5DB5 A;  3L8A A;  2EZ2 A;  3AEJ A;  2CWE A;  3W96 A;  3H0R C;  3AEM C;  3NQJ A;  3WZF A;  5B1M D;  3MGP D;  2VIB A;  2F8J A;  1XI9 A;  1KU5 A;  4WU9 A;  4ITX A;  4AO9 A;  1P3B A;  2ARO B;  4F5J A;  3X1T B;  3ZRR A;  4ZUX B;  3X1U C;  1P3F A;  1EQZ B;  5FT8 A;  4ADE A;  4J8X B;  3O62 A;  3AN2 B;  3V9R B;  1KX3 D;  3WA9 A;  3EI7 A;  3FVS A;  3AZF C;  3AEM A;  5B40 B;  5C6U A;  1BQD A;  3B6G D;  4GE7 A;  3FCR A;  4Z2M G;  4Z5T C;  3DYD A;  5B1L B;  4WXG A;  1M1A D;  1S09 A;  1ZLA B;  3EIB A;  3B0D C;  2WK9 A;  2BYL A;  4OBU A;  1B4X A;  3X1U A;  3EPK A;  5B0Z B;  1YIY A;  2XD5 A;  4DQY B;  3AZK C;  1PMM A;  3QBO A;  3AZF A;  2BYK B;  4WU9 D;  4YM6 C;  1P3B D;  4Z5T A;  5F8V A;  2FKI A;  3NQU B;  5GT0 B;  3BCB A;  3WAA B;  3HDO A;  1P3F D;  1JG8 A;  1AJR A;  4MQP A;  3KWQ B;  1ARS A;  2R2N A;  4GSA A;  4YS3 C;  2XH1 A;  1GEW A;  3EPL A;  3AV1 B;  3B8X A;  2HOX A;  3AEN B;  4GEB A;  2JJE A;  4UQV A;  5EFS A;  5BNV B;  3ACZ A;  3QGU A;  3AEO A;  4YM6 A;  3LY1 A;  1F66 B;  3JWA A;  4ADB A;  3MGQ D;  3A2B A;  2ORD A;  3X1T A;  4O6Z A;  3LZ0 C;  3AZM C;  3X1U D;  4UUZ B;  2ZP7 A;  4J8X A;  4OMA A;  2YCT A;  1X29 A;  3AN2 A;  4R2N A;  3V9R A;  4K2I A;  2NQB D;  3QI6 A;  3FZ7 A;  4IXO A;  3WKS A;  3WCN A;  3AZF D;  4Y0H A;  3PGY A;  4R8P B;  5B40 A;  2C7T A;  3HMU A;  3R4T A;  3NTJ A;  1MDX A;  4CSR A;  3REI C;  5GT0 C;  2VMT A;  4ZBJ B;  3A9Y A;  4XJP A;  3LZ0 A;  3AZM A;  2GQN A;  3AZG D;  5JAY A;  3JWB A;  4Q6R A;  1KAF A;  2F8N K;  3W99 B;  1GD9 A;  2Z9W A;  3AZK D;  5GSU D;  5CPJ B;  3WGB A;  5AVB C;  5E5A C;  5B2I C;  2EH6 A;  2X3L A;  4A72 A;  4YM6 D;  5F99 B;  5HHY A;  5G2P A;  4RKD A;  2G7J A;  4M2M A;  3NX3 A;  2CB1 A;  3NQU A;  3REI A;  2Y2I A;  5GT0 A;  2AY1 A;  4P7Y A;  2AAT A;  4J5U A;  4WYE A;  3KWQ A;  1B9H A;  5G4I A;  2VMZ A;  2AY5 A;  3BWN C;  4YS3 D;  4XZQ D;  4LC3 A;  2AY7 A;  2HOY A;  3A8U X;  3LWS A;  4H9S A;  2YFW B;  5E5A A;  5AVB A;  1AIB A;  3UAK A;  3A6N B;  1SPA A;  3LZ0 D;  1VEF A;  7AAT A;  4LW4 A;  2JG2 A;  2BYJ A;  4UUZ A;  3GR9 A;  1W2E A;  2VMS A;  5G2Q A;  2YHK A;  4WNN B;  3BWN A;  2VMR A;  3A9Z A;  1LKC A;  5EUN A;  3ZRQ A;  4K2M A;  5GT3 D;  3REI D;  2E7U A;  8AAT A;  5AV9 B;  3H0L C;  1X28 A;  3BWO A;  1ULY A;  1ARH A;  3B6F C;  5CPJ A;  1N1J B;  4MSO A;  1ID3 D;  3MKJ A;  5AVB D;  4BQ0 A;  5B2I D;  3EPJ A;  3LVM A;  2BHX A;  2E54 A;  3A6N C;  2W7E A;  1P3K B;  2CV5 C;  1KMK A;  4RKC A;  1M0N A;  3W97 B;  3GSB A;  3KXB D;  1TAF A;  1W23 A;  3RBL A;  1TAT A;  4WBT A;  4QGR A;  2YFW A;  3MEB A;  4JEW A;  5AV9 C;  3A6N A;  1P3L B;  1TOE A;  4DBC A;  5B24 C;  1EG5 A;  2DGL A;  3WCO A;  1IX7 A;  2DQN C;  2E7J A;  3R9A A;  3LVJ A;  1GC3 A;  2BI9 A;  3A1K A;  2HUF A;  2AY6 A;  4Q76 A;  3LVK A;  4JJN B;  1ASB A;  1G7W A;  3AZI B;  5AV9 A;  1EQB A;  3C1B B;  1TOJ A;  2G5I C;  3W97 C;  