2ZY5A

R487a mutant of l-aspartate beta-decarboxylase
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
510
structure length
510
Chain Sequence
b'ELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGAGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-aspartate beta-decarboxylase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
molecule tags Lyase
total genus 183
structure length 510
sequence length 510
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy5A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy5A01
1SZSA 3QHXA 3UWCA 1ZOBA 2D64A 1BJ4A 1AMAA 2YRIA 1WYUB 4OT8A 1BQDA 2EZ2A 3GSBA 3DR4A 2CY8A 1OHWA 1M7YA 2Z20A 1C7OA 1BT4A 1C7NA 4AOAA 1ASMA 1M0OA 2GSAA 2HUUA 2HZPA 4GRXA 3AOVA 2ZSLA 3OP7A 3BCBA 4IXZA 5BJ4A 2D63A 2W8JA 1OHVA 4A6RA 2D65A 3GJUA 1IVRA 1D7RA 2BWPA 3A2BA 4MQQA 4K2BA 5HHYA 4WLJA 2AY3A 2JJHA 4A0RA 4UHOA 1X0MA 1GD9A 5HDMA 3PJ0A 3FQ8A 4Y0HA 4EB5A 3USFA 1B4XA 1N31A 5DB5A 3UAKA 3NYUA 1WYTA 2HP2A 2ZY5A 3JWBA 2AATA 2JJGA 4ZM4A 3BB8A 4JEXA 1DJEA 4JEYA 3K40A 3MKJA 1ASGA 4LNLA 1CJ0A 4NOGA 2VMOA 1J32A 3AEOA 4CBRA 1DFOA 1FC4A 1W7LA 4CVQA 4DBCA 3CAIA 1IJIA 1X29A 1EG5A 2VMNA 3PPLA 1W23A 1O62A 3OKSA 4IW7A 3KKIA 4A00A 1V72A 3I5TA 2Z9XA 3AATA 3WLXA 4BA4A 2R5EA 5M49A 3M5UA 3TATA 1YIYA 5DJ9A 1QJ3A 1P3WA 4E77A 4EU1A 1D7SA 3HL2A 2OGAA 4CXQA 3PAAA 3FVXA 1WKGA 3P1TA 4A72A 5FT6A 5G0AA 2AY6A 2D7ZA 3AOWA 4B98A 2W7LA 2FNUA 3MAFA 3PDBA 1QITA 1KMJA 1LC8A 2EGYA 2Z9UA 1ARIA 1KKPA 2HUFA 3N0LA 1GC0A 2DKBA 2E7IA 1OATA 3DODA 3BV0A 8AATA 4W91A 3F9TA 1CL2A 1G4VA 4WD2A 1G7XA 5BJ3A 2W8UA 2YCNA 4F5LA 3LG0A 1W7NA 2W7EA 1I43A 3EZ1A 2VGTA 3ZZJA 2HOYA 1BJOA 2F8JA 2VGUA 2W8TA 3ZRQA 1EJIA 3KGXA 2WK7A 1ELUA 1E5EA 1GEXA 3CQ5A 1TARA 2YKYA 3PD6B 3AENB 4Y0DA 4RKDA 1D7UA 2QB3A 2VMSA 2X5DA 1C7GA 2AY2A 2W7JA 4FFCA 4JF0A 3ASAA 2ZJGA 1YIZA 4JEZA 2TPLA 3ATHA 3UE8A 3LVLB 4MQRA 3G7QA 1J04A 2CJHA 2BWOA 3HDOA 2AY1A 3FDBA 4FL0A 3FKDA 1CS1A 3L8AA 3WY7A 2C0RA 5G4JA 4RAEA 4CBSA 4DGTA 2DOUA 3LV2A 4MKJA 3EIBA 3WGBA 1AJRA 1B5OA 1C0NA 1O69A 4XJOA 3E2FA 1I41A 3FCRA 3RBFA 1YJZA 1TOIA 3D6KA 4OCAA 4LC3A 4JEVA 4BHDA 1BJNA 1BKGA 4GE4A 1UU1A 4M2MA 3ZRPA 1S07A 5K8BA 2PB0A 3DXVA 2PO3A 1YJYA 1IBJA 2VYCA 2GMSA 4WB0A 1E5FA 5AX8A 3BCAA 3WGCA 4EFFA 2HOXA 4I8AA 4WYEA 3NYSA 4R5FA 1D7VA 1ZC9A 4WXFA 1BW0A 1M32A 2G6WA 2R5CB 1X28A 3GETA 4PFFA 4K2MA 2VGVA 4AZKA 2R0TA 1IX6A 5E4ZA 1Z3ZA 2D5YA 2W7KA 1V2FA 1S09A 3EI5A 1KL2A 1TPLA 4Q75A 2QA3A 3MADA 4B9BA 2BI5A 1GC4A 2HORA 2VGSA 3DR7A 3FVUA 3KE3A 3BWNC 2BI2A 2YOBA 3LVMA 2HUIA 3QPGA 2W7FA 1FG3A 4WYFA 1LC7A 2D61A 2VMRA 2GB3A 1SFFA 3BCXA 3E2ZB 4MQPA 4MY5A 3EZSA 4KXKA 2QMAA 4GEBA 3R9AA 5E3KA 3BC8A 4PFNA 3MC6C 1ASEA 3AEJA 3AEPA 1ASBA 5EIGA 4F5JA 4ZM3A 4K2IA 2VMPA 2WK9A 3K7YA 5DX5A 4UQVA 1CZEA 3PDXA 3F6TA 4J5UA 4WBTA 3NNKA 1W3UA 1WYUA 2CFBA 4DQ6A 4IXOA 3NX3A 4ADDA 1AMQA 5JAYA 5F9SA 5C6UA 3MBBA 2CINA 3B1EA 2WK8A 5FT4A 2V1PA 2VIAA 4AO9A 5EUEA 3R4TA 4GE7A 4ATQA 7AATA 1AJSB 3VOMA 2GMUA 1AX4A 3G8MA 1C9CA 1G7WA 1TOGA 2OGEA 5EUDA 2CTZA 4ADEA 3ZRRA 4WP0A 3FTBA 2ORDA 2XH1A 2Z1ZA 2FNIA 2X8UA 2EZ1A 1IAXA 2JGTA 5EUNA 4M2KA 1YJSA 1AHFA 5M4DA 1AIBA 3AEMA 3E6GA 2AY5A 1M6SA 4W1WA 3QI6A 4IYOB 4U1TA 4BA5A 1O4SA 4ZDOA 2X5FA 3GZCA 1IAYA 3NU7A 1EQBA 3DRDA 4WLHA 2VGZA 5G4IA 2AY4A 4ADCA 1SZUA 3E2YA 2FM1A 4CXRA 1YAAA 3DC1A 1KMKA 2BIEA 4XJLA 3L44A 1MDOA 2ZY3A 4F5MA 2V0YA 4W1VA 1ZODA 1BS0A 1DGDA 3KGWA 2ZSMA 2RFVA 2E7JA 3E77A 1LK9A 5TF5A 1S08A 1U08A 4QGRA 3HMUA 2DR1A 1AAWA 2VMVA 3ISLA 1WYVB 3GBXA 5G2PA 1H0CA 1ARHA 3LY1A 4F5KA 4GDYA 4ITGA 2OATA 3LVKA 4ZDPA 1TOEA 1V2EA 3ASBA 2D7YA 2Z61A 4ZAHA 1VEFA 4IY7A 3A9YA 3QBOA 1CQ7A 3WKRA 1ARGA 4W8IA 3EI8A 4TN4A 2QB2A 2W7MA 4EB7A 1GDEA 2BI1A 4A6TA 1CQ6A 1LKCA 2QBTA 4HVKA 1QIRA 2DKJA 3IHJA 2BYLA 2VMZA 4ISYA 4IX8A 3RBLA 4PIWA 2YHKA 1M0QA 3FSLA 4OC9A 1TATA 4Q76A 2BHXA 1AIAA 3JTXA 2CJDA 3PD6A 4AO4A 3AENA 1GCKA 1MAQA 4AZJA 2BKWA 3FQ7A 4R2NA 2WKAA 1GEYA 4ATPA 3GZDC 1I29A 5D5SA 1AMRA 2EPJA 2VMUA 3P6KA 1SVVA 4A0GA 1GBNA 3K28A 4Q6RA 1AHGA 1AKBA 2E7UA 1VJOA 3N75A 4LW4A 1QGNA 4N0WA 4ZASA 3RCHB 1AHEA 3ELEA 1ELQA 3FFHA 2ZY4A 3B1CA 2AY7A 1CL1A 2ZP7A 3EI7A 2VI9A 4L0OA 2BIGA 4OMAA 4OTLA 1IX7A 1UU2A 1SZKA 2BYJA 2VMWA 4MKKA 1ARSA 5G2QA 3QN6A 1T3IA 4A0FA 2ZUKA 3TFUA 3VK4A 2VMXA 4ZSWA 4E1OA 4R5ZA 1B9HA 2Z9VA 1S0AA 3NUBA 1M4NA 2W8VA 1VP4A 4A0HA 4BMKA 2W7DA 1PFFA 3COGA 2R5CA 4R8DA 4WYCA 1Y4IA 2QLRA 3TCMA 2VMYA 1PG8A 1QZ9A 1GC2A 4BQ0A 5J8QA 2AY9A 5EFSA 1UU0A 1CZCA 3EI9A 5D95A 3AEJC 1DKAA 3BWNA 1AY4A 1B9IA 1RV3A 1S06A 4GE9A 2AY8A 3CQ6A 5F8VA 4F5FA 5G09A 2VGWA 1ECXA 4WYGA 4HF8A 1B8GA 1IUGA 2D66A 2YCTA 1TASA 3E2ZA 4OYTA 3JWAA 2VI8A 3MC6A 3VK3A 1WYTB 3II0A 1N2TA 3EI6A 2ZY2A 3H7FA 5M46A 4KYOA 3PA9A 1ASNA 1RVYA 2VMQA 3A9XA 3I4JA 1TOKA 1MLZA 4LNMA 3FVSA 3DU4A 4UHMA 1N8PA 4ADBA 1O61A 2W7IA 1YNUA 2YKXA 1JS3A 1SF2A 2EO5A 3FRKA 3WZFA 1AAMA 3LWSA 1AKCA 1DGEA 3F0HA 1RV4A 2OQXA 3ZZKA 3FFRA 3FQAA 4XJPA 2GQNA 1ASFA 1H1CA 2JJEA 1IX8A 2VLHA 4XAUA 1FG7A 5HXXA 2CH2A 2R2NA 4P3MA 4TMRA 3JW9A 5I92A 1GEWA 3AEMC 3B8XA 3ACZA 4GSAA 1AY8A 3NYTA 2YKVA 1AY5A 1LW4A 2YKUA 5FT5A 2YCPA 4LNJA 2BIAA 1AJSA 3MAFB 3PDBB 2FN6A 1XI9A 2BI9A 3VAXA 1X2AA 2FYFA 2Q7WA 2HP1A 3NU8A 1GC3A 2E54A 4W1XA 3RUYA 4XJMA 2YRRA 5EAAA 2FQ6A 4ZWVA 4LW2A 3QGUA 4F5HA 4XK1A 3BN1A 2W8WA 1BJOB 1AICA 2CJGA 2XBNA 1ASDA 2C7TA 4IYOA 4E3QA 1YOOA 1LS3A 1UKJA 2O1BA 2EH6A 2HOZA 3AV7A 3A8UX 1M0PA 2O0RA 1MAPA 3QM2A 4JF1A 4A6UA 4WYAA 3CQ4A 4UOYA 3NDNA 3EIAA 1MDXA 4IXSA 2O7CA 2CH1A 1OXPA 1OXOA 1ORDA 1RVUA 3LVJA 2BI3A 2BWNA 4XQ2A 1DJ9A 3CBFA 1JF9A 1KL1A 4MSOA 4RJYA 3B1DA 2ZC0A 1MDZA 3DYDA 1AMSA 4KAMA 1DTYA 1WYVA 1ASAA 1OHYA 3DZZA 3NRAA 1ASLA 1I48A 1WKHA 1BQAA 2VIBA 4U2HA 2ZYJA 3DXWA 2PB2A 3MAUA 3PIUA 9AATA 4F5IA 3HLMA 3WX9A 4WXGA 4ZSYA 1MGVA 1JG8A 1TOJA 3VK2A 4P7YA 1DJUA 4WB0B 3Q8NA 5FT8A 2JG2A 1QISA 5E5IA 3GR9A 4H51A 4EMYA 1D2FA 3NUIA 3E9KA 4W5KA 1ARTA 2CSTA 1JS6A 2CB1A 2Z9WA 3MEBA 4ITXA 2NMPA 2Z1YA 5M4BA 1AHYA 1G4XA 1SPAA 3AELA 3A9ZA 4O6ZA 4PVFA 4ZWMA 1AHXA 3BS8A 3RQ1A 4JEWA 3EUCA 3GZDA 1ASCA 1BJWA 2C44A 2VMTA 1C4KA 1CQ8A 1AKAA 3T32A 4F4EA 1LC5A 4UHNA 5IWQA 4WXBA 4M2JA 4RKCA 4Y0IA 5EQCA 1QJ5A 3WKSA 1W7MA 3TQXA 4F5GA 2W7GA 3TFTA 3FDDA 1LW5A 3HQTA 2VLFA 3RI6A 1MLYA 1B5PA 5EAVA 4ZDLA 1V2DA 2CANA 3B46A 1Z7DA 4XEWA 3RCHA 3BWOA 3N5MA 4ZLVA 3PGYA 3NTJA 1M0NA 5EIGB 5DJ1A 4E3RA 2JJFA 2C81A 4WYDA 1KKJA 4AH3A 3ELPA 3ECDA 4Q31A 2W7HA 1WSTA
chains in the Genus database with same CATH superfamily