4WU8 B;  9AAT A;  4XJM A;  3DC1 A;  5B24 A;  3B6F D;  1ASA A;  5IWQ A;  1N1J A;  3UT9 C;  1GC2 A;  3FDD A;  2ZY5 A;  4DRA A;  1ART A;  2W8W A;  4W91 A;  2D65 A;  2EPJ A;  2DGK A;  3B0B A;  2CV5 D;  4RM1 A;  5B33 B;  4A0H A;  1YNU A;  5AVC B;  1TPL A;  3W97 A;  5EUD A;  2V1P A;  5G49 A;  2BI1 A;  1P3O D;  4LD9 C;  2AY2 A;  1IJI A;  1TZY C;  2E7I A;  1AOI C;  4W5K A;  1GCK A;  1LW5 A;  5AV8 B;  1P3G D;  1U08 A;  1R4V A;  4IW7 A;  3JTX A;  4W8I A;  1LW4 A;  3PA9 A;  5DX5 A;  4M6B A;  4H9P A;  5B24 D;  2DF4 C;  4J8V B;  3MC6 C;  4E77 A;  2YKX A;  1P3P C;  2YFV B;  4LD9 A;  5FT6 A;  3LJA C;  3H7F A;  3BS8 A;  1DKA A;  3C1C D;  2FJ7 C;  2EYQ A;  1FG3 A;  5B33 C;  4DGT A;  1P34 B;  3R45 B;  4J8W B;  4KUD C;  3MC6 A;  1FC4 A;  2BYM B;  3AFA C;  1P3P A;  3FKD A;  1YAA A;  3REH C;  4EO5 B;  4QLC B;  3UT9 D;  2YCN A;  1RVU A;  4TMR A;  1BT4 A;  1JF9 A;  5AV6 B;  1OHY A;  3LJA A;  3PDB A;  4RLG A;  5DNN B;  1GDE A;  1BFM A;  4P3M A;  4HGA C;  2FJ7 A;  1LC5 A;  3A1I A;  3H0M C;  5B33 A;  5CP6 C;  5AVC A;  2L5A A;  3B1D A;  3E2Z B;  1TZY D;  3LG0 A;  5B1M B;  3AFA A;  1AOI D;  3MGP B;  1G4V A;  2OGE A;  2W8J A;  3REH A;  1AAW A;  3QPG A;  4UOY A;  5E4Z A;  4BA4 A;  1CZE A;  2Z1Z A;  5K8B A;  4A6T A;  3ELE A;  1DFO A;  2Y2N A;  1LC7 A;  1AMQ A;  3ATH A;  2Z9V A;  4E3R A;  1MAQ A;  1QIS A;  3PIU A;  2JSS A;  1KX3 B;  4J8V A;  1P3P D;  2JJF A;  4XJO A;  2YFV A;  3B6G B;  3LJA D;  1C7O A;  3WTP C;  1AJS A;  1S32 D;  4MY5 A;  4WYG A;  1M1A B;  5F9S A;  5DNN C;  3MGR D;  2FJ7 D;  2W7G A;  1ASE A;  2A1V A;  1M18 C;  5EQC A;  5FUG A;  4XEW A;  3RQ1 A;  1P34 A;  3R45 A;  1PFF A;  3NQJ B;  4KUD D;  2WK7 A;  4WYA A;  3AFA D;  4Q31 A;  3REH D;  4WU9 B;  3MAF B;  1P3B B;  1B67 A;  2D64 A;  3WTP A;  1P3F B;  1X0M A;  2TPL A;  5DNN A;  4AO4 A;  1ASF A;  4IYO A;  2QBT A;  1TAR A;  3AZN C;  5CP6 D;  2UWX A;  1O4S A;  1AX4 A;  1GC0 A;  3MGP A;  1S07 A;  1U35 C;  3BB8 A;  3MGQ B;  1AAM A;  1E5F A;  3VAX A;  3X1U B;  3UTB D;  3QM2 A;  4CXR A;  3HBX A;  4R5Z A;  3LZ1 D;  3BV0 A;  1AKA A;  3F9T A;  4NE5 A;  1UU2 A;  3AZF B;  5B31 C;  3B6G A;  2R5C B;  4ZDO A;  1YJS A;  1HTA A;  4Z5T B;  4G91 C;  4FL0 A;  5KDM B;  3WTP D;  1X2A A;  1U35 A;  2ZY2 A;  1DGD A;  2FN6 A;  5DJ9 A;  5EAA A;  4IX8 A;  3B0D B;  3AZG B;  3WGC A;  4F5M A;  1GBN A;  2GMU A;  4WXF A;  1XEY A;  1M18 D;  3CQ6 A;  3NRA A;  4U2H A;  3AZK B;  3REJ C;  5GSU B;  4WV4 B;  4YM6 B;  3MAF A;  4RIT A;  2VGU A;  3AEL A;  3MGQ C;  3UTA D;  5HXX A;  1ASC A;  4H9O A;  4ATQ A;  2PO3 A;  5I92 A;  3CAI A;  3E9K A;  4E44 A;  4NE3 A;  4FFC A;  3DRD A;  3AZE D;  4ZAS A;  4YS3 B;  3AZN D;  1GEX A;  4XUJ C;  1DTY A;  2NQB C;  4XZQ B;  5AV5 C;  3REJ A;  4OTL A;  1T3U A;  1S0A A;  1IAY A;  3AOV A;  1SZS A;  3VK4 A;  4CSR B;  3WX9 A;  1HQ3 C;  2W7H A;  3G7Q A;  1U35 D;  1BJ4 A;  3M5U A;  3VH5 T;  3MGQ A;  1LC8 A;  1ASG A;  3EZ1 A;  1S08 A;  3LZ0 B;  3AZM B;  4L0O A;  3AZG C;  2D5Y A;  3GZD C;  4JF1 A;  1BS0 A;  5GSU C;  2VLF A;  2NQB A;  2PYO C;  4AWL C;  2VGS A;  1UU0 A;  3II0 A;  1IVR A;  2FYF A;  1B5P A;  5B31 D;  4NE6 A;  4XQ2 A;  4CBS A;  3MGS C;  2R5C A;  5GT3 B;  2OQX A;  2VMU A;  5KDM A;  2WKA A;  3REI B;  1AHY A;  2JCH A;  4J8L A;  4UHO A;  2YKV A;  3RI6 A;  4ZSY A;  3AZG A;  4W1X A;  2HUU A;  4I8A A;  3USF A;  4Y0I A;  4XZQ C;  1O62 A;  3PDX A;  3REJ D;  3AZK A;  5GSU A;  3EG5 B;  2PYO A;  3FZ6 A;  1CQ8 A;  2W7K A;  1ID3 B;  5E5A B;  5AVB B;  5B2I B;  1WYU B;  1D7V A;  1MLY A;  4JF0 A;  1PG8 A;  5E3K A;  2Y2M A;  3MNN C;  1RV3 A;  2YRR A;  1GEY A;  2C81 A;  2Z1Y A;  3E2F A;  3PD6 A;  4HF8 A;  2BWO A;  4AH3 A;  1BH8 B;  1PMO A;  4XUJ D;  4YS3 A;  1PZR A;  4XZQ A;  4KYO A;  5AV5 D;  3EUC A;  4F4E A;  2CH1 A;  3TU4 C;  4LNM A;  2CIN A;  2VMX A;  5GXQ C;  1IX6 A;  2DOU A;  3K40 A;  5GT3 C;  1HQ3 D;  5TF5 A;  1VJO A;  1WKG A;  3MBB A;  4H9R A;  1ARG A;  3MNN A;  1KKP A;  4E45 A;  3B1C A; 
#chains in the Genus database with same CATH homology
 1BQA A;  2Y2P A;  2AY3 A;  1MAP A;  3FVX A;  5B0Y C;  4KHA A;  1BKG A;  2F8N A;  2PYO D;  1CQ6 A;  2VMN A;  1ID3 C;  1YIZ A;  3MGS D;  5GXQ A;  4A6U A;  1CQ7 A;  2JIS A;  1WWS A;  5GT3 A;  2ZY4 A;  5BS7 C;  1SZK A;  2W8V A;  2CAN A;  5BJ3 A;  1TAF B;  2OKK A;  3KXB C;  5B0Y A;  3B6F B;  4KAM A;  3KUY C;  1CL1 A;  2ARO D;  3ZZJ A;  1ID3 A;  5B2I A;  1WYU A;  4IXS A;  3Q8N A;  3WY7 A;  4X23 C;  3MNN D;  4WJ3 C;  1ELU A;  4ZDP A;  3MAD A;  2CV5 B;  1ASM A;  1BH8 A;  2F8N D;  3LEL C;  2HIO C;  3KXB A;  1B5O A;  2O1B A;  3TU4 D;  3AL0 C;  3E77 A;  5GXQ D;  3VH6 W;  1ZLA D;  2NMP A;  3REL C;  1D7R A;  2HZP A;  3KKI A;  2VMV A;  4X23 A;  3X1S C;  1AMS A;  4Z66 C;  5B24 B;  5B0Y D;  1J32 A;  2F8N H;  3DOD A;  2D61 A;  3LEL A;  3COG A;  3N7N A;  3NYS A;  4UPK A;  2HIO A;  4U1T A;  1AY4 A;  3AV7 A;  4K05 A;  3ISL A;  1ELQ A;  5B32 C;  3C1C B;  2BG1 A;  3X1S A;  3LVL B;  4PVF A;  5G4J A;  1V2D A;  2BI3 A;  5G49 B;  2ZC0 A;  2CJH A;  1P3O C;  3BCA A;  2CFB A;  3B6F A;  3WLX A;  3VH5 A;  1OAT A;  3KUY D;  4M2K A;  3UT9 B;  4E1O A;  2HOR A;  3EIA A;  5CPK C;  1P3G C;  2VMQ A;  5E5I A;  4M2J A;  1UKJ A;  3NUB A;  4X23 D;  3DR7 A;  3FVU A;  2CV5 A;  4H9P B;  3W1H A;  4XK1 A;  5BT1 C;  3LEL D;  3IHJ A;  1G7X A;  2HIO D;  4LD9 B;  1P3O A;  3KFU G;  1TZY B;  1P3I C;  1AOI B;  3DU4 A;  3REL D;  1P3G A;  1OXO A;  1TAS A;  3C1C C;  3W99 D;  3X1S D;  2ZSL A;  1QIT A;  2IO5 B;  4OCA A;  4Z66 D;  1A7W A;  2HP2 A;  4CAY B;  2LY8 A;  1P3P B;  4F5L A;  1KX5 C;  1TOG A;  1P3I A;  3DXV A;  3LJA B;  3PDB B;  1GC4 A;  5EUE A;  3W98 C;  3MGR B;  3VH6 T;  5B32 D;  1ASD A;  3B0C W;  3C1C A;  2FJ7 B;  3GBX A;  4NFT A;  3AEP A;  1AHX A;  2BKW A;  1YJZ A;  4WLH A;  3L44 A;  1M6S A;  3KGW A;  1YJY