3QHXA 1BJ4A 4OT8A 1BQDA 4YM6B 3DR4A 1ZLAB 1C7NA 3AYWC 4AOAA 1ASMA 4H9QB 3AOVA 2Y2OA 5E5AC 3GWPA 3BCBA 5BJ4A 2D63A 1OHVA 4A6RA 2D65A 1IVRA 2PYOA 4K2BA 3W96A 3X1VA 3G0TA 4LD9B 4Y0HA 3AN2C 1B4XA 3AZGD 2PYOD 4H9OB 1WYTA 3MNNB 2ZY5A 3W96D 3BB8A 1DJEA 4JEYA 3K40A 3MKJA 1ASGA 4NOGA 3WTPB 1W7LA 4J8XC 5B40A 4E44A 1EG5A 2VMNA 4H63Q 1W23A 4CAYB 3OKSA 3KKIA 2CV5B 2Z9XA 4BA4A 3WLXA 5M49A 5C3IB 1YIYA 1QJ3A 4EU1A 1A7WA 1WKGA 4A72A 3MNNA 3AZNA 2AROA 3UTAB 1LC8A 3W98B 4DQYB 1HQ3B 3MNND 2E7IA 1KX4C 1M18A 2X3LA 3F9TA 3LJAB 3HBXA 4F5LA 3LG0A 1I43A 3EZ1A 2VGUA 2W8TA 3ZRQA 1EJIA 1GEXA 1TARA 3AENB 4Y0DA 2QB3A 5B24C 2AY2A 3JZLA 4JF0A 3W98A 1YIZA 5B32C 4KHAA 1M1AB 3UTAD 2EYQA 3W98D 1HQ3D 3LV2A 3EIBA 1B5OA 1O69A 3MGRB 5AV9C 3RBFA 3FCRA 1TOIA 2NZDC 4JEVA 4EO5C 3LJAD 4J8WA 1BJNA 3AV1A 4M2MA 3KXBC 1KX3A 4QLCB 4XUJC 4WB0A 3AV1D 3A1KA 2XD5A 2YFWA 4I8AA 1BW0A 3X1UB 3REJA 4ZUXB 1Z3ZA 5E4ZA 4Z2MH 1ID3B 2W7KA 2IO5C 1KL2A 1P3AA 3WCOA 4Q75A 3MADA 2HORA 1GC4A 4H9NB 3MGRD 3REJD 3FVUA 3KE3A 3QPGA 2BI2A 2YOBA 2HUIA 3C1BA 4WYFA 2D61A 5E3KA 5E5AB 3UT9A 4PFNA 3MC6C 3C1BD 2VQRA 3AZMC 5EIGA 5B0YB 4K2IA 2WK9A 3K7YA 3R45B 4XZQC 4ZUXD 4Z5TC 3AN2B 5JRGC 1ID3D 3AYWA 1WYUA 1AMQA 5F9SA 3MBBA 2CINA 4J8VA 4H9RB 5AV6A 2DGKA 3AYWD 7AATA 3VOMA 5E5AD 2Y2HA 3FTBA 2EZ1A 4M2KA 1YJSA 5DNNC 4AWLC 1EQZC 1Q9CA 4IYOB 4BA5A 4R8PB 3FD0A 3AN2D 1O4SA 3GZCA 4J8XA 1EQBA 4WLHA 5G4IA 1KX4B 2FM1A 2V0YA 4J8XD 3W97C 3W99A 1DGDA 3KGWA 2F8NG 2RFVA 5TF5A 4QGRA 3HMUA 1AAWA 4J8UA 2RIQA 5B24B 4ZDPA 5F99B 3ASBA 2D7YA 2Z61A 2JCHA 5B32B 3WKRA 4J8UD 1P34C 3EI8A 4TN4A 1KX4D 5AV9B 2BI1A 2BYKA 4HVKA 4EO5B 1QIRA 2BYLA 3MVDA 3KXBB 3JTXA 3H0RC 1GCKA 2G5IC 2WKAA 5B33C 3MVDD 4WU9C 5B24D 5B32D 1AHGA 2E7UA 1VJOA 2NZDA 4ZASA 3RCHB 2IO5B 1AHEA 1ELQA 2ZY4A 2VI9A 2BIGA 2WB6A 1BH9B 5AV9D 2NZDD 4XUJA 1T3IA 4A0FA 5B32G 2Z9VA 1P3FC 3KXBD 1PMOA 4XUJD 1VP4A 3AZLC 3AZMB 3COGA 4WYCA 1Y4IA 1PG8A 5AVBC 5J8QA 5JRGB 2FFFB 1P3PC 1RV3A 4GE9A 1ECXA 2D66A 1IUGA 1AOIC 3JWAA 3MC6A 1N2TA 4X23A 1RVYA 4XZQA 3DU4A 4Z5TA 3AZMD 1YNUA 1JS3A 3LWSA 1EQZB 1AKCA 3P5JB 3ZZKA 4XJPA 4XZQD 1H1CA 4Z5TD 5JRGD 4TMRA 3JW9A 3B8XA 1AY8A 2YKVA 1LW4A 2YKUA 5FT5A 4LNJA 2BIAA 2Y2QA 4JJNC 2HP1A 1H3OA 5DNNA 4XJMA 4ZWVA 1P3GC 4Z66C 1TAFA 2C7TA 3A6NC 5DNND 1YOOA 3EPKA 4RITA 2EH6A 3AZFC 1M0PA 2O0RA 4JF1A 2NQBC 5CP6A 5BT1D 4A6UA 3W97A 4UOYA 4IXSA 2O7CA 3H0LC 5AY8C 3W97D 4KAMA 1ASAA 3NRAA 1WKHA 3MAUA 1P34A 4WU9B 4WXGA 4P7YA 1DJUA 5FT8A 2JG2A 1QISA 1P34D 5B31A 1D2FA 4W5KA 2CSTA 2Z1YA 4WZSB 5B31D 3BS8A 5B33A 1BJWA 5AVCC 1P3FB 3LZ1C 1C4KA 3T32A 3WKSA 4Y0IA 3TQXA 4F5GA 5B1MA 5B33D 5CPKA 1KU5A 1LW5A 1KAFA 1V2DA 3B46A 1M0NA 1P3PB 3AZJC 4WYDA 3VP6A 4CSRA 1SZSA 2D64A 3W1JA 1F1EA 4NE6A 3AZLA 3GSBA 2CY8A 2HUEB 1C7OA 1P3FD 1BT4A 3N7NA 4YM6C 5AVBA 1M0OA 2GSAA 2HZPA 3H9XA 3AZLD 1ZLAC 3N4SA 2W8JA 2BWPA 5AVBD 3A2BA 3MGPC 2AY3A 3REHA 1X0MA 1AOIA 1GD9A 3O62A 5HDMA 1P3PD 3FQ8A 3USFA 5DB5A 3MGQA 4LD9C 2HP2A 4ZM4A 4JEXA 1AOID 4LNLA 5BNVB 4JJNB 4CBRA 1J32A 4DBCA 1IJIA 3MGSA 1X29A 1R4VA 1O62A 1V72A 3I5TA 3AATA 1P3GB 3TATA 5DJ9A 2CV5C 3A6NB 3B6GB 3MGSD 5KDMA 5C3IC 3LZ0C 3HL2A 3PAAA 3FVXA 5G0AA 2NQBB 2D7ZA 3AOWA 4WNNA 2FNUA 3PDBA 1QITA 1KMJA 3N0LA 3VH6W 2YFVB 4W91A 5AY8B 4JJND 4Z66A 1G7XA 5BJ3A 2YCNA 1W7NA 3ZZJA 3AZFA 4Z66D 1E5EA 3CQ5A 2YKYA 3A6ND 3WA9A 1D7UA 2VMSA 5CHLB 4WU8A 3AZFD 3ASAA 5JA4B 2NQBD 2BWOA 3HDOA 2JE5A 1P3BC 3FKDA 3L8AA 3WY7A 4CBSA 1M1AC 4XJOA 2BYMB 1YJZA 3D6KA 5AY8D 5AVCB 1T3UA 2VYCA 1YJYA 1IBJA 1E5FA 5AX8A 4QLCC 1D7VA 2Y2IA 1JFIB 1ZC9A 1M32A 2FJ7A 1V2FA 1S09A 5B1LA 3EI5A 3LZ1A 3AZIB 3X1UC 4RM1A 2BI5A 2VGSA 4UPKA 3DR7A 3LVMA 5B1LD 3LZ1D 3WKJA 3E2ZB 3BCXA 4MQPA 3AV2C 2QMAA 4GEBA 3AZJA 4H9PB 3WKJD 3MGPB 3AEPA 1ASBA 1P3OC 3AZGA 1CZEA 3AZJD 5B0YC 3PDXA 4WBTA 4J5UA 2CFBA 3AZHC 4YM6A 5JAYA 5G49B 1ZLAA 5FT4A 2WK8A 2V1PA 2VIAA 4AO9A 3AZEB 3R4TA 4ATQA 4H9QA 1AJSB 4YM6D 3G8MA 1ZLAD 4K05A 5EUDA 4ADEA 2Z1ZA 2X8UA 3LZ0B 1IAXA 2JGTA 4LD9A 2QSRA 3AEMA 2AY5A 1M6SA 3W1IA 3QI6A 4H9OA 1WWSA 1TZYC 4LD9D 3NU7A 4R8PC 3WTPA 4ADCA 1SZUA 4XJLA 1KMKA 2BIEA 4CAYA 2CV5A 4W1VA 3WTPD 3AFAC 2E7JA 3E77A 1LK9A 1S08A 2CV5D 3LY1A 3LZ0D 4GDYA 4ITGA 2JISA 3LVKA 1TOEA 1VEFA 3UTAA 4E45A 3QBOA 5F99C 1HQ3A 2DGMA 1P3BB 1ARGA 4W8IA 3WAAB 3LJAA 4OBUA 4A6TA 4YS3B 2QBTA 2DKJA 2VMZA 3RBLA 1M19B 5BNXB 5FUGB 2YHKA 1TATA 4UUZB 3AENA 1S32C 3FQ7A 1P3MC 1GEYA 1I29A 5D5SA 1AMRA 2VMUA 3REIB 4NE5A 1M1AA 5AV5B 1GBNA 2F8NH 1AKBA 1P3BD 3ELEA 3FFHA 3MGRA 2AY7A 1M1AD 4H9SA 1SZKA 4MKKA 1ARSA 4QLCA 1B67A 3AV2B 2Y2GA 4A0HA 3TCMA 4QLCD 3X1UA 2VMYA 1P3OB 4ZUXA 1ID3A 5EFSA 5DNMB 3AEJC 5CPIB 1DKAA 3X1UD 2F8NB 4H9NA 3AZHB 5F8VA 2VGWA 4WYGA 4HF8A 2G5HC 2YCTA 4OYTA 3VK3A 3II0A 3EI6A 5E5AA 2ZY2A 5M46A 3AV2D 3VH6T 2VMQA 3A9XA 3I4JA 4ADBA 1N8PA 5B0YA 1O61A 3R45A 2YKXA 2EO5A 1P3OD 3AZHA 3B0BA 3AN2A 1IX8A 1TZYB 1FG7A 5B0YD 2R2NA 2F8ND 1GEWA 2RVQC 3AZHD 4H9RA 5B2JB 3B6FB 1AY5A 2YCPA 3MAFB 2FN6A 1XI9A 2BI9A 3HT4A 3VAXA 1X2AA 3AFAB 4LW2A 1KX5C 3X1TC 2W8WA 1BJOB 2CJGA 4IYOA 3EG5B 4R8PA 2HOZA 3AV7A 1KX4A 3VH6A 4R8PD 3AFAA 3NDNA 1F66B 4KUDB 2CH1A 3EPHA 4XQ2A 1DJ9A 3CBFA 1JF9A 4MSOA 3B1DA 2ZC0A 3DYDA 3AFAD 1DTYA 3V9RB 5B2IC 1OHYA 1S32B 2VIBA 5B24A 1P3KC 1P3MB 5F99A 3DXWA 2PB2A 5B32A 3B0CW 1TOJA 4H51A 2HIOC 5F99D 2Z9WA 1JS6A 5AV9A 3MEBA 2NMPA 1U35B 1G4XA 3A9ZA 4PVFA 3KXBA 5GT3B 3EUCA 2G7JA 1AKAA 3C1CB 1LC5A 4RKCA 1S32D 1W7MA 1P3MD 1N1JB 4ZDLA 3RCHA 4ZLVA 1P3LC 5DJ1A 1BH9A 3RELC 5AV8C 3KUYC 1P3IC 3HVYA 2Z20A 4M6BA 2UWXA 2W8SA 2HUEC 3AZKC 3AZMA 3WTPE 2HUUA 3LELB 1BH8B 3OP7A 4NFTA 3GJUA 1D7RA 5JRGA 5HHYA 4WLJA 1PMMA 3NQUB 4KGCC 3I16A 1N31A 3NYUA 2AATA 2JJGA 3N4XA 2VMOA 1FC4A 4CVQA 3CAIA 3PPLA 4IW7A 1KX5B 2R5EA 3X1TB 1EQZA 4E77A 1D7SA 5GXQC 2OGAA 3P1TA 3B6GC 2AY6A 1EQZD 2RVQD 5BO0B 3KWQC 2EGYA 1ARIA 1KKPA 1CL2A 3W1HA 4WD2A 5GT0C 5B2IB 2W7EA 3EPLA 2VGTA 2HOYA 1P3KB 3X1TD 2WK7A 3PD6B 4RKDA 1ULYA 5KTBA 2W7JA 2HIOB 4FFCA 5GSUC 2ZJGA 3G7QA 2CJHA 2AY1A 1CS1A 4DGTA 4RAEA 1AJRA 3E2FA 2AEUA 1I41A 1WWIA 4LC3A 1UU1A 3IP4C 5B2ID 3ZRPA 2PB0A 4WU9A 1P3KD 3DXVA 2GMSA 5CPJC 2HOXA 4WU9D 4WXFA 2HIOD 2G6WA 2R5CB 1X28A 1P3LB 2VGVA 4AZKA 2R0TA 3RELB 1IX6A 5AV8B 3KUYB 1P3IB 4ZBJC 3NQJB 1P3FA 3AZIC 3A1IA 1FG3A 1LC7A 2VMRA 4MY5A 1SFFA 3AZKB 4KXKA 3R9AA 2LY8A 4DRBA 1P3PA 2A1VA 4F5JA 4ZM3A 3KFUG 5DX5A 3RELD 4KGCB 4UQVA 3KUYD 2PYOC 1P3ID 3NNKA 1W3UA 3W96C 3X1VC 3NX3A 4HGAC 2GMUA 4DRAA 1C9CA 1G7WA 3AZEC 1TOGA 2OGEA 2CTZA 4WP0A 5B40C 2ORDA 5GXQB 1AIBA 4W1WA 3UTBB 2X5FA 3KWQB 3B0CT 5BNVA 4JJNA 2VGZA 3AZNC 2AROC 2AY4A 3E2YA 5GT0B 3N4RA 2ZY3A 4F5MA 1P3GA 1BS0A 1M18C 3A6NA 3B6GA 1BFMA 2DR1A 3ISLA 1WYVB 3GBXA 5G2PA 1ARHA 1H0CA 1P3GD 2NQBA 5GXQD 5GSUB 3B6GD 4NE3A 4ZAHA 4IY7A 3A9YA 2YFVA 2Y2MA 3KWQD 4EB7A 5AY8A 1GDEA 5B0ZB 3WAAC 3IHJA 2DGLA 4ISYA 4YS3C 1M0QA 2BG1A 1M19C 4J8WC 1MAQA 2BKWA 5CPJB 3X1SB 3GZDC 5JA4A 2EPJA 4WJ3C 1KX3C 3P6KA 4A0GA 3K28A 4Q6RA 3REKB 2Y2NA 4LW4A 3REIC 1QGNA 5AV5C 4ZBJB 2BYMA 4OTLA 5AVCA 3FZ8A 2VMWA 3QN6A 1P3AC 3VK4A 2VMXA 5AVCD 1S0AA 1M4NA 3C1BC 1JFIA 4BMKA 1PFFA 2QLRA 1QZ9A 1GC2A 4BQ0A 3UT9C 2AY9A 1UU0A 3VH5W 1CZCA 3AZIA 3EI9A 5D95A 2PYOB 2J8PA 1AY4A 3B0DC 1S06A 5DNMC 3W96B 3CQ6A 5CPIC 3X1VB 3AZID 4HGAB 3E2ZA 1WYTB 3H7FA 4KYOA 3PA9A 1ASNA 4H9PA 4J8VC 3MGPA 5AV6C 5B40B 1MLZA 1TOKA 3FVSA 3FRKA 3WZFA 1AAMA 1DGEA 3F0HA 1RV4A 2OQXA 3MGPD 1ASFA 2VLHA 4XAUA 5HXXA 5G49A 3ACZA 3X1VD 3AZNB 2AROB 3AZEA 1AJSA 1XEYA 5B2JC 3B6FC 1M18B 2E54A 4W1XA 3RUYA 3AZED 2YRRA 3LZ0A 5EAAA 3QGUA 5B40D 3BN1A 3W99C 1AICA 1ASDA 4J8UC 3A8UX 1MAPA 3QM2A 2Y2PA 3CQ4A 3AZND 2AROD 2AEVA 4KHAB 1MDXA 1OXPA 1ORDA 4G92B 1F66C 4KUDC 1KL1A 4RJYA 1MDZA 