A;  3GET A;  4J8U C;  4KUD B;  4UHM A;  3AFA B;  4WD2 A;  3REH B;  5AX8 A;  3H9X A;  3UT9 A;  1AMR A;  5CPK D;  1ORD A;  1N8P A;  2XBN A;  3WKJ C;  3FTB A;  5BJ4 A;  1SVV A;  3NU8 A;  4IXZ A;  4HGA B;  1I29 A;  3I16 A;  2IO5 C;  3AYW C;  2W7J A;  4A0F A;  5CP6 B;  4H51 A;  5BT1 D;  4WYD A;  1P3I D;  1N2T A;  4ITG A;  1TZY A;  1AOI A;  2HOZ A;  1F1E A;  1AJS B;  1BJO B;  1S32 C;  3WKJ A;  3MGR C;  3UTB B;  3TAT A;  1H0C A;  3AOW A;  2GMS A;  2W7L A;  5FUG B;  3AYW A;  3F0H A;  2BI2 A;  1QGN A;  3LZ1 B;  2YOB A;  4CAY A;  5M49 A;  3FDB A;  1KX5 D;  1D7U A;  4R8D A;  2VYC A;  1I43 A;  2JJG A;  3WTP B;  2W8U A;  3HLM A;  1S32 A;  3W98 D;  3OP7 A;  3MGR A;  3FQ7 A;  4IYO B;  1M18 B;  3BCX A;  3JZL A;  5FT4 A;  1CZC A;  1Q9C A;  4J8U D;  4KUD A;  1Z2C B;  2Q7W A;  3JW9 A;  1WYT A;  1IBJ A;  3N75 A;  2V0Y A;  3WKJ D;  4H63 Q;  1P3L D;  1W7M A;  3UTB C;  3AZL C;  3FFR A;  3P1T A;  3AYW D;  3AZE B;  2Y2H A;  5D95 A;  3AZN B;  2Z9U A;  5CP6 A;  3LZ1 C;  2R0T A;  3B0C T;  2QB2 A;  2EZ1 A;  4ZSW A;  2VLH A;  4ZLV A;  1WWI A;  3DXW A;  3WKR A;  1FG7 A;  4ZM3 A;  3AAT A;  1J04 A;  3AV2 C;  1U35 B;  1BJO A;  3E2Y A;  1JS6 A;  4GDY A;  1C0N A;  3UTB A;  3AZL A;  4WZS B;  4KXK A;  2AEU A;  3LZ1 A;  3RBF A;  4F5G A;  4HVK A;  3I5T A;  5B31 B;  3MVD C;  5JA4 B;  4G91 B;  3UTA C;  1ECX A;  2CST A;  4H9O B;  2O7C A;  5B2J D;  1RV4 A;  1KX4 C;  5AY8 C;  3N0L A;  4XAU A;  5CHL B;  3REK D;  3AZJ C;  4WYC A;  3AZE C;  1M18 A;  2QLR A;  2F2A C;  3REJ B;  2VI9 A;  5AV8 D;  2GB3 A;  3PAA A;  5JRG C;  4ADC A;  1P3M C;  4W1V A;  4F5I A;  3MVD A;  2FNI A;  2ZM5 A;  1P3A C;  3UTA A;  4H9Q B;  5BNX B;  5AY8 A;  2NZD C;  3AZL D;  2BWN A;  2ZSM A;  3AZE A;  5G09 A;  1V72 A;  4XUJ B;  3AZN A;  2NQB B;  3QHX A;  4PIW A;  5AV5 B;  3EI6 A;  3DZZ A;  1O61 A;  1QJ3 A;  3AZH C;  5JRG A;  1G4X A;  1HQ3 B;  5CPI C;  3AV2 D;  4WYF A;  2PB0 A;  3NYU A;  1P3A A;  4F5H A;  4G92 B;  4IY7 A;  2RVQ C;  3W96 C;  2OAT A;  2NZD A;  4J8W D;  4BHD A;  5FT5 A;  3I4J A;  1CS1 A;  5KTB A;  4Z2M H;  2PYO B;  4AWL B;  5J8Q A;  1H3O B;  2HUE B;  2CY8 A;  3X1V D;  5B31 A;  3MVD D;  3MGS B;  5DNM C;  2DR1 A;  1WYV B;  5JA4 A;  4RAE A;  4EMY A;  3O62 C;  3DR4 A;  1KX4 D;  5AY8 D;  4WLJ A;  1DJ9 A;  1ARI A;  1M4N A;  2AY9 A;  3AZJ D;  3PD6 B;  2Y2G A;  4KGC C;  3WA9 C;  4A0G A;  4ZM4 A;  4MKJ A;  1V2F A;  2ZYJ A;  2FQ6 A;  5JRG D;  3IP4 C;  1P3M D;  2YRI A;  2YKU A;  1OXP A;  5DNM A;  1P3A D;  5BO0 A;  4G92 C;  4H9R B;  1D2F A;  3MNN B;  1T3I A;  4H9Q A;  5BNX A;  2NZD D;  1S06 A;  5G0A A;  4KGC A;  4KHA B;  3HQT A;  1AHF A;  2F8N B;  1JS3 A;  4XUJ A;  2VMP A;  5AV5 A;  2HUE C;  3TU4 B;  1JFI A;  1M19 C;  1ZC9 A;  5GXQ B;  2C0R A;  3AZH D;  1IUG A;  5CPI D;  1HQ3 A;  2FNU A;  3E6G A;  2W7I A;  2OKJ A;  4ZDL A;  2W7F A;  3B1E A;  1W7N A;  2RVQ D;  3W96 D;  1B8G A;  4OT8 A;  3GZD A;  2Y2L A;  3ZRP A;  4OBV A;  3EZS A;  5B0Y B;  5C3I B;  3PPL A;  1I41 A;  4DRB A;  3EI5 A;  1H3O A;  3FSL A;  2ARO C;  3PJ0 A;  3X1T C;  1M19 A;  3MGS A;  5DNM D;  4ZUX C;  1EQZ C;  1ZOB A;  3ASA A;  1AHE A;  1WYV A;  4J8X C;  3O62 D;  3WTP E;  1M0O A;  2W8S A;  3AN2 C;  4ATP A;  2GSA A;  4LW2 A;  2D7Y A;  2QSR A;  4GE4 A;  4KGC D;  3WA9 D;  4ZAH A;  5B40 C;  3KXB B;  1MDO A;  3NUI A;  5B1L C;  2FFF B;  2Y2O A;  2RIQ A;  3KUY B;  3EI9 A;  1ZLA C;  2ARO A;  5D5S A;  1RVY A;  1TOK A;  4ZUX A;  1EQZ A;  5B0Z C;  4X23 B;  2G6W A;  4OC9 A;  4ZWM A;  3FZ8 A;  1M7Y A;  4RJ0 A;  4Q75 A;  1DJE A;  2CJD A;  3VOM A;  3EPH A;  5C3I C;  2JE5 A;  3LEL B;  2HIO B;  2R5E A;  4Z5T D;  5B31 G;  5B1L A;  3TU4 A;  1LS3 A;  3WAA C;  1M19 D;  2O0R A;  2WK8 A;  4F5F A;  3FQ8 A;  2Y2Q A;  1ZLA A;  3REL B;  3NNK A;  1OHV A;  2EO5 A;  3KWQ C;  1YOO A;  5B0Z A;  4A00 A;  4AZJ A;  3X1S B;  4B98 A;  1DGE A;  2W7M A;  3AV1 C;  4Z66 B;  1SZU A;  4H9S C;  2BYK A;  3VK3 A;  5M4D A;  2Z9X A;  4JEY A;  4XJL A;  1F66 C;  4LNL A;  3X1T D;  3WAA A;  5EAV A;  2W7D A;  4ZUX D;  2X8U A;  1EQZ D;  1W3U A;  4J8X D;  5BS7 A;  3EI8 A;  3AN2 D;  3N4R A;  5B32 B;  3KSY A;  1ASL A;  2VGZ A;  3HT4 A;  5B40 D;  4R8P C;  2G5H C;  3AV1 A;  2VGV A;  2VQR A;  3AEN A;  1P3O B;  1MDZ A;  3OKS A;  5B1L D;  5BNV A;  3KUY A;  4ZBJ C;  1F66 A;  2JJH A;  5CPK B;  1P3G B;  3AZM D;  1TOI A;  2D7Z A;  1WST A;  5B0Z D;  4GE9 A;  2QB3 A;  3GZC A;  3W99 C;  1Z7D A;  2J8P A;  5CPJ C;  4PFF A;  1QZ9 A;  2EGY A;  3N4S A;  1Z3Z A;  4R8P A;  3NYT A;  4JEV A;  1V2E A;  4JEX A;  5F99 C;  1AHG A;  1P3I B;  2ZUK A;  2WB6 A;  5GT0 D;  3WAA D;  3REL A;  3KWQ D;  1UU1 A;  3W1J A;  2Y2J A;  1CJ0 A;  1ZOD A;  3W99 A;  2QA3 A;  3RUY A;  3AV1 D;  4Z66 A;  2BIA A;  3N4X A;  5E5A D;  3ECD A;  5F99 A;  1KX5 B;  1F66 D;  2JGT A;  2Z20 A;  2D66 A;  3TFU A;  4EU1 A;  3VK2 A;  3ELP A;  4B9B A;  2KFP A;  4K2B A;  3ASB A;  2VMW A;  3A9X A;  3FD0 A;  3W98 B;  5B32 A;  2BWP A;  3FRK A;  2VI8 A;  4R8P D;  2F8N G;  4J8U B;  1MLZ A;  3HL2 A;  2VIA A;  2Y2K A;  4BMK A;  1C7G A;  5CPK A;  3WKJ B;  1OHW A;  3LV2 A;  4MKK A;  3HVY A;  4EB5 A;  4WNN A;  4Y0D A;  5CPJ D;  3AYW B;  1O69 A;  1IX8 A;  4WP0 A;  5F99 D;  2YCP A;  3G0T A;  1P3K C;  2D63 A;  4TN4 A;  1S32 B;  2Z61 A;  1W7L A;  3MAU A;  1AIC A;  1BJW A;  1B9I A;  4A6R A;  1AMA A;  1WKH A;  3CBF A;  1WYT B;  1KX5 A;  2X5F A;  3A6N D;  4ZWV A;  1P3K A;  5B2J B;  2RFV A;  2VMY A;  1P3L C;  5EIG B;  1P3W A;  3KE3 A;  3KGX A;  3VP6 A;  3W98 A;  3REK B;  2VMO A;  1QIR A;  2XD1 A;  1LK9 A;  3N5M A;  2BIG A;  4J8U A;  2QMA A;  4BA5 A;  3F6T A;  4RIZ A;  4RJY A;  1BJN A;  4UHN A;  4JJN C;  3TFT A;  5AV9 D;  3AZI C;  3C1B C;  4ADD A;  1P3L A;  3ZZK A;  4WU8 C;  4A0R A;  1N31 A;  3AZL B;  3BN1 A;  1BW0 A;  1BH9 B;  3BC8 A;  4AZK A;  1AKB A;  1DJU A;  