3KSYA 1M18D 4J8WB 3AV1B 1BQAA 3MVDC 9AATA 4F5IA 3WX9A 1KX3B 1JG8A 3VK2A 4WB0B 1P3BA 3Q8NA 5E5IA 2YFWB 3WAAA 3E9KA 4YS3A 5M4BA 3REJB 1M19A 2KFPA 5BNXA 2ZM5A 3WAAD 5FUGA 4ZWMA 1U35C 1P3AB 4UUZA 3GZDA 4YS3D 1ASCA 4F4EA 2VMTA 1CQ8A 1M19D 5GT3C 4WXBA 4M2JA 5EQCA 4J8WD 4RJ0A 1QJ5A 3C1BB 3REIA 3C1CC 3FDDA 5AV5A 2OKKA 3RI6A 1MLYA 1KX3D 5EAVA 2DQNC 3UT9B 1Z7DA 3N5MA 3REID 3PGYA 2Y2LA 3NTJA 3B0DB 5AV5D 5EIGB 4E3RA 5BS7C 4AH3A 3ELPA 3ECDA 4Q31A 3FZ7A 2W7HA 1WSTA 4RLGA 3UWCA 1ZOBA 1AMAA 2YRIA 3AYWB 3AV2A 1P3AD 1WYUB 2EZ2A 1OHWA 1M7YA 4J8VB 5AV6B 4GRXA 1P3OA 2ZSLA 4X23C 4IXZA 1HTAA 2Y2JA 5DNMA 3LELC 4MQQA 5CPIA 3UT9D 2JJHA 4A0RA 2F8NA 4UHOA 3PJ0A 4EB5A 5DNMD 5CPID 3UAKA 3JWBA 4J8XB 1CJ0A 3AEOA 1Z2CB 1DFOA 4J8VD 4A00A 5AV6D 3W99B 3M5UA 1P3WA 1TZYA 4CXQA 4J8UB 5FT6A 5BT1C 5B2JA 3B6FA 3AL0C 2W7LA 4B98A 1TZYD 3MAFA 2Z9UA 2HUFA 1GC0A 2DKBA 5CP6C 1OATA 3DODA 2CWEA 3BV0A 8AATA 5B2JD 3B6FD 1G4VA 2W8UA 2BYKB 3FZ6A 1W2EA 1BJOA 2F8JA 3TU4C 3MVDB 4Z2MG 3KGXA 1ELUA 3W99D 2X5DA 1C7GA 4JEZA 2TPLA 3ATHA 3UE8A 3LVLB 4MQRA 1F66A 4KUDA 1J04A 3FDBA 4FL0A 2C0RA 5G4JA 2NZDB 2DOUA 4MKJA 5B31C 3VH5T 3WGBA 1C0NA 1F66D 3V9RA 4KUDD 4OCAA 4BHDA 1S32A 1BKGA 4GE4A 1P3MA 4XUJB 1S07A 5K8BA 2PO3A 3BCAA 3WGCA 4EFFA 4WYEA 3NYSA 4R5FA 5B1MC 5CPKC 3GETA 4PFFA 1U35A 4K2MA 2D5YA 5GT3A 1TPLA 2QA3A 1U35D 4B9BA 3C1CA 3BWNC 2W7FA 4WV4B 5GT3D 2GB3A 3EZSA 3C1CD 2F2AC 3BC8A 4X23B 1N1JA 1B6WA 1ASEA 5BS7A 3AEJA 3VH5A 4XZQB 4Z5TB 2VMPA 3F6TA 4DQ6A 3REHC 4IXOA 4ADDA 4RIZA 3O62C 5C6UA 3B1EA 3MGQC 5EUEA 4GE7A 3LELA 1BH8A 1AX4A 1H3OB 4X23D 3ZRRA 5DNNB 3MGSC 2XH1A 4AWLB 2FNIA 3LELD 5EUNA 2XD1A 1AHFA 5M4DA 3NQUA 2DF4C 3E6GA 1TAFB 4U1TA 4ZDOA 1IAYA 3H0MC 3DRDA 3UTBC 5CP6B 4CXRA 3W97B 1YAAA 3DC1A 3L44A 1MDOA 1KX5A 1ZODA 3X1TA 2ZSMA 3TU4B 1U08A 2VMVA 4J8LA 1KX5D 4F5KA 2OATA 1V2EA 1P34B 5BO0A 3WA9C 1CQ7A 4WU8C 2QB2A 2W7MA 5B31B 5CP6D 5B2IA 3TU4A 1CQ6A 1LKCA 4IX8A 1P3KA 5B0ZC 3EPJA 4PIWA 3FSLA 4OC9A 4Q76A 2BHXA 1AIAA 2CJDA 5B33B 3TU4D 3PD6A 4AO4A 4AZJA 4R2NA 2HIOA 4ATPA 4G91C 5B1MB 3X1SC 5CPKB 1SVVA 3N75A 4N0WA 3REKC 3B1CA 2ZP7A 1CL1A 3EI7A 4L0OA 4OMAA 2FJ7C 1IX7A 1UU2A 2BYJA 5B1LC 5G2QA 4CSRB 2ZUKA 3TFUA 4ZSWA 4E1OA 4R5ZA 1B9HA 3AZLB 3NUBA 2OKJA 2W8VA 5AVBB 5B31G 3WKJC 2W7DA 2R5CA 4R8DA 1P3LA 3RELA 5B1MD 5AV8A 5CPKD 3KUYA 1P3IA 3BWNA 3NQJA 1P3LD 1B9IA 2AY8A 5AV8D 4F5FA 3REHB 3AZGC 1AOIB 5G09A 3O62B 1B8GA 1TASA 3MGQB 3AZKA 2VI8A 2L5AA 3AZKD 4LNMA 3MGSB 4UHMA 2W7IA 2Y2KA 1SF2A 4KGCA 3FFRA 3FQAA 2GQNA 2JJEA 5KDMB 2CH2A 4P3MA 5I92A 4KGCD 3AEMC 4GSAA 3REHD 3NYTA 3O62D 4WNNB 3MNNC 3PDBB 3MGQD 3WTPC 2FYFA 2Q7WA 3NU8A 1GC3A 4Z66B 2FQ6A 5GXQA 4F5HA 4XK1A 2JSSA 2XBNA 3AZFB 4E3QA 1LS3A 3UTBA 1UKJA 2O1BA 3KWQA 3WA9B 2F8NK 4WU8B 4WYAA 3UTBD 3UTAC 3EIAA 5GT0A 3W98C 3LVJA 1OXOA 1HQ3C 1RVUA 2BI3A 2BWNA 3LJAC 4G92C 1AMSA 5GT0D 1WYVA 3DZZA 1ASLA 1I48A 3WCNA 4U2HA 2ZYJA 5GSUA 3PIUA 3AV1C 3HLMA 4G91B 4ZSYA 1MGVA 4EMYA 3GR9A 3WA9D 5GSUD 3NUIA 1ARTA 2CB1A 4WU8D 5B0ZA 4ITXA 1AHYA 1SPAA 3AELA 2FJ7B 4O6ZA 5B1LB 3LZ1B 1AHXA 3RQ1A 3MGRC 3REJC 4JEWA 5B0ZD 2C44A 4H9SC 2FKIA 5CPJA 4UHNA 5IWQA 3X1SA 1PZRA 2W7GA 3WKJB 3TFTA 3HQTA 2VLFA 3REKA 5CPJD 1B5PA 3X1SD 2CANA 3AZJB 4XEWA 3BWOA 2JJFA 3REKD 4ZUXC 2C81A 1ID3C 1KKJA 4OBVA 3AZGB 2FJ7D
chains in the Genus database with same CATH topology
3QHXA 1BJ4A 4OT8A 1BQDA 4YM6B 3DR4A 1ZLAB 1C7NA 3AYWC 4AOAA 1ASMA 4H9QB 3AOVA 2Y2OA 5E5AC 3GWPA 3BCBA 5BJ4A 2D63A 1OHVA 4A6RA 2D65A 1IVRA 2PYOA 4K2BA 3W96A 3X1VA 3G0TA 4LD9B 4Y0HA 3AN2C 1B4XA 3AZGD 2PYOD 4H9OB 1WYTA 3MNNB 2ZY5A 3W96D 3BB8A 1DJEA 4JEYA 3K40A 3MKJA 1ASGA 4NOGA 3WTPB 1W7LA 4J8XC 5B40A 4E44A 1EG5A 2VMNA 4H63Q 1W23A 4CAYB 3OKSA 3KKIA 2CV5B 2Z9XA 4BA4A 3WLXA 5M49A 5C3IB 1YIYA 1QJ3A 4EU1A 1A7WA 1WKGA 4A72A 3MNNA 3AZNA 2AROA 3UTAB 1LC8A 3W98B 4DQYB 1HQ3B 3MNND 2E7IA 1KX4C 1M18A 2X3LA 3F9TA 3LJAB 3HBXA 4F5LA 3LG0A 1I43A 3EZ1A 2VGUA 2W8TA 3ZRQA 1EJIA 1GEXA 1TARA 3AENB 4Y0DA 2QB3A 5B24C 2AY2A 3JZLA 4JF0A 3W98A 1YIZA 5B32C 4KHAA 1M1AB 3UTAD 2EYQA 3W98D 1HQ3D 3LV2A 3EIBA 1B5OA 1O69A 3MGRB 5AV9C 3RBFA 3FCRA 1TOIA 2NZDC 4JEVA 4EO5C 3LJAD 4J8WA 1BJNA 3AV1A 4M2MA 3KXBC 1KX3A 4QLCB 4XUJC 4WB0A 3AV1D 3A1KA 2XD5A 2YFWA 4I8AA 1BW0A 3X1UB 3REJA 4ZUXB 1Z3ZA 5E4ZA 4Z2MH 1ID3B 2W7KA 2IO5C 1KL2A 1P3AA 3WCOA 4Q75A 3MADA 2HORA 1GC4A 4H9NB 3MGRD 3REJD 3FVUA 3KE3A 3QPGA 2BI2A 2YOBA 2HUIA 3C1BA 4WYFA 2D61A 5E3KA 5E5AB 3UT9A 4PFNA 3MC6C 3C1BD 2VQRA 3AZMC 5EIGA 5B0YB 4K2IA 2WK9A 3K7YA 3R45B 4XZQC 4ZUXD 4Z5TC 3AN2B 5JRGC 1ID3D 3AYWA 1WYUA 1AMQA 5F9SA 3MBBA 2CINA 4J8VA 4H9RB 5AV6A 2DGKA 3AYWD 7AATA 3VOMA 5E5AD 2Y2HA 3FTBA 2EZ1A 4M2KA 1YJSA 5DNNC 4AWLC 1EQZC 1Q9CA 4IYOB 4BA5A 4R8PB 3FD0A 3AN2D 1O4SA 3GZCA 4J8XA 1EQBA 4WLHA 5G4IA 1KX4B 2FM1A 2V0YA 4J8XD 3W97C 3W99A 1DGDA 3KGWA 2F8NG 2RFVA 5TF5A 4QGRA 3HMUA 1AAWA 4J8UA 2RIQA 5B24B 4ZDPA 5F99B 3ASBA 2D7YA 2Z61A 2JCHA 5B32B 3WKRA 4J8UD 1P34C 3EI8A 4TN4A 1KX4D 5AV9B 2BI1A 2BYKA 4HVKA 4EO5B 1QIRA 2BYLA 3MVDA 3KXBB 3JTXA 3H0RC 1GCKA 2G5IC 2WKAA 5B33C 3MVDD 4WU9C 5B24D 5B32D 1AHGA 2E7UA 1VJOA 2NZDA 4ZASA 3RCHB 2IO5B 1AHEA 1ELQA 2ZY4A 2VI9A 2BIGA 2WB6A 1BH9B 5AV9D 2NZDD 4XUJA 1T3IA 4A0FA 5B32G 2Z9VA 1P3FC 3KXBD 1PMOA 4XUJD 1VP4A 3AZLC 3AZMB 3COGA 4WYCA 1Y4IA 1PG8A 5AVBC 5J8QA 5JRGB 2FFFB 1P3PC 1RV3A 4GE9A 1ECXA 2D66A 1IUGA 1AOIC 3JWAA 3MC6A 1N2TA 4X23A 1RVYA 4XZQA 3DU4A 4Z5TA 3AZMD 1YNUA 1JS3A 3LWSA 1EQZB 1AKCA 3P5JB 3ZZKA 4XJPA 4XZQD 1H1CA 4Z5TD 5JRGD 4TMRA 3JW9A 3B8XA 1AY8A 2YKVA 1LW4A 2YKUA 5FT5A 4LNJA 2BIAA 2Y2QA 4JJNC 2HP1A 1H3OA 5DNNA 4XJMA 4ZWVA 1P3GC 4Z66C 1TAFA 2C7TA 3A6NC 5DNND 1YOOA 3EPKA 4RITA 2EH6A 3AZFC 1M0PA 2O0RA 4JF1A 2NQBC 5CP6A 5BT1D 4A6UA 3W97A 4UOYA 4IXSA 2O7CA 3H0LC 5AY8C 3W97D 4KAMA 1ASAA 3NRAA 1WKHA 3MAUA 1P34A 4WU9B 4WXGA 4P7YA 1DJUA 5FT8A 2JG2A 1QISA 1P34D 5B31A 1D2FA 4W5KA 2CSTA 2Z1YA 4WZSB 5B31D 3BS8A 5B33A 1BJWA 5AVCC 1P3FB 3LZ1C 1C4KA 3T32A 3WKSA 4Y0IA 3TQXA 4F5GA 5B1MA 5B33D 5CPKA 1KU5A 1LW5A 1V2DA 3B46A 1M0NA 1P3PB 3AZJC 4WYDA 3VP6A 4CSRA 1SZSA 2D64A 3W1JA 1F1EA 4NE6A 3AZLA 3GSBA 2CY8A 2HUEB 1C7OA 1P3FD 1BT4A 3N7NA 4YM6C 5AVBA 1M0OA 2GSAA 2HZPA 3H9XA 3AZLD 1ZLAC 3N4SA 2W8JA 2BWPA 5AVBD 3A2BA 3MGPC 2AY3A 3REHA 1X0MA 1AOIA 1GD9A 3O62A 5HDMA 1P3PD 3FQ8A 3USFA 5DB5A 3MGQA 4LD9C 2HP2A 4ZM4A 4JEXA 1AOID 4LNLA 5BNVB 4JJNB 4CBRA 1J32A 4DBCA 1IJIA 3MGSA 1X29A 1R4VA 1O62A 1V72A 3I5TA 3AATA 1P3GB 3TATA 5DJ9A 2CV5C 3A6NB 3B6GB 3MGSD 5KDMA 5C3IC 3LZ0C 3HL2A 3PAAA 3FVXA 5G0AA 2NQBB 2D7ZA 3AOWA 4WNNA 2FNUA 3PDBA 1QITA 1KMJA 3N0LA 3VH6W 2YFVB 4W91A 5AY8B 4JJND 4Z66A 1G7XA 5BJ3A 2YCNA 1W7NA 3ZZJA 3AZFA 4Z66D 1E5EA 3CQ5A 2YKYA 3A6ND 3WA9A 1D7UA 2VMSA 5CHLB 4WU8A 3AZFD 3ASAA 5JA4B 2NQBD 2BWOA 3HDOA 2JE5A 1P3BC 3FKDA 3L8AA 3WY7A 4CBSA 1M1AC 4XJOA 2BYMB 1YJZA 3D6KA 5AY8D 5AVCB 1T3UA 2VYCA 1YJYA 1IBJA 1E5FA 5AX8A 4QLCC 1D7VA 2Y2IA 1JFIB 1ZC9A 1M32A 2FJ7A 1V2FA 1S09A 5B1LA 3EI5A 3LZ1A 3AZIB 3X1UC 4RM1A 2BI5A 2VGSA 4UPKA 3DR7A 3LVMA 5B1LD 3LZ1D 3WKJA 3E2ZB 3BCXA 4MQPA 3AV2C 2QMAA 4GEBA 3AZJA 4H9PB 3WKJD 3MGPB 