2ZY3 A;  4JJN A;  1P3K D;  3TQX A;  3AV2 B;  5B2J C;  2DGM A;  4NOG A;  3AZI A;  3C1B A;  3UE8 A;  5B32 G;  5AVC C;  3REK C;  3W97 D;  1VP4 A;  4CXQ A;  4WU8 A;  4ISY A;  2HUI A;  1M0P A;  1AKC A;  5DJ1 A;  5AV8 C;  4CVQ A;  3G8M A;  2YKY A;  3X1V B;  3MVD B;  3K28 A;  1MGV A;  4GRX A;  2OGA A;  1QJ5 A;  1AY8 A;  3UTA B;  4MQQ A;  1C9C A;  5B2J A;  5M46 A;  1KX4 B;  5EIG A;  5AY8 B;  1D7S A;  4PFN A;  4R5F A;  3AZJ B;  4J8V C;  3REK A;  4LD9 D;  1I48 A;  2DKB A;  3CQ5 A;  2AY8 A;  1Y4I A;  5AV8 A;  5JRG B;  4F5K A;  1P3M B;  4JJN D;  4CBR A;  3AZI D;  1P3A B;  3C1B D;  1KL1 A;  1M0Q A;  3GWP A;  4WU8 D;  4LNJ A;  2NZD B;  1SFF A;  1P34 C;  3RCH B;  4J8W C;  3K7Y A;  4H9N B;  2AY4 A;  3T32 A;  3UWC A;  1C4K A;  4EO5 C;  4QLC C;  1BH9 A;  4OYT A;  5AV6 C;  1AY5 A;  1SF2 A;  4WB0 B;  3X1V C;  1KKJ A;  4EB7 A;  1B6W A;  4MQR A;  1IAX A;  3W1I A;  3AZH B;  5CPI B;  4EFF A;  3FQA A;  5M4B A;  1ASN A;  3AV2 A;  3FFH A;  4E3Q A;  4WXB A;  1AIA A;  5B33 D;  2DKJ A;  5AVC D;  4N0W A;  3W96 B;  4AOA A;  4J8W A;  3CQ4 A;  2BYM A;  5B1M C;  3MGP C;  2CJG A;  3VH5 W;  4QLC A;  3D6K A;  1H1C A;  2CH2 A;  5AV6 A;  3X1V A;  2BI5 A;  2AEV A;  5DNM B;  5BO0 B;  3O62 B;  1KX4 A;  2VGW A;  2X5D A;  2W8T A;  4DQ6 A;  1KL2 A;  1KX3 C;  4J8V D;  3AZJ A;  3WA9 B;  4KGC B;  1C7N A;  3NDN A;  3B6G C;  3E2Z A;  5B1M A;  5HDM A;  1JFI B;  2C44 A;  2HP1 A;  3VH6 A;  1M1A C;  3GJU A;  1P3M A;  2FM1 A;  2BIE A;  3QN6 A;  2ZJG A;  4JEZ A;  3NU7 A;  3AEJ C;  3B46 A;  1P34 D;  3RCH A;  1KX3 A;  1CL2 A;  1M32 A;  4H9N A;  3P6K A;  1KMJ A;  4WU9 C;  1EJI A;  4QLC D;  1P3B C;  2CTZ A;  5AV6 D;  1E5E A;  4WB0 A;  1M19 B;  1P3F C;  5DNN D;  1M1A A;  3AZH A;  5CPI A;  3P5J B;  2VGT A;  2PB2 A;  3TCM A;  4W1W A;  5DB5 A;  3L8A A;  2EZ2 A;  3AEJ A;  2CWE A;  3W96 A;  3H0R C;  3AEM C;  3NQJ A;  3WZF A;  5B1M D;  3MGP D;  2VIB A;  2F8J A;  1XI9 A;  1KU5 A;  4WU9 A;  4ITX A;  4AO9 A;  1P3B A;  2ARO B;  4F5J A;  3X1T B;  3ZRR A;  4ZUX B;  3X1U C;  1P3F A;  1EQZ B;  5FT8 A;  4ADE A;  4J8X B;  3O62 A;  3AN2 B;  3V9R B;  1KX3 D;  3WA9 A;  3EI7 A;  3FVS A;  3AZF C;  3AEM A;  5B40 B;  5C6U A;  1BQD A;  3B6G D;  4GE7 A;  3FCR A;  4Z2M G;  4Z5T C;  3DYD A;  5B1L B;  4WXG A;  1M1A D;  1S09 A;  1ZLA B;  3EIB A;  3B0D C;  2WK9 A;  2BYL A;  4OBU A;  1B4X A;  3X1U A;  3EPK A;  5B0Z B;  1YIY A;  2XD5 A;  4DQY B;  3AZK C;  1PMM A;  3QBO A;  3AZF A;  2BYK B;  4WU9 D;  4YM6 C;  1P3B D;  4Z5T A;  5F8V A;  2FKI A;  3NQU B;  5GT0 B;  3BCB A;  3WAA B;  3HDO A;  1P3F D;  1JG8 A;  1AJR A;  4MQP A;  3KWQ B;  1ARS A;  2R2N A;  4GSA A;  4YS3 C;  2XH1 A;  1GEW A;  3EPL A;  3AV1 B;  3B8X A;  2HOX A;  3AEN B;  4GEB A;  2JJE A;  4UQV A;  5EFS A;  5BNV B;  3ACZ A;  3QGU A;  3AEO A;  4YM6 A;  3LY1 A;  1F66 B;  3JWA A;  4ADB A;  3MGQ D;  3A2B A;  2ORD A;  3X1T A;  4O6Z A;  3LZ0 C;  