3AEPA 1ASBA 1P3OC 3AZGA 1CZEA 3AZJD 5B0YC 3PDXA 4WBTA 4J5UA 2CFBA 3AZHC 4YM6A 5JAYA 5G49B 1ZLAA 5FT4A 2WK8A 2V1PA 2VIAA 4AO9A 3AZEB 3R4TA 4ATQA 4H9QA 1AJSB 4YM6D 3G8MA 1ZLAD 4K05A 5EUDA 4ADEA 2Z1ZA 2X8UA 3LZ0B 1IAXA 2JGTA 4LD9A 2QSRA 3AEMA 2AY5A 1M6SA 3W1IA 3QI6A 4H9OA 1WWSA 1TZYC 4LD9D 3NU7A 4R8PC 3WTPA 4ADCA 1SZUA 4XJLA 1KMKA 2BIEA 4CAYA 2CV5A 4W1VA 3WTPD 3AFAC 2E7JA 3E77A 1LK9A 1S08A 2CV5D 3LY1A 3LZ0D 4GDYA 4ITGA 2JISA 3LVKA 1TOEA 1VEFA 3UTAA 4E45A 3QBOA 5F99C 1HQ3A 2DGMA 1P3BB 1ARGA 4W8IA 3WAAB 3LJAA 4OBUA 4A6TA 4YS3B 2QBTA 2DKJA 2VMZA 3RBLA 1M19B 5BNXB 5FUGB 2YHKA 1TATA 4UUZB 3AENA 1S32C 3FQ7A 1P3MC 1GEYA 1I29A 5D5SA 1AMRA 2VMUA 3REIB 4NE5A 1M1AA 5AV5B 1GBNA 2F8NH 1AKBA 1P3BD 3ELEA 3FFHA 3MGRA 2AY7A 1M1AD 4H9SA 1SZKA 4MKKA 1ARSA 4QLCA 1B67A 3AV2B 2Y2GA 4A0HA 3TCMA 4QLCD 3X1UA 2VMYA 1P3OB 4ZUXA 1ID3A 5EFSA 5DNMB 3AEJC 5CPIB 1DKAA 3X1UD 2F8NB 4H9NA 3AZHB 5F8VA 2VGWA 4WYGA 4HF8A 2G5HC 2YCTA 4OYTA 3VK3A 3II0A 3EI6A 5E5AA 2ZY2A 5M46A 3AV2D 3VH6T 2VMQA 3A9XA 3I4JA 4ADBA 1N8PA 5B0YA 1O61A 3R45A 2YKXA 2EO5A 1P3OD 3AZHA 3B0BA 3AN2A 1IX8A 1TZYB 1FG7A 5B0YD 2R2NA 2F8ND 1GEWA 2RVQC 3AZHD 4H9RA 5B2JB 3B6FB 1AY5A 2YCPA 3MAFB 2FN6A 1XI9A 2BI9A 3HT4A 3VAXA 1X2AA 3AFAB 4LW2A 1KX5C 3X1TC 2W8WA 1BJOB 2CJGA 4IYOA 3EG5B 4R8PA 2HOZA 3AV7A 1KX4A 3VH6A 4R8PD 3AFAA 3NDNA 1F66B 4KUDB 2CH1A 3EPHA 4XQ2A 1DJ9A 3CBFA 1JF9A 4MSOA 3B1DA 2ZC0A 3DYDA 3AFAD 1DTYA 3V9RB 5B2IC 1OHYA 1S32B 2VIBA 5B24A 1P3KC 1P3MB 5F99A 3DXWA 2PB2A 5B32A 3B0CW 1TOJA 4H51A 2HIOC 5F99D 2Z9WA 1JS6A 5AV9A 3MEBA 2NMPA 1U35B 1G4XA 3A9ZA 4PVFA 3KXBA 5GT3B 3EUCA 2G7JA 1AKAA 3C1CB 1LC5A 4RKCA 1S32D 1W7MA 1P3MD 1N1JB 4ZDLA 3RCHA 4ZLVA 1P3LC 5DJ1A 1BH9A 3RELC 5AV8C 3KUYC 1P3IC 3HVYA 2Z20A 4M6BA 2UWXA 2W8SA 2HUEC 3AZKC 3AZMA 3WTPE 2HUUA 3LELB 1BH8B 3OP7A 4NFTA 3GJUA 1D7RA 5JRGA 5HHYA 4WLJA 1PMMA 3NQUB 4KGCC 3I16A 1N31A 3NYUA 2AATA 2JJGA 3N4XA 2VMOA 1FC4A 4CVQA 3CAIA 3PPLA 4IW7A 1KX5B 2R5EA 3X1TB 1EQZA 4E77A 1D7SA 5GXQC 2OGAA 3P1TA 3B6GC 2AY6A 1EQZD 2RVQD 5BO0B 3KWQC 2EGYA 1ARIA 1KKPA 1CL2A 3W1HA 4WD2A 5GT0C 5B2IB 2W7EA 3EPLA 2VGTA 2HOYA 1P3KB 3X1TD 2WK7A 3PD6B 4RKDA 1ULYA 5KTBA 2W7JA 2HIOB 4FFCA 5GSUC 2ZJGA 3G7QA 2CJHA 2AY1A 1CS1A 4DGTA 4RAEA 1AJRA 3E2FA 2AEUA 1I41A 1WWIA 4LC3A 1UU1A 3IP4C 5B2ID 3ZRPA 2PB0A 4WU9A 1P3KD 3DXVA 2GMSA 5CPJC 2HOXA 4WU9D 4WXFA 2HIOD 2G6WA 2R5CB 1X28A 1P3LB 2VGVA 4AZKA 2R0TA 3RELB 1IX6A 5AV8B 3KUYB 1P3IB 4ZBJC 3NQJB 1P3FA 3AZIC 3A1IA 1FG3A 1LC7A 2VMRA 4MY5A 1SFFA 3AZKB 4KXKA 3R9AA 2LY8A 4DRBA 1P3PA 2A1VA 4F5JA 4ZM3A 3KFUG 5DX5A 3RELD 4KGCB 4UQVA 3KUYD 2PYOC 1P3ID 3NNKA 1W3UA 3W96C 3X1VC 3NX3A 4HGAC 2GMUA 4DRAA 1C9CA 1G7WA 3AZEC 1TOGA 2OGEA 2CTZA 4WP0A 5B40C 2ORDA 5GXQB 1AIBA 4W1WA 3UTBB 2X5FA 3KWQB 3B0CT 5BNVA 4JJNA 2VGZA 3AZNC 2AROC 2AY4A 3E2YA 5GT0B 3N4RA 2ZY3A 4F5MA 1P3GA 1BS0A 1M18C 3A6NA 3B6GA 1BFMA 2DR1A 3ISLA 1WYVB 3GBXA 5G2PA 1ARHA 1H0CA 1P3GD 2NQBA 5GXQD 5GSUB 3B6GD 4NE3A 4ZAHA 4IY7A 3A9YA 2YFVA 2Y2MA 3KWQD 4EB7A 5AY8A 1GDEA 5B0ZB 3WAAC 3IHJA 2DGLA 4ISYA 4YS3C 1M0QA 2BG1A 1M19C 4J8WC 1MAQA 2BKWA 5CPJB 3X1SB 3GZDC 5JA4A 2EPJA 4WJ3C 1KX3C 3P6KA 4A0GA 3K28A 4Q6RA 3REKB 2Y2NA 4LW4A 3REIC 1QGNA 5AV5C 4ZBJB 2BYMA 4OTLA 5AVCA 3FZ8A 2VMWA 3QN6A 1P3AC 3VK4A 2VMXA 5AVCD 1S0AA 1M4NA 3C1BC 1JFIA 4BMKA 1PFFA 2QLRA 1QZ9A 1GC2A 4BQ0A 3UT9C 2AY9A 1UU0A 3VH5W 1CZCA 3AZIA 3EI9A 5D95A 2PYOB 2J8PA 1AY4A 3B0DC 1S06A 5DNMC 3W96B 3CQ6A 5CPIC 3X1VB 3AZID 4HGAB 3E2ZA 1WYTB 3H7FA 4KYOA 3PA9A 1ASNA 4H9PA 4J8VC 3MGPA 5AV6C 5B40B 1MLZA 1TOKA 3FVSA 3FRKA 3WZFA 1AAMA 1DGEA 3F0HA 1RV4A 2OQXA 3MGPD 1ASFA 2VLHA 4XAUA 5HXXA 5G49A 3ACZA 3X1VD 3AZNB 2AROB 3AZEA 1AJSA 1XEYA 5B2JC 3B6FC 1M18B 2E54A 4W1XA 3RUYA 3AZED 2YRRA 3LZ0A 5EAAA 3QGUA 5B40D 3BN1A 3W99C 1AICA 1ASDA 4J8UC 3A8UX 1MAPA 3QM2A 2Y2PA 3CQ4A 3AZND 2AROD 2AEVA 4KHAB 1MDXA 1OXPA 1ORDA 4G92B 1F66C 4KUDC 1KL1A 4RJYA 1MDZA 3KSYA 1M18D 4J8WB 3AV1B 1BQAA 3MVDC 9AATA 4F5IA 3WX9A 1KX3B 1JG8A 3VK2A 4WB0B 1P3BA 3Q8NA 5E5IA 2YFWB 3WAAA 3E9KA 4YS3A 5M4BA 3REJB 1M19A 2KFPA 5BNXA 2ZM5A 3WAAD 5FUGA 4ZWMA 1U35C 1P3AB 4UUZA 3GZDA 4YS3D 1ASCA 4F4EA 2VMTA 1CQ8A 1M19D 5GT3C 4WXBA 4M2JA 5EQCA 4J8WD 4RJ0A 1QJ5A 3C1BB 3REIA 3C1CC 3FDDA 5AV5A 2OKKA 3RI6A 1MLYA 1KX3D 5EAVA 2DQNC 3UT9B 1Z7DA 3N5MA 3REID 3PGYA 2Y2LA 3NTJA 3B0DB 5AV5D 5EIGB 4E3RA 5BS7C 4AH3A 3ELPA 3ECDA 4Q31A 3FZ7A 2W7HA 1WSTA 4RLGA 3UWCA 1ZOBA 1AMAA 2YRIA 3AYWB 3AV2A 1P3AD 1WYUB 2EZ2A 1OHWA 1M7YA 4J8VB 5AV6B 4GRXA 1P3OA 2ZSLA 4X23C 4IXZA 1HTAA 2Y2JA 5DNMA 3LELC 4MQQA 5CPIA 3UT9D 2JJHA 4A0RA 2F8NA 4UHOA 3PJ0A 4EB5A 5DNMD 5CPID 3UAKA 3JWBA 4J8XB 1CJ0A 3AEOA 1Z2CB 1DFOA 4J8VD 4A00A 5AV6D 3W99B 3M5UA 1P3WA 1TZYA 4CXQA 4J8UB 5FT6A 5BT1C 5B2JA 3B6FA 3AL0C 2W7LA 4B98A 1TZYD 3MAFA 2Z9UA 2HUFA 1GC0A 2DKBA 5CP6C 1OATA 3DODA 2CWEA 3BV0A 8AATA 5B2JD 3B6FD 1G4VA 2W8UA 2BYKB 3FZ6A 1W2EA 1BJOA 2F8JA 3TU4C 3MVDB 4Z2MG 3KGXA 1ELUA 3W99D 2X5DA 1C7GA 4JEZA 2TPLA 3ATHA 3UE8A 3LVLB 4MQRA 1F66A 4KUDA 1J04A 3FDBA 4FL0A 2C0RA 5G4JA 2NZDB 2DOUA 4MKJA 5B31C 3VH5T 3WGBA 1C0NA 1F66D 3V9RA 4KUDD 4OCAA 4BHDA 1S32A 1BKGA 4GE4A 1P3MA 4XUJB 1S07A 5K8BA 2PO3A 3BCAA 3WGCA 4EFFA 4WYEA 3NYSA 4R5FA 5B1MC 5CPKC 3GETA 4PFFA 1U35A 4K2MA 2D5YA 5GT3A 1TPLA 2QA3A 1U35D 4B9BA 3C1CA 3BWNC 2W7FA 4WV4B 5GT3D 2GB3A 3EZSA 3C1CD 2F2AC 3BC8A 4X23B 1N1JA 1B6WA 1ASEA 5BS7A 3AEJA 3VH5A 4XZQB 4Z5TB 2VMPA 3F6TA 4DQ6A 3REHC 4IXOA 4ADDA 4RIZA 3O62C 5C6UA 3B1EA 3MGQC 5EUEA 4GE7A 3LELA 1BH8A 1AX4A 1H3OB 4X23D 3ZRRA 5DNNB 3MGSC 2XH1A 4AWLB 2FNIA 3LELD 5EUNA 2XD1A 1AHFA 5M4DA 3NQUA 2DF4C 3E6GA 1TAFB 4U1TA 4ZDOA 1IAYA 3H0MC 3DRDA 3UTBC 5CP6B 4CXRA 3W97B 1YAAA 3DC1A 3L44A 1MDOA 1KX5A 1ZODA 3X1TA 2ZSMA 3TU4B 1U08A 2VMVA 4J8LA 1KX5D 4F5KA 2OATA 1V2EA 1P34B 5BO0A 3WA9C 1CQ7A 4WU8C 2QB2A 2W7MA 5B31B 5CP6D 5B2IA 3TU4A 1CQ6A 1LKCA 4IX8A 1P3KA 5B0ZC 3EPJA 4PIWA 3FSLA 4OC9A 4Q76A 2BHXA 1AIAA 2CJDA 5B33B 3TU4D 3PD6A 4AO4A 4AZJA 4R2NA 2HIOA 4ATPA 4G91C 5B1MB 3X1SC 5CPKB 1SVVA 3N75A 4N0WA 3REKC 3B1CA 2ZP7A 1CL1A 3EI7A 4L0OA 4OMAA 2FJ7C 1IX7A 1UU2A 2BYJA 5B1LC 5G2QA 4CSRB 2ZUKA 3TFUA 4ZSWA 4E1OA 4R5ZA 1B9HA 3AZLB 3NUBA 2OKJA 2W8VA 5AVBB 5B31G 3WKJC 2W7DA 2R5CA 4R8DA 1P3LA 3RELA 5B1MD 5AV8A 5CPKD 3KUYA 1P3IA 3BWNA 3NQJA 1P3LD 1B9IA 2AY8A 5AV8D 4F5FA 3REHB 3AZGC 1AOIB 5G09A 3O62B 1B8GA 1TASA 3MGQB 3AZKA 2VI8A 2L5AA 3AZKD 4LNMA 3MGSB 4UHMA 2W7IA 2Y2KA 1SF2A 4KGCA 3FFRA 3FQAA 2GQNA 2JJEA 5KDMB 2CH2A 4P3MA 5I92A 4KGCD 3AEMC 4GSAA 3REHD 3NYTA 3O62D 4WNNB 3MNNC 3PDBB 3MGQD 3WTPC 2FYFA 2Q7WA 3NU8A 1GC3A 4Z66B 2FQ6A 5GXQA 4F5HA 4XK1A 2JSSA 2XBNA 3AZFB 4E3QA 1LS3A 3UTBA 1UKJA 2O1BA 3KWQA 3WA9B 2F8NK 4WU8B 4WYAA 3UTBD 3UTAC 3EIAA 5GT0A 3W98C 3LVJA 1OXOA 1HQ3C 1RVUA 2BI3A 2BWNA 3LJAC 4G92C 1AMSA 5GT0D 1WYVA 3DZZA 1ASLA 1I48A 3WCNA 4U2HA 2ZYJA 5GSUA 3PIUA 3AV1C 3HLMA 4G91B 4ZSYA 1MGVA 4EMYA 3GR9A 3WA9D 5GSUD 3NUIA 1ARTA 2CB1A 4WU8D 5B0ZA 4ITXA 1AHYA 1SPAA 3AELA 2FJ7B 4O6ZA 5B1LB 3LZ1B 1AHXA 3RQ1A 3MGRC 3REJC 4JEWA 5B0ZD 2C44A 4H9SC 2FKIA 5CPJA 4UHNA 5IWQA 3X1SA 1PZRA 2W7GA 3WKJB 3TFTA 3HQTA 2VLFA 3REKA 5CPJD 1B5PA 3X1SD 2CANA 3AZJB 4XEWA 3BWOA 2JJFA 3REKD 4ZUXC 2C81A 1ID3C 1KKJA 4OBVA 3AZGB 2FJ7D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZS A;  3QHX A;  3UWC A;  1ZOB A;  2D64 A;  1BJ4 A;  1AMA A;  2YRI A;  1WYU B;  4OT8 A;  1BQD A;  2EZ2 A;  3GSB A;  3DR4 A;  2CY8 A;  1OHW A;  1M7Y A;  2Z20 A;  1C7O A;  1BT4 A;  1C7N A;  4AOA A;  1ASM A;  1M0O A;  2GSA A;  2HUU A;  2HZP A;  4GRX A;  3AOV A;  2ZSL A;  3OP7 A;  3BCB A;  4IXZ A;  5BJ4 A;  2D63 A;  2W8J A;  1OHV A;  4A6R A;  2D65 A;  3GJU A;  1IVR A;  1D7R A;  2BWP A;  3A2B A;  4MQQ A;  4K2B A;  5HHY A;  4WLJ A;  2AY3 A;  2JJH A;  4A0R A;  4UHO A;  1X0M A;  1GD9 A;  5HDM A;  3PJ0 A;  3FQ8 A;  4Y0H A;  4EB5 A;  3USF A;  1B4X A;  1N31 A;  5DB5 A;  3UAK A;  3NYU A;  1WYT A;  2HP2 A;  2ZY5 A;  3JWB A;  2AAT A;  2JJG A;  4ZM4 A;  3BB8 A;  4JEX A;  1DJE A;  4JEY A;  3K40 A;  3MKJ A;  1ASG A;  4LNL A;  1CJ0 A;  4NOG A;  2VMO A;  1J32 A;  3AEO A;  4CBR A;  1DFO A;  1FC4 A;  1W7L A;  4CVQ A;  4DBC A;  3CAI A;  1IJI A;  1X29 A;  1EG5 A;  2VMN A;  3PPL A;  1W23 A;  1O62 A;  3OKS A;  4IW7 A;  3KKI A;  4A00 A;  1V72 A;  3I5T A;  2Z9X A;  3AAT A;  3WLX A;  4BA4 A;  2R5E A;  5M49 A;  3M5U A;  3TAT A;  1YIY A;  5DJ9 A;  1QJ3 A;  1P3W A;  4E77 A;  4EU1 A;  1D7S A;  3HL2 A;  2OGA A;  4CXQ A;  3PAA A;  3FVX A;  1WKG A;  3P1T A;  4A72 A;  5FT6 A;  5G0A A;  2AY6 A;  2D7Z A;  3AOW A;  4B98 A;  2W7L A;  2FNU A;  3MAF A;  3PDB A;  1QIT A;  1KMJ A;  1LC8 A;  2EGY A;  2Z9U A;  1ARI A;  1KKP A;  2HUF A;  3N0L A;  1GC0 A;  2DKB A;  2E7I A;  1OAT A;  3DOD A;  3BV0 A;  8AAT A;  4W91 A;  3F9T A;  1CL2 A;  1G4V A;  4WD2 A;  1G7X A;  5BJ3 A;  2W8U A;  2YCN A;  4F5L A;  3LG0 A;  1W7N A;  2W7E A;  1I43 A;  3EZ1 A;  2VGT A;  3ZZJ A;  2HOY A;  1BJO A;  2F8J A;  2VGU A;  2W8T A;  3ZRQ A;  1EJI A;  3KGX A;  2WK7 A;  1ELU A;  1E5E A;  1GEX A;  3CQ5 A;  1TAR A;  2YKY A;  3PD6 B;  3AEN B;  4Y0D A;  4RKD A;  1D7U A;  2QB3 A;  2VMS A;  2X5D A;  1C7G A;  2AY2 A;  2W7J A;  4FFC A;  4JF0 A;  3ASA A;  2ZJG A;  1YIZ A;  4JEZ A;  2TPL A;  3ATH A;  3UE8 A;  3LVL B;  4MQR A;  3G7Q A;  1J04 A;  2CJH A;  2BWO A;  3HDO A;  2AY1 A;  3FDB A;  4FL0 A;  3FKD A;  1CS1 A;  3L8A A;  3WY7 A;  2C0R A;  5G4J A;  4RAE A;  4CBS A;  4DGT A;  2DOU A;  3LV2 A;  4MKJ A;  3EIB A;  3WGB A;  1AJR A;  1B5O A;  1C0N A;  1O69 A;  4XJO A;  3E2F A;  1I41 A;  3FCR A;  3RBF A;  1YJZ A;  1TOI A;  3D6K A;  4OCA A;  4LC3 A;  4JEV A;  4BHD A;  1BJN A;  1BKG A;  4GE4 A;  1UU1 A;  4M2M A;  3ZRP A;  1S07 A;  5K8B A;  2PB0 A;  3DXV A;  2PO3 A;  1YJY A;  1IBJ A;  2VYC A;  2GMS A;  4WB0 A;  1E5F A;  5AX8 A;  3BCA A;  3WGC A;  4EFF A;  2HOX A;  4I8A A;  4WYE A;  3NYS A;  4R5F A;  1D7V A;  1ZC9 A;  4WXF A;  1BW0 A;  1M32 A;  2G6W A;  2R5C B;  1X28 A;  3GET A;  4PFF A;  4K2M A;  2VGV A;  4AZK A;  2R0T A;  1IX6 A;  5E4Z A;  1Z3Z A;  2D5Y A;  2W7K A;  1V2F A;  1S09 A;  3EI5 A;  1KL2 A;  1TPL A;  4Q75 A;  2QA3 A;  3MAD A;  4B9B A;  2BI5 A;  1GC4 A;  2HOR A;  2VGS A;  3DR7 A;  3FVU A;  3KE3 A;  3BWN C;  2BI2 A;  2YOB A;  3LVM A;  2HUI A;  3QPG A;  2W7F A;  1FG3 A;  4WYF A;  1LC7 A;  2D61 A;  2VMR A;  2GB3 A;  1SFF A;  3BCX A;  3E2Z B;  4MQP A;  4MY5 A;  3EZS A;  4KXK A;  2QMA A;  4GEB A;  3R9A A;  5E3K A;  3BC8 A;  4PFN A;  3MC6 C;  1ASE A;  3AEJ A;  3AEP A;  1ASB A;  5EIG A;  4F5J A;  4ZM3 A;  4K2I A;  2VMP A;  2WK9 A;  3K7Y A;  5DX5 A;  4UQV A;  1CZE A;  3PDX A;  3F6T A;  4J5U A;  4WBT A;  3NNK A;  1W3U A;  1WYU A;  2CFB A;  4DQ6 A;  4IXO A;  3NX3 A;  4ADD A;  1AMQ A;  5JAY A;  5F9S A;  5C6U A;  3MBB A;  2CIN A;  3B1E A;  2WK8 A;  5FT4 A;  2V1P A;  2VIA A;  4AO9 A;  5EUE A;  3R4T A;  4GE7 A;  4ATQ A;  7AAT A;  1AJS B;  3VOM A;  2GMU A;  1AX4 A;  3G8M A;  1C9C A;  1G7W A;  1TOG A;  2OGE A;  5EUD A;  2CTZ A;  4ADE A;  3ZRR A;  4WP0 A;  3FTB A;  2ORD A;  2XH1 A;  2Z1Z A;  2FNI A;  2X8U A;  2EZ1 A;  1IAX A;  2JGT A;  5EUN A;  4M2K A;  1YJS A;  1AHF A;  5M4D A;  1AIB A;  3AEM A;  3E6G A;  2AY5 A;  1M6S A;  4W1W A;  3QI6 A;  4IYO B;  4U1T A;  4BA5 A;  1O4S A;  4ZDO A;  2X5F A;  3GZC A;  1IAY A;  3NU7 A;  1EQB A;  3DRD A;  4WLH A;  2VGZ A;  5G4I A;  2AY4 A;  4ADC A;  1SZU A;  3E2Y A;  2FM1 A;  4CXR A;  1YAA A;  3DC1 A;  1KMK A;  2BIE A;  4XJL A;  3L44 A;  1MDO A;  2ZY3 A;  4F5M A;  2V0Y A;  4W1V A;  1ZOD A;  1BS0 A;  1DGD A;  3KGW A;  2ZSM A;  2RFV A;  2E7J A;  3E77 A;  1LK9 A;  5TF5 A;  1S08 A;  1U08 A;  4QGR A;  3HMU A;  2DR1 A;  1AAW A;  2VMV A;  3ISL A;  1WYV B;  3GBX A;  5G2P A;  1H0C A;  1ARH A;  3LY1 A;  4F5K A;  4GDY A;  4ITG A;  2OAT A;  3LVK A;  4ZDP A;  1TOE A;  1V2E A;  3ASB A;  2D7Y A;  2Z61 A;  4ZAH A;  1VEF A;  4IY7 A;  3A9Y A;  3QBO A;  1CQ7 A;  3WKR A;  1ARG A;  4W8I A;  3EI8 A;  4TN4 A;  2QB2 A;  2W7M A;  4EB7 A;  1GDE A;  2BI1 A;  4A6T A;  1CQ6 A;  1LKC A;  2QBT A;  4HVK A;  1QIR A;  2DKJ A;  3IHJ A;  2BYL A;  2VMZ A;  4ISY A;  4IX8 A;  3RBL A;  4PIW A;  2YHK A;  1M0Q A;  3FSL A;  4OC9 A;  1TAT A;  4Q76 A;  2BHX A;  1AIA A;  3JTX A;  2CJD A;  3PD6 A;  4AO4 A;  3AEN A;  1GCK A;  1MAQ A;  4AZJ A;  2BKW A;  3FQ7 A;  4R2N A;  2WKA A;  1GEY A;  4ATP A;  3GZD C;  1I29 A;  5D5S A;  1AMR A;  2EPJ A;  2VMU A;  3P6K A;  1SVV A;  4A0G A;  1GBN A;  3K28 A;  4Q6R A;  1AHG A;  1AKB A;  2E7U A;  1VJO A;  3N75 A;  4LW4 A;  1QGN A;  4N0W A;  4ZAS A;  3RCH B;  1AHE A;  3ELE A;  1ELQ A;  3FFH A;  2ZY4 A;  3B1C A;  2AY7 A;  1CL1 A;  2ZP7 A;  3EI7 A;  2VI9 A;  4L0O A;  2BIG A;  4OMA A;  4OTL A;  1IX7 A;  1UU2 A;  1SZK A;  2BYJ A;  2VMW A;  4MKK A;  1ARS A;  5G2Q A;  3QN6 A;  1T3I A;  4A0F A;  2ZUK A;  3TFU A;  3VK4 A;  2VMX A;  4ZSW A;  4E1O A;  4R5Z A;  1B9H A;  2Z9V A;  1S0A A;  3NUB A;  1M4N A;  2W8V A;  1VP4 A;  4A0H A;  4BMK A;  2W7D A;  1PFF A;  3COG A;  2R5C A;  4R8D A;  4WYC A;  1Y4I A;  2QLR A;  3TCM A;  2VMY A;  1PG8 A;  1QZ9 A;  1GC2 A;  4BQ0 A;  5J8Q A;  2AY9 A;  5EFS A;  1UU0 A;  1CZC A;  3EI9 A;  5D95 A;  3AEJ C;  1DKA A;  3BWN A;  1AY4 A;  1B9I A;  1RV3 A;  1S06 A;  4GE9 A;  2AY8 A;  3CQ6 A;  5F8V A;  4F5F A;  5G09 A;  2VGW A;  1ECX A;  4WYG A;  4HF8 A;  1B8G A;  1IUG A;  2D66 A;  2YCT A;  1TAS A;  3E2Z A;  4OYT A;  3JWA A;  2VI8 A;  3MC6 A;  3VK3 A;  1WYT B;  3II0 A;  1N2T A;  3EI6 A;  2ZY2 A;  3H7F A;  5M46 A;  4KYO A;  3PA9 A;  1ASN A;  1RVY A;  2VMQ A;  3A9X A;  3I4J A;  1TOK A;  1MLZ A;  4LNM A;  3FVS A;  3DU4 A;  4UHM A;  1N8P A;  4ADB A;  1O61 A;  2W7I A;  1YNU A;  2YKX A;  1JS3 A;  1SF2 A;  2EO5 A;  3FRK A;  3WZF A;  1AAM A;  3LWS A;  1AKC A;  1DGE A;  3F0H A;  1RV4 A;  2OQX A;  3ZZK A;  3FFR A;  3FQA A;  4XJP A;  2GQN A;  1ASF A;  1H1C A;  2JJE A;  1IX8 A;  2VLH A;  4XAU A;  1FG7 A;  5HXX A;  2CH2 A;  2R2N A;  4P3M A;  4TMR A;  3JW9 A;  5I92 A;  1GEW A;  3AEM C;  3B8X A;  3ACZ A;  4GSA A;  1AY8 A;  3NYT A;  2YKV A;  1AY5 A;  1LW4 A;  2YKU A;  5FT5 A;  2YCP A;  4LNJ A;  2BIA A;  1AJS A;  3MAF B;  3PDB B;  2FN6 