3AZM C;  3X1U D;  4UUZ B;  2ZP7 A;  4J8X A;  4OMA A;  2YCT A;  1X29 A;  3AN2 A;  4R2N A;  3V9R A;  4K2I A;  2NQB D;  3QI6 A;  3FZ7 A;  4IXO A;  3WKS A;  3WCN A;  3AZF D;  4Y0H A;  3PGY A;  4R8P B;  5B40 A;  2C7T A;  3HMU A;  3R4T A;  3NTJ A;  1MDX A;  4CSR A;  3REI C;  5GT0 C;  2VMT A;  4ZBJ B;  3A9Y A;  4XJP A;  3LZ0 A;  3AZM A;  2GQN A;  3AZG D;  5JAY A;  3JWB A;  4Q6R A;  2F8N K;  3W99 B;  1GD9 A;  2Z9W A;  3AZK D;  5GSU D;  5CPJ B;  3WGB A;  5AVB C;  5E5A C;  5B2I C;  2EH6 A;  2X3L A;  4A72 A;  4YM6 D;  5F99 B;  5HHY A;  5G2P A;  4RKD A;  2G7J A;  4M2M A;  3NX3 A;  2CB1 A;  3NQU A;  3REI A;  2Y2I A;  5GT0 A;  2AY1 A;  4P7Y A;  2AAT A;  4J5U A;  4WYE A;  3KWQ A;  1B9H A;  5G4I A;  2VMZ A;  2AY5 A;  3BWN C;  4YS3 D;  4XZQ D;  4LC3 A;  2AY7 A;  2HOY A;  3A8U X;  3LWS A;  4H9S A;  2YFW B;  5E5A A;  5AVB A;  1AIB A;  3UAK A;  3A6N B;  1SPA A;  3LZ0 D;  1VEF A;  7AAT A;  4LW4 A;  2JG2 A;  2BYJ A;  4UUZ A;  3GR9 A;  1W2E A;  2VMS A;  5G2Q A;  2YHK A;  4WNN B;  3BWN A;  2VMR A;  3A9Z A;  1LKC A;  5EUN A;  3ZRQ A;  4K2M A;  5GT3 D;  3REI D;  2E7U A;  8AAT A;  5AV9 B;  3H0L C;  1X28 A;  3BWO A;  1ULY A;  1ARH A;  3B6F C;  5CPJ A;  1N1J B;  4MSO A;  1ID3 D;  3MKJ A;  5AVB D;  4BQ0 A;  5B2I D;  3EPJ A;  3LVM A;  2BHX A;  2E54 A;  3A6N C;  2W7E A;  1P3K B;  2CV5 C;  1KMK A;  4RKC A;  1M0N A;  3W97 B;  3GSB A;  3KXB D;  1TAF A;  1W23 A;  3RBL A;  1TAT A;  4WBT A;  4QGR A;  2YFW A;  3MEB A;  4JEW A;  5AV9 C;  3A6N A;  1P3L B;  1TOE A;  4DBC A;  5B24 C;  1EG5 A;  2DGL A;  3WCO A;  1IX7 A;  2DQN C;  2E7J A;  3R9A A;  3LVJ A;  1GC3 A;  2BI9 A;  3A1K A;  2HUF A;  2AY6 A;  4Q76 A;  3LVK A;  4JJN B;  1ASB A;  1G7W A;  3AZI B;  5AV9 A;  1EQB A;  3C1B B;  1TOJ A;  2G5I C;  3W97 C;  4WU8 B;  9AAT A;  4XJM A;  3DC1 A;  5B24 A;  3B6F D;  1ASA A;  5IWQ A;  1N1J A;  3UT9 C;  1GC2 A;  3FDD A;  2ZY5 A;  4DRA A;  1ART A;  2W8W A;  4W91 A;  2D65 A;  2EPJ A;  2DGK A;  3B0B A;  2CV5 D;  4RM1 A;  5B33 B;  4A0H A;  1YNU A;  5AVC B;  1TPL A;  3W97 A;  5EUD A;  2V1P A;  5G49 A;  2BI1 A;  1P3O D;  4LD9 C;  2AY2 A;  1IJI A;  1TZY C;  2E7I A;  1AOI C;  4W5K A;  1GCK A;  1LW5 A;  5AV8 B;  1P3G D;  1U08 A;  1R4V A;  4IW7 A;  3JTX A;  4W8I A;  1LW4 A;  3PA9 A;  5DX5 A;  4M6B A;  4H9P A;  5B24 D;  2DF4 C;  4J8V B;  3MC6 C;  4E77 A;  2YKX A;  1P3P C;  2YFV B;  4LD9 A;  5FT6 A;  3LJA C;  3H7F A;  3BS8 A;  1DKA A;  3C1C D;  2FJ7 C;  2EYQ A;  1FG3 A;  5B33 C;  4DGT A;  1P34 B;  3R45 B;  4J8W B;  4KUD C;  3MC6 A;  1FC4 A;  2BYM B;  3AFA C;  1P3P A;  3FKD A;  1YAA A;  3REH C;  4EO5 B;  4QLC B;  3UT9 D;  2YCN A;  1RVU A;  4TMR A;  1BT4 A;  1JF9 A;  5AV6 B;  1OHY A;  3LJA A;  3PDB A;  4RLG A;  5DNN B;  1GDE A;  1BFM A;  4P3M A;  4HGA C;  2FJ7 A;  1LC5 A;  3A1I A;  3H0M C;  5B33 A;  5CP6 C;  5AVC A;  2L5A A;  3B1D A;  3E2Z B;  1TZY D;  3LG0 A;  5B1M B;  3AFA