A;  1XI9 A;  2BI9 A;  3VAX A;  1X2A A;  2FYF A;  2Q7W A;  2HP1 A;  3NU8 A;  1GC3 A;  2E54 A;  4W1X A;  3RUY A;  4XJM A;  2YRR A;  5EAA A;  2FQ6 A;  4ZWV A;  4LW2 A;  3QGU A;  4F5H A;  4XK1 A;  3BN1 A;  2W8W A;  1BJO B;  1AIC A;  2CJG A;  2XBN A;  1ASD A;  2C7T A;  4IYO A;  4E3Q A;  1YOO A;  1LS3 A;  1UKJ A;  2O1B A;  2EH6 A;  2HOZ A;  3AV7 A;  3A8U X;  1M0P A;  2O0R A;  1MAP A;  3QM2 A;  4JF1 A;  4A6U A;  4WYA A;  3CQ4 A;  4UOY A;  3NDN A;  3EIA A;  1MDX A;  4IXS A;  2O7C A;  2CH1 A;  1OXP A;  1OXO A;  1ORD A;  1RVU A;  3LVJ A;  2BI3 A;  2BWN A;  4XQ2 A;  1DJ9 A;  3CBF A;  1JF9 A;  1KL1 A;  4MSO A;  4RJY A;  3B1D A;  2ZC0 A;  1MDZ A;  3DYD A;  1AMS A;  4KAM A;  1DTY A;  1WYV A;  1ASA A;  1OHY A;  3DZZ A;  3NRA A;  1ASL A;  1I48 A;  1WKH A;  1BQA A;  2VIB A;  4U2H A;  2ZYJ A;  3DXW A;  2PB2 A;  3MAU A;  3PIU A;  9AAT A;  4F5I A;  3HLM A;  3WX9 A;  4WXG A;  4ZSY A;  1MGV A;  1JG8 A;  1TOJ A;  3VK2 A;  4P7Y A;  1DJU A;  4WB0 B;  3Q8N A;  5FT8 A;  2JG2 A;  1QIS A;  5E5I A;  3GR9 A;  4H51 A;  4EMY A;  1D2F A;  3NUI A;  3E9K A;  4W5K A;  1ART A;  2CST A;  1JS6 A;  2CB1 A;  2Z9W A;  3MEB A;  4ITX A;  2NMP A;  2Z1Y A;  5M4B A;  1AHY A;  1G4X A;  1SPA A;  3AEL A;  3A9Z A;  4O6Z A;  4PVF A;  4ZWM A;  1AHX A;  3BS8 A;  3RQ1 A;  4JEW A;  3EUC A;  3GZD A;  1ASC A;  1BJW A;  2C44 A;  2VMT A;  1C4K A;  1CQ8 A;  1AKA A;  3T32 A;  4F4E A;  1LC5 A;  4UHN A;  5IWQ A;  4WXB A;  4M2J A;  4RKC A;  4Y0I A;  5EQC A;  1QJ5 A;  3WKS A;  1W7M A;  3TQX A;  4F5G A;  2W7G A;  3TFT A;  3FDD A;  1LW5 A;  3HQT A;  2VLF A;  3RI6 A;  1MLY A;  1B5P A;  5EAV A;  4ZDL A;  1V2D A;  2CAN A;  3B46 A;  1Z7D A;  4XEW A;  3RCH A;  3BWO A;  3N5M A;  4ZLV A;  3PGY A;  3NTJ A;  1M0N A;  5EIG B;  5DJ1 A;  4E3R A;  2JJF A;  2C81 A;  4WYD A;  1KKJ A;  4AH3 A;  3ELP A;  3ECD A;  4Q31 A;  2W7H A;  1WST A; 
#chains in the Genus database with same CATH topology
 3QHX A;  1BJ4 A;  4OT8 A;  1BQD A;  4YM6 B;  3DR4 A;  1ZLA B;  1C7N A;  3AYW C;  4AOA A;  1ASM A;  4H9Q B;  3AOV A;  2Y2O A;  5E5A C;  3GWP A;  3BCB A;  5BJ4 A;  2D63 A;  1OHV A;  4A6R A;  2D65 A;  1IVR A;  2PYO A;  4K2B A;  3W96 A;  3X1V A;  3G0T A;  4LD9 B;  4Y0H A;  3AN2 C;  1B4X A;  3AZG D;  2PYO D;  4H9O B;  1WYT A;  3MNN B;  2ZY5 A;  3W96 D;  3BB8 A;  1DJE A;  4JEY A;  3K40 A;  3MKJ A;  1ASG A;  4NOG A;  3WTP B;  1W7L A;  4J8X C;  5B40 A;  4E44 A;  1EG5 A;  2VMN A;  4H63 Q;  1W23 A;  4CAY B;  3OKS A;  3KKI A;  2CV5 B;  2Z9X A;  4BA4 A;  3WLX A;  5M49 A;  5C3I B;  1YIY A;  1QJ3 A;  4EU1 A;  1A7W A;  1WKG A;  4A72 A;  3MNN A;  3AZN A;  2ARO A;  3UTA B;  1LC8 A;  3W98 B;  4DQY B;  1HQ3 B;  3MNN D;  2E7I A;  1KX4 C;  1M18 A;  2X3L A;  3F9T A;  3LJA B;  3HBX A;  4F5L A;  3LG0 A;  1I43 A;  3EZ1 A;  2VGU A;  2W8T A;  3ZRQ A;  1EJI A;  1GEX A;  1TAR A;  3AEN B;  4Y0D A;  2QB3 A;  5B24 C;  2AY2 A;  3JZL A;  4JF0 A;  3W98 A;  1YIZ A;  5B32 C;  4KHA A;  1M1A B;  3UTA D;  2EYQ A;  3W98 D;  1HQ3 D;  3LV2 A;  3EIB A;  1B5O A;  1O69 A;  3MGR B;  5AV9 C;  3RBF A;  3FCR A;  1TOI A;  2NZD C;  4JEV A;  4EO5 C;  3LJA D;  4J8W A;  1BJN A;  3AV1 A;  4M2M A;  3KXB C;  1KX3 A;  4QLC B;  4XUJ C;  4WB0 A;  3AV1 D;  3A1K A;  2XD5 A;  2YFW A;  4I8A A;  1BW0 A;  3X1U B;  3REJ A;  4ZUX B;  1Z3Z A;  5E4Z A;  4Z2M H;  1ID3 B;  2W7K A;  2IO5 C;  1KL2 A;  1P3A A;  3WCO A;  4Q75 A;  3MAD A;  2HOR A;  1GC4 A;  4H9N B;  3MGR D;  3REJ D;  3FVU A;  3KE3 A;  3QPG A;  2BI2 A;  2YOB A;  2HUI A;  3C1B A;  4WYF A;  2D61 A;  5E3K A;  5E5A B;  3UT9 A;  4PFN A;  3MC6 C;  3C1B D;  2VQR A;  3AZM C;  5EIG A;  5B0Y B;  4K2I A;  2WK9 A;  3K7Y A;  3R45 B;  4XZQ C;  4ZUX D;  4Z5T C;  3AN2 B;  5JRG C;  1ID3 D;  3AYW A;  1WYU A;  1AMQ A;  5F9S A;  3MBB A;  2CIN A;  4J8V A;  4H9R B;  5AV6 A;  2DGK A;  3AYW D;  7AAT A;  3VOM A;  5E5A D;  2Y2H A;  3FTB A;  2EZ1 A;  4M2K A;  1YJS A;  5DNN C;  4AWL C;  1EQZ C;  1Q9C A;  4IYO B;  4BA5 A;  4R8P B;  3FD0 A;  3AN2 D;  1O4S A;  3GZC A;  4J8X A;  1EQB A;  4WLH A;  5G4I A;  1KX4 B;  2FM1 A;  2V0Y A;  4J8X D;  3W97 C;  3W99 A;  1DGD A;  3KGW A;  2F8N G;  2RFV A;  5TF5 A;  4QGR A;  3HMU A;  1AAW A;  4J8U A;  2RIQ A;  5B24 B;  4ZDP A;  5F99 B;  3ASB A;  2D7Y A;  2Z61 A;  2JCH A;  5B32 B;  3WKR A;  4J8U D;  1P34 C;  3EI8 A;  4TN4 A;  1KX4 D;  5AV9 B;  2BI1 A;  2BYK A;  4HVK A;  4EO5 B;  1QIR A;  2BYL A;  3MVD A;  3KXB B;  3JTX A;  3H0R C;  1GCK A;  2G5I C;  2WKA A;  5B33 C;  3MVD D;  4WU9 C;  5B24 D;  5B32 D;  1AHG A;  2E7U A;  1VJO A;  2NZD A;  4ZAS A;  3RCH B;  2IO5 B;  1AHE A;  1ELQ A;  2ZY4 A;  2VI9 A;  2BIG A;  2WB6 A;  1BH9 B;  5AV9 D;  2NZD D;  4XUJ A;  1T3I A;  4A0F A;  5B32 G;  2Z9V A;  1P3F C;  3KXB D;  1PMO A;  4XUJ D;  1VP4 A;  3AZL C;  3AZM B;  3COG A;  4WYC A;  1Y4I A;  1PG8 A;  5AVB C;  5J8Q A;  5JRG B;  2FFF B;  1P3P C;  1RV3 A;  4GE9 A;  1ECX A;  2D66 A;  1IUG A;  1AOI C;  3JWA A;  3MC6 A;  1N2T A;  4X23 A;  1RVY A;  4XZQ A;  3DU4 A;  4Z5T A;  3AZM D;  1YNU A;  1JS3 A;  3LWS A;  1EQZ B;  1AKC A;  3P5J B;  3ZZK A;  4XJP A;  4XZQ D;  1H1C A;  4Z5T D;  5JRG D;  4TMR A;  3JW9 A;  3B8X A;  1AY8 A;  2YKV A;  1LW4 A;  2YKU A;  5FT5 A;  4LNJ A;  2BIA A;  2Y2Q A;  4JJN C;  2HP1 A;  1H3O A;  5DNN A;  4XJM A;  4ZWV A;  1P3G C;  4Z66 C;  1TAF A;  2C7T A;  3A6N C;  5DNN D;  1YOO A;  3EPK A;  4RIT A;  2EH6 A;  3AZF C;  1M0P A;  2O0R A;  4JF1 A;  2NQB C;  5CP6 A;  5BT1 D;  4A6U A;  3W97 A;  4UOY A;  4IXS A;  2O7C A;  3H0L C;  5AY8 C;  3W97 D;  4KAM A;  1ASA A;  3NRA A;  1WKH A;  3MAU A;  1P34 A;  4WU9 B;  4WXG A;  4P7Y A;  1DJU A;  5FT8 A;  2JG2 A;  1QIS A;  1P34 D;  5B31 A;  1D2F A;  4W5K A;  2CST A;  2Z1Y A;  4WZS B;  5B31 D;  3BS8 A;  5B33 A;  1BJW A;  5AVC C;  1P3F B;  3LZ1 C;  1C4K A;  3T32 A;  3WKS A;  4Y0I A;  3TQX A;  4F5G A;  5B1M A;  5B33 D;  5CPK A;  1KU5 A;  1LW5 A;  1KAF A;  1V2D A;  3B46 A;  1M0N A;  1P3P B;  3AZJ C;  4WYD A;  3VP6 A;  4CSR A;  1SZS A;  2D64 A;  3W1J A;  1F1E A;  4NE6 A;  3AZL A;  3GSB A;  2CY8 A;  2HUE B;  1C7O A;  1P3F D;  1BT4 A;  3N7N A;  4YM6 C;  5AVB A;  1M0O A;  2GSA A;  2HZP A;  3H9X A;  3AZL D;  1ZLA C;  3N4S A;  2W8J A;  2BWP A;  5AVB D;  3A2B A;  3MGP C;  2AY3 A;  3REH A;  1X0M A;  1AOI A;  1GD9 A;  3O62 A;  5HDM A;  1P3P D;  3FQ8 A;  3USF A;  5DB5 A;  3MGQ A;  4LD9 C;  2HP2 A;  4ZM4 A;  4JEX A;  1AOI D;  4LNL A;  5BNV B;  4JJN B;  4CBR A;  1J32 A;  4DBC A;  1IJI A;  3MGS A;  1X29 A;  1R4V A;  1O62 A;  1V72 A;  3I5T A;  3AAT A;  1P3G B;  3TAT A;  5DJ9 A;  2CV5 C;  3A6N B;  3B6G B;  3MGS D;  5KDM A;  5C3I C;  3LZ0 C;  3HL2 A;  3PAA A;  3FVX A;  5G0A A;  2NQB B;  2D7Z A;  3AOW A;  4WNN A;  2FNU A;  3PDB A;  1QIT A;  1KMJ A;  3N0L A;  3VH6 W;  2YFV B;  4W91 A;  5AY8 B;  4JJN D;  4Z66 A;  1G7X A;  5BJ3 A;  2YCN A;  1W7N A;  3ZZJ A;  3AZF A;  4Z66 D;  1E5E A;  3CQ5 A;  2YKY A;  3A6N D;  3WA9 A;  1D7U A;  2VMS A;  5CHL B;  4WU8 A;  3AZF D;  3ASA A;  5JA4 B;  2NQB D;  2BWO A;  3HDO A;  2JE5 A;  1P3B C;  3FKD A;  3L8A A;  3WY7 A;  4CBS A;  1M1A C;  4XJO A;  2BYM B;  1YJZ A;  3D6K A;  5AY8 D;  5AVC B;  1T3U A;  2VYC A;  1YJY A;  1IBJ A;  1E5F A;  5AX8 A;  4QLC C;  1D7V A;  2Y2I A;  1JFI B;  1ZC9 A;  1M32 A;  2FJ7 A;  1V2F A;  1S09 A;  5B1L A;  3EI5 A;  3LZ1 A;  3AZI B;  3X1U C;  4RM1 A;  2BI5 A;  2VGS A;  4UPK A;  3DR7 A;  3LVM A;  5B1L D;  3LZ1 D;  3WKJ A;  3E2Z B;  3BCX A;  4MQP A;  3AV2 C;  2QMA A;  4GEB A;  3AZJ A;  4H9P B;  3WKJ D;  3MGP B;  3AEP A;  1ASB A;  1P3O C;  3AZG A;  1CZE A;  3AZJ D;  5B0Y C;  3PDX A;  4WBT A;  4J5U A;  2CFB A;  3AZH C;  4YM6 A;  5JAY A;  5G49 B;  1ZLA A;  5FT4 A;  2WK8 A;  2V1P A;  2VIA A;  4AO9 A;  3AZE B;  3R4T A;  4ATQ A;  4H9Q A;  1AJS B;  4YM6 D;  3G8M A;  1ZLA D;  4K05 A;  5EUD A;  4ADE A;  2Z1Z A;  2X8U A;  3LZ0 B;  1IAX A;  2JGT A;  4LD9 A;  2QSR A;  3AEM A;  2AY5 A;  1M6S A;  3W1I A;  3QI6 A;  4H9O A;  1WWS A;  1TZY C;  4LD9 D;  3NU7 A;  4R8P C;  3WTP A;  4ADC A;  1SZU A;  4XJL A;  1KMK A;  2BIE A;  4CAY A;  2CV5 A;  4W1V A;  3WTP D;  3AFA C;  2E7J A;  3E77 A;  1LK9 A;  1S08 A;  2CV5 D;  3LY1 A;  3LZ0 D;  4GDY A;  4ITG A;  2JIS A;  3LVK A;  1TOE A;  1VEF A;  3UTA A;  4E45 A;  3QBO A;  5F99 C;  1HQ3 A;  2DGM A;  1P3B B;  1ARG A;  4W8I A;  3WAA B;  3LJA A;  4OBU A;  4A6T A;  4YS3 B;  2QBT A;  2DKJ A;  2VMZ A;  3RBL A;  1M19 B;  5BNX B;  5FUG B;  2YHK A;  1TAT A;  4UUZ B;  3AEN A;  1S32 C;  3FQ7 A;  1P3M C;  1GEY A;  1I29 A;  5D5S A;  1AMR A;  2VMU A;  3REI B;  4NE5 A;  1M1A A;  5AV5 B;  1GBN A;  2F8N H;  1AKB A;  1P3B D;  3ELE A;  3FFH A;  3MGR A;  2AY7 A;  1M1A D;  4H9S A;  1SZK A;  4MKK A;  1ARS A;  4QLC A;  1B67 A;  3AV2 B;  2Y2G A;  4A0H A;  3TCM A;  4QLC D;  3X1U A;  2VMY A;  1P3O B;  4ZUX A;  1ID3 A;  5EFS A;  5DNM B;  3AEJ C;  5CPI B;  1DKA A;  3X1U D;  2F8N B;  4H9N A;  3AZH B;  5F8V A;  2VGW A;  4WYG A;  4HF8 A;  2G5H C;  2YCT A;  4OYT A;  3VK3 A;  3II0 A;  3EI6 A;  5E5A A;  2ZY2 A;  5M46 A;  3AV2 D;  3VH6 T;  2VMQ A;  3A9X A;  3I4J A;  4ADB A;  1N8P A;  5B0Y A;  1O61 A;  3R45 A;  2YKX A;  2EO5 A;  1P3O D;  3AZH A;  3B0B A;  3AN2 A;  1IX8 A;  1TZY B;  1FG7 A;  5B0Y D;  2R2N A;  2F8N D;  1GEW A;  2RVQ C;  3AZH D;  4H9R A;  5B2J B;  3B6F B;  1AY5 A;  2YCP A;  3MAF B;  2FN6 A;  1XI9 A;  2BI9 A;  3HT4 A;  3VAX A;  1X2A A;  3AFA B;  4LW2 A;  1KX5 C;  3X1T C;  2W8W A;  1BJO B;  2CJG A;  4IYO A;  3EG5 B;  4R8P A;  2HOZ A;  3AV7 A;  1KX4 A;  3VH6 A;  4R8P D;  3AFA A;  3NDN A;  1F66 B;  4KUD B;  2CH1 A;  3EPH A;  4XQ2 A;  1DJ9 A;  3CBF A;  1JF9 A;  4MSO A;  3B1D A;  2ZC0 A;  3DYD A;  3AFA D;  1DTY A;  3V9R B;  5B2I C;  1OHY A;  1S32 B;  2VIB A;  5B24 A;  1P3K C;  1P3M B;  5F99 A;  3DXW A;  2PB2 A;  5B32 A;  3B0C W;  1TOJ A;  4H51 A;  2HIO C;  5F99 D;  2Z9W A;  1JS6 A;  5AV9 A;  3MEB A;  2NMP A;  1U35 B;  1G4X A;  3A9Z A;  4PVF A;  3KXB A;  5GT3 B;  3EUC A;  2G7J A;  1AKA A;  3C1C B;  1LC5 A;  4RKC A;  1S32 D;  1W7M A;  1P3M D;  1N1J B;  4ZDL A;  3RCH A;  4ZLV A;  1P3L C;  5DJ1 A;  1BH9 A;  3REL C;  5AV8 C;  3KUY C;  1P3I C;  3HVY A;  2Z20 A;  4M6B A;  2UWX A;  2W8S A;  2HUE C;  3AZK C;  3AZM A;  3WTP E;  2HUU A;  3LEL B;  1BH8 B;  3OP7 A;  4NFT A;  3GJU A;  1D7R A;  5JRG A;  5HHY A;  4WLJ A;  1PMM A;  3NQU B;  4KGC C;  3I16 A;  1N31 A;  3NYU A;  2AAT A;  2JJG A;  3N4X A;  2VMO A;  1FC4 A;  4CVQ A;  3CAI A;  3PPL A;  4IW7 A;  1KX5 B;  2R5E A;  3X1T B;  1EQZ A;  4E77 A;  1D7S A;  5GXQ C;  2OGA A;  3P1T A;  3B6G C;  2AY6 A;  1EQZ D;  2RVQ D;  5BO0 B;  3KWQ C;  2EGY A;  1ARI A;  1KKP A;  1CL2 A;  3W1H A;  4WD2 A;  5GT0 C;  5B2I B;  2W7E A;  3EPL A;  2VGT A;  2HOY A;  1P3K B;  3X1T D;  2WK7 A;  3PD6 B;  4RKD A;  1ULY A;  5KTB A;  2W7J A;  2HIO B;  4FFC A;  5GSU C;  2ZJG A;  3G7Q A;  2CJH A;  2AY1 A;  1CS1 A;  4DGT A;  4RAE A;  1AJR A;  3E2F A;  2AEU A;  1I41 A;  1WWI A;  4LC3 A;  1UU1 A;  3IP4 C;  5B2I D;  3ZRP A;  2PB0 A;  4WU9 A;  1P3K D;  3DXV A;  2GMS A;  5CPJ C;  2HOX A;  4WU9 D;  4WXF A;  2HIO D;  2G6W A;  2R5C B;  1X28 A;  1P3L B;  2VGV A;  4AZK A;  2R0T A;  3REL B;  1IX6 A;  5AV8 B;  3KUY B;  1P3I B;  4ZBJ C;  3NQJ B;  1P3F A;  3AZI C;  3A1I A;  1FG3 A;  1LC7 A;  2VMR A;  4MY5 A;  1SFF A;  3AZK B;  4KXK A;  3R9A A;  2LY8 A;  4DRB A;  1P3P A;  2A1V A;  4F5J A;  4ZM3 A;  3KFU G;  5DX5 A;  3REL D;  4KGC B;  4UQV A;  3KUY D;  2PYO C;  1P3I D;  3NNK A;  1W3U A;  3W96 C;  3X1V C;  3NX3 A;  4HGA C;  2GMU A;  4DRA A;  1C9C A;  1G7W A;  3AZE C;  1TOG A;  2OGE A;  2CTZ A;  4WP0 A;  5B40 C;  2ORD A;  5GXQ B;  1AIB A;  4W1W A;  3UTB B;  2X5F A;  3KWQ B;  3B0C T;  5BNV A;  4JJN A;  2VGZ A;  3AZN C;  2ARO C;  2AY4 A;  3E2Y A;  5GT0 B;  3N4R A;  2ZY3 A;  4F5M A;  1P3G A;  1BS0 A;  1M18 C;  3A6N A;  3B6G A;  1BFM A;  2DR1 A;  3ISL A;  1WYV B;  3GBX A;  5G2P A;  1ARH A;  1H0C A;  1P3G D;  2NQB A;  5GXQ D;  5GSU B;  3B6G D;  4NE3 A;  4ZAH A;  4IY7 A;  3A9Y A;  2YFV A;  2Y2M A;  3KWQ D;  4EB7 A;  5AY8 A;  1GDE A;  5B0Z B;  3WAA C;  3IHJ A;  2DGL A;  4ISY A;  4YS3 C;  1M0Q A;  2BG1 A;  1M19 C;  4J8W C;  1MAQ A;  2BKW A;  5CPJ B;  3X1S B;  3GZD C;  5JA4 A;  2EPJ A;  4WJ3 C;  1KX3 C;  3P6K A;  4A0G A;  3K28 A;  4Q6R A;  3REK B;  2Y2N A;  4LW4 A;  3REI C;  1QGN A;  5AV5 C;  4ZBJ B;  2BYM A;  4OTL A;  5AVC A;  3FZ8 A;  2VMW A;  3QN6 A;  1P3A C;  3VK4 A;  2VMX A;  5AVC D;  1S0A A;  1M4N A;  3C1B C;  1JFI A;  4BMK A;  1PFF A;  2QLR A;  1QZ9 A;  1GC2 A;  4BQ0 A;  3UT9 C;  2AY9 A;  1UU0 A;  3VH5 W;  1CZC A;  3AZI A;  3EI9 A;  5D95 A;  2PYO B;  2J8P A;  1AY4 A;  3B0D C;  1S06 A;  5DNM C;  3W96 B;  3CQ6 A;  5CPI C;  3X1V B;  3AZI D;  4HGA B;  3E2Z A;  1WYT B;  3H7F A;  4KYO A;  3PA9 A;  1ASN A;  4H9P A;  4J8V C;  3MGP A;  5AV6 C;  5B40 B;  1MLZ A;  1TOK A;  3FVS A;  3FRK A;  3WZF A;  1AAM A;  1DGE A;  3F0H A;  1RV4 A;  2OQX A;  3MGP D;  1ASF A;  2VLH A;  4XAU A;  5HXX A;  5G49 A;  3ACZ A;  3X1V D;  3AZN B;  2ARO B;  3AZE A;  1AJS A;  1XEY A;  5B2J C;  3B6F C;  1M18 B;  2E54 A;  4W1X A;  3RUY A;  3AZE D;  2YRR A;  3LZ0 A;  5EAA A;  3QGU A;  5B40 D;  3BN1 A;  3W99 C;  1AIC A;  1ASD A;  4J8U C;  3A8U X;  1MAP A;  3QM2 A;  2Y2P A;  3CQ4 A;  3AZN D;  2ARO D;  2AEV A;  4KHA B;  1MDX A;  1OXP A;  1ORD A;  4G92 B;  1F66 C;  4KUD C;  1KL1 A;  4RJY A;  1MDZ A;  3KSY A;  1M18 D;  4J8W B;  3AV1 B;  1BQA A;  3MVD C;  9AAT A;  4F5I A;  3WX9 A;  1KX3 B;  1JG8 A;  3VK2 A;  4WB0 B;  1P3B A;  3Q8N A;  5E5I A;  2YFW B;  3WAA A;  3E9K A;  4YS3 A;  5M4B A;  3REJ B;  1M19 A;  2KFP A;  5BNX A;  2ZM5 A;  3WAA D;  5FUG A;  4ZWM A;  1U35 C;  1P3A B;  4UUZ A;  3GZD A;  4YS3 D;  1ASC A;  4F4E A;  2VMT A;  1CQ8 A;  1M19 D;  5GT3 C;  4WXB A;  4M2J A;  5EQC A;  4J8W D;  4RJ0 A;  1QJ5 A;  3C1B B;  3REI A;  3C1C C;  3FDD A;  5AV5 A;  2OKK A;  3RI6 A;  1MLY A;  1KX3 D;  5EAV A;  2DQN C;  3UT9 B;  1Z7D A;  3N5M A;  3REI D;  3PGY A;  2Y2L A;  3NTJ A;  3B0D B;  5AV5 D;  5EIG B;  4E3R A;  5BS7 C;  4AH3 A;  3ELP A;  3ECD A;  4Q31 A;  