A;  1AOI D;  3MGP B;  1G4V A;  2OGE A;  2W8J A;  3REH A;  1AAW A;  3QPG A;  4UOY A;  5E4Z A;  4BA4 A;  1CZE A;  2Z1Z A;  5K8B A;  4A6T A;  3ELE A;  1DFO A;  2Y2N A;  1LC7 A;  1AMQ A;  3ATH A;  2Z9V A;  4E3R A;  1MAQ A;  1QIS A;  3PIU A;  2JSS A;  1KX3 B;  4J8V A;  1P3P D;  2JJF A;  4XJO A;  2YFV A;  3B6G B;  3LJA D;  1C7O A;  3WTP C;  1AJS A;  1S32 D;  4MY5 A;  4WYG A;  1M1A B;  5F9S A;  5DNN C;  3MGR D;  2FJ7 D;  2W7G A;  1ASE A;  2A1V A;  1M18 C;  5EQC A;  5FUG A;  4XEW A;  3RQ1 A;  1P34 A;  3R45 A;  1PFF A;  3NQJ B;  4KUD D;  2WK7 A;  4WYA A;  3AFA D;  4Q31 A;  3REH D;  4WU9 B;  3MAF B;  1P3B B;  1B67 A;  2D64 A;  3WTP A;  1P3F B;  1X0M A;  2TPL A;  5DNN A;  4AO4 A;  1ASF A;  4IYO A;  2QBT A;  1TAR A;  3AZN C;  5CP6 D;  2UWX A;  1O4S A;  1AX4 A;  1GC0 A;  3MGP A;  1S07 A;  1U35 C;  3BB8 A;  3MGQ B;  1AAM A;  1E5F A;  3VAX A;  3X1U B;  3UTB D;  3QM2 A;  4CXR A;  3HBX A;  4R5Z A;  3LZ1 D;  3BV0 A;  1AKA A;  3F9T A;  4NE5 A;  1UU2 A;  3AZF B;  5B31 C;  3B6G A;  2R5C B;  4ZDO A;  1YJS A;  1HTA A;  4Z5T B;  4G91 C;  4FL0 A;  5KDM B;  3WTP D;  1X2A A;  1U35 A;  2ZY2 A;  1DGD A;  2FN6 A;  5DJ9 A;  5EAA A;  4IX8 A;  3B0D B;  3AZG B;  3WGC A;  4F5M A;  1GBN A;  2GMU A;  4WXF A;  1XEY A;  1M18 D;  3CQ6 A;  3NRA A;  4U2H A;  3AZK B;  3REJ C;  5GSU B;  4WV4 B;  4YM6 B;  3MAF A;  4RIT A;  2VGU A;  3AEL A;  3MGQ C;  3UTA D;  5HXX A;  1ASC A;  4H9O A;  4ATQ A;  2PO3 A;  5I92 A;  3CAI A;  3E9K A;  4E44 A;  4NE3 A;  4FFC A;  3DRD A;  3AZE D;  4ZAS A;  4YS3 B;  3AZN D;  1GEX A;  4XUJ C;  1DTY A;  2NQB C;  4XZQ B;  5AV5 C;  3REJ A;  4OTL A;  1T3U A;  1S0A A;  1IAY A;  3AOV A;  1SZS A;  3VK4 A;  4CSR B;  3WX9 A;  1HQ3 C;  2W7H A;  3G7Q A;  1U35 D;  1BJ4 A;  3M5U A;  3VH5 T;  3MGQ A;  1LC8 A;  1ASG A;  3EZ1 A;  1S08 A;  3LZ0 B;  3AZM B;  4L0O A;  3AZG C;  2D5Y A;  3GZD C;  4JF1 A;  1BS0 A;  5GSU C;  2VLF A;  2NQB A;  2PYO C;  4AWL C;  2VGS A;  1UU0 A;  3II0 A;  1IVR A;  2FYF A;  1B5P A;  5B31 D;  4NE6 A;  4XQ2 A;  4CBS A;  3MGS C;  2R5C A;  5GT3 B;  2OQX A;  2VMU A;  5KDM A;  2WKA A;  3REI B;  1AHY A;  2JCH A;  4J8L A;  4UHO A;  2YKV A;  3RI6 A;  4ZSY A;  3AZG A;  4W1X A;  2HUU A;  4I8A A;  3USF A;  4Y0I A;  4XZQ C;  1O62 A;  3PDX A;  3REJ D;  3AZK A;  5GSU A;  3EG5 B;  2PYO A;  3FZ6 A;  1CQ8 A;  2W7K A;  1ID3 B;  5E5A B;  5AVB B;  5B2I B;  1WYU B;  1D7V A;  1MLY A;  4JF0 A;  1PG8 A;  5E3K A;  2Y2M A;  3MNN C;  1RV3 A;  2YRR A;  1GEY A;  2C81 A;  2Z1Y A;  3E2F A;  3PD6 A;  4HF8 A;  2BWO A;  4AH3 A;  1BH8 B;  1PMO A;  4XUJ D;  4YS3 A;  1PZR A;  4XZQ A;  4KYO A;  5AV5 D;  3EUC A;  4F4E A;  2CH1 A;  3TU4 C;  4LNM A;  2CIN A;  2VMX A;  5GXQ C;  1IX6 A;  2DOU A;  3K40 A;  5GT3 C;  1HQ3 D;  5TF5 A;  1VJO A;  1WKG A;  3MBB A;  4H9R A;  1ARG A;  3MNN A;  1KKP A;  4E45 A;  3B1C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...