3FZ7 A;  2W7H A;  1WST A;  4RLG A;  3UWC A;  1ZOB A;  1AMA A;  2YRI A;  3AYW B;  3AV2 A;  1P3A D;  1WYU B;  2EZ2 A;  1OHW A;  1M7Y A;  4J8V B;  5AV6 B;  4GRX A;  1P3O A;  2ZSL A;  4X23 C;  4IXZ A;  1HTA A;  2Y2J A;  5DNM A;  3LEL C;  4MQQ A;  5CPI A;  3UT9 D;  2JJH A;  4A0R A;  2F8N A;  4UHO A;  3PJ0 A;  4EB5 A;  5DNM D;  5CPI D;  3UAK A;  3JWB A;  4J8X B;  1CJ0 A;  3AEO A;  1Z2C B;  1DFO A;  4J8V D;  4A00 A;  5AV6 D;  3W99 B;  3M5U A;  1P3W A;  1TZY A;  4CXQ A;  4J8U B;  5FT6 A;  5BT1 C;  5B2J A;  3B6F A;  3AL0 C;  2W7L A;  4B98 A;  1TZY D;  3MAF A;  2Z9U A;  2HUF A;  1GC0 A;  2DKB A;  5CP6 C;  1OAT A;  3DOD A;  2CWE A;  3BV0 A;  8AAT A;  5B2J D;  3B6F D;  1G4V A;  2W8U A;  2BYK B;  3FZ6 A;  1W2E A;  1BJO A;  2F8J A;  3TU4 C;  3MVD B;  4Z2M G;  3KGX A;  1ELU A;  3W99 D;  2X5D A;  1C7G A;  4JEZ A;  2TPL A;  3ATH A;  3UE8 A;  3LVL B;  4MQR A;  1F66 A;  4KUD A;  1J04 A;  3FDB A;  4FL0 A;  2C0R A;  5G4J A;  2NZD B;  2DOU A;  4MKJ A;  5B31 C;  3VH5 T;  3WGB A;  1C0N A;  1F66 D;  3V9R A;  4KUD D;  4OCA A;  4BHD A;  1S32 A;  1BKG A;  4GE4 A;  1P3M A;  4XUJ B;  1S07 A;  5K8B A;  2PO3 A;  3BCA A;  3WGC A;  4EFF A;  4WYE A;  3NYS A;  4R5F A;  5B1M C;  5CPK C;  3GET A;  4PFF A;  1U35 A;  4K2M A;  2D5Y A;  5GT3 A;  1TPL A;  2QA3 A;  1U35 D;  4B9B A;  3C1C A;  3BWN C;  2W7F A;  4WV4 B;  5GT3 D;  2GB3 A;  3EZS A;  3C1C D;  2F2A C;  3BC8 A;  4X23 B;  1N1J A;  1B6W A;  1ASE A;  5BS7 A;  3AEJ A;  3VH5 A;  4XZQ B;  4Z5T B;  2VMP A;  3F6T A;  4DQ6 A;  3REH C;  4IXO A;  4ADD A;  4RIZ A;  3O62 C;  5C6U A;  3B1E A;  3MGQ C;  5EUE A;  4GE7 A;  3LEL A;  1BH8 A;  1AX4 A;  1H3O B;  4X23 D;  3ZRR A;  5DNN B;  3MGS C;  2XH1 A;  4AWL B;  2FNI A;  3LEL D;  5EUN A;  2XD1 A;  1AHF A;  5M4D A;  3NQU A;  2DF4 C;  3E6G A;  1TAF B;  4U1T A;  4ZDO A;  1IAY A;  3H0M C;  3DRD A;  3UTB C;  5CP6 B;  4CXR A;  3W97 B;  1YAA A;  3DC1 A;  3L44 A;  1MDO A;  1KX5 A;  1ZOD A;  3X1T A;  2ZSM A;  3TU4 B;  1U08 A;  2VMV A;  4J8L A;  1KX5 D;  4F5K A;  2OAT A;  1V2E A;  1P34 B;  5BO0 A;  3WA9 C;  1CQ7 A;  4WU8 C;  2QB2 A;  2W7M A;  5B31 B;  5CP6 D;  5B2I A;  3TU4 A;  1CQ6 A;  1LKC A;  4IX8 A;  1P3K A;  5B0Z C;  3EPJ A;  4PIW A;  3FSL A;  4OC9 A;  4Q76 A;  2BHX A;  1AIA A;  2CJD A;  5B33 B;  3TU4 D;  3PD6 A;  4AO4 A;  4AZJ A;  4R2N A;  2HIO A;  4ATP A;  4G91 C;  5B1M B;  3X1S C;  5CPK B;  1SVV A;  3N75 A;  4N0W A;  3REK C;  3B1C A;  2ZP7 A;  1CL1 A;  3EI7 A;  4L0O A;  4OMA A;  2FJ7 C;  1IX7 A;  1UU2 A;  2BYJ A;  5B1L C;  5G2Q A;  4CSR B;  2ZUK A;  3TFU A;  4ZSW A;  4E1O A;  4R5Z A;  1B9H A;  3AZL B;  3NUB A;  2OKJ A;  2W8V A;  5AVB B;  5B31 G;  3WKJ C;  2W7D A;  2R5C A;  4R8D A;  1P3L A;  3REL A;  5B1M D;  5AV8 A;  5CPK D;  3KUY A;  1P3I A;  3BWN A;  3NQJ A;  1P3L D;  1B9I A;  2AY8 A;  5AV8 D;  4F5F A;  3REH B;  3AZG C;  1AOI B;  5G09 A;  3O62 B;  1B8G A;  1TAS A;  3MGQ B;  3AZK A;  2VI8 A;  2L5A A;  3AZK D;  4LNM A;  3MGS B;  4UHM A;  2W7I A;  2Y2K A;  1SF2 A;  4KGC A;  3FFR A;  3FQA A;  2GQN A;  2JJE A;  5KDM B;  2CH2 A;  4P3M A;  5I92 A;  4KGC D;  3AEM C;  4GSA A;  3REH D;  3NYT A;  3O62 D;  4WNN B;  3MNN C;  3PDB B;  3MGQ D;  3WTP C;  2FYF A;  2Q7W A;  3NU8 A;  1GC3 A;  4Z66 B;  2FQ6 A;  5GXQ A;  4F5H A;  4XK1 A;  2JSS A;  2XBN A;  3AZF B;  4E3Q A;  1LS3 A;  3UTB A;  1UKJ A;  2O1B A;  3KWQ A;  3WA9 B;  2F8N K;  4WU8 B;  4WYA A;  3UTB D;  3UTA C;  3EIA A;  5GT0 A;  3W98 C;  3LVJ A;  1OXO A;  1HQ3 C;  1RVU A;  2BI3 A;  2BWN A;  3LJA C;  4G92 C;  1AMS A;  5GT0 D;  1WYV A;  3DZZ A;  1ASL A;  1I48 A;  3WCN A;  4U2H A;  2ZYJ A;  5GSU A;  3PIU A;  3AV1 C;  3HLM A;  4G91 B;  4ZSY A;  1MGV A;  4EMY A;  3GR9 A;  3WA9 D;  5GSU D;  3NUI A;  1ART A;  2CB1 A;  4WU8 D;  5B0Z A;  4ITX A;  1AHY A;  1SPA A;  3AEL A;  2FJ7 B;  4O6Z A;  5B1L B;  3LZ1 B;  1AHX A;  3RQ1 A;  3MGR C;  3REJ C;  4JEW A;  5B0Z D;  2C44 A;  4H9S C;  2FKI A;  5CPJ A;  4UHN A;  5IWQ A;  3X1S A;  1PZR A;  2W7G A;  3WKJ B;  3TFT A;  3HQT A;  2VLF A;  3REK A;  5CPJ D;  1B5P A;  3X1S D;  2CAN A;  3AZJ B;  4XEW A;  3BWO A;  2JJF A;  3REK D;  4ZUX C;  2C81 A;  1ID3 C;  1KKJ A;  4OBV A;  3AZG B;  2FJ7 D; 
#chains in the Genus database with same CATH homology
 3QHX A;  1BJ4 A;  4OT8 A;  1BQD A;  4YM6 B;  3DR4 A;  1ZLA B;  1C7N A;  3AYW C;  4AOA A;  1ASM A;  4H9Q B;  3AOV A;  2Y2O A;  5E5A C;  3GWP A;  3BCB A;  5BJ4 A;  2D63 A;  1OHV A;  4A6R A;  2D65 A;  1IVR A;  2PYO A;  4K2B A;  3W96 A;  3X1V A;  3G0T A;  4LD9 B;  4Y0H A;  3AN2 C;  1B4X A;  3AZG D;  2PYO D;  4H9O B;  1WYT A;  3MNN B;  2ZY5 A;  3W96 D;  3BB8 A;  1DJE A;  4JEY A;  3K40 A;  3MKJ A;  1ASG A;  4NOG A;  3WTP B;  1W7L A;  4J8X C;  5B40 A;  4E44 A;  1EG5 A;  2VMN A;  4H63 Q;  1W23 A;  4CAY B;  3OKS A;  3KKI A;  2CV5 B;  2Z9X A;  4BA4 A;  3WLX A;  5M49 A;  5C3I B;  1YIY A;  1QJ3 A;  4EU1 A;  1A7W A;  1WKG A;  4A72 A;  3MNN A;  3AZN A;  2ARO A;  3UTA B;  1LC8 A;  3W98 B;  4DQY B;  1HQ3 B;  3MNN D;  2E7I A;  1KX4 C;  1M18 A;  2X3L A;  3F9T A;  3LJA B;  3HBX A;  4F5L A;  3LG0 A;  1I43 A;  3EZ1 A;  2VGU A;  2W8T A;  3ZRQ A;  1EJI A;  1GEX A;  1TAR A;  3AEN B;  4Y0D A;  2QB3 A;  5B24 C;  2AY2 A;  3JZL A;  4JF0 A;  3W98 A;  1YIZ A;  5B32 C;  4KHA A;  1M1A B;  3UTA D;  2EYQ A;  3W98 D;  1HQ3 D;  3LV2 A;  3EIB A;  1B5O A;  1O69 A;  3MGR B;  5AV9 C;  3RBF A;  3FCR A;  1TOI A;  2NZD C;  4JEV A;  4EO5 C;  3LJA D;  4J8W A;  1BJN A;  3AV1 A;  4M2M A;  3KXB C;  1KX3 A;  4QLC B;  4XUJ C;  4WB0 A;  3AV1 D;  3A1K A;  2XD5 A;  2YFW A;  4I8A A;  1BW0 A;  3X1U B;  3REJ A;  4ZUX B;  1Z3Z A;  5E4Z A;  4Z2M H;  1ID3 B;  2W7K A;  2IO5 C;  1KL2 A;  1P3A A;  3WCO A;  4Q75 A;  3MAD A;  2HOR A;  1GC4 A;  4H9N B;  3MGR D;  3REJ D;  3FVU A;  3KE3 A;  3QPG A;  2BI2 A;  2YOB A;  2HUI A;  3C1B A;  4WYF A;  2D61 A;  5E3K A;  5E5A B;  3UT9 A;  4PFN A;  3MC6 C;  3C1B D;  2VQR A;  3AZM C;  5EIG A;  5B0Y B;  4K2I A;  2WK9 A;  3K7Y A;  3R45 B;  4XZQ C;  4ZUX D;  4Z5T C;  3AN2 B;  5JRG C;  1ID3 D;  3AYW A;  1WYU A;  1AMQ A;  5F9S A;  3MBB A;  2CIN A;  4J8V A;  4H9R B;  5AV6 A;  2DGK A;  3AYW D;  7AAT A;  3VOM A;  5E5A D;  2Y2H A;  3FTB A;  2EZ1 A;  4M2K A;  1YJS A;  5DNN C;  4AWL C;  1EQZ C;  1Q9C A;  4IYO B;  4BA5 A;  4R8P B;  3FD0 A;  3AN2 D;  1O4S A;  3GZC A;  4J8X A;  1EQB A;  4WLH A;  5G4I A;  1KX4 B;  2FM1 A;  2V0Y A;  4J8X D;  3W97 C;  3W99 A;  1DGD A;  3KGW A;  2F8N G;  2RFV A;  5TF5 A;  4QGR A;  3HMU A;  1AAW A;  4J8U A;  2RIQ A;  5B24 B;  4ZDP A;  5F99 B;  3ASB A;  2D7Y A;  2Z61 A;  2JCH A;  5B32 B;  3WKR A;  4J8U D;  1P34 C;  3EI8 A;  4TN4 A;  1KX4 D;  5AV9 B;  2BI1 A;  2BYK A;  4HVK A;  4EO5 B;  1QIR A;  2BYL A;  3MVD A;  3KXB B;  3JTX A;  3H0R C;  1GCK A;  2G5I C;  2WKA A;  5B33 C;  3MVD D;  4WU9 C;  5B24 D;  5B32 D;  1AHG A;  2E7U A;  1VJO A;  2NZD A;  4ZAS A;  3RCH B;  2IO5 B;  1AHE A;  1ELQ A;  2ZY4 A;  2VI9 A;  2BIG A;  2WB6 A;  1BH9 B;  5AV9 D;  2NZD D;  4XUJ A;  1T3I A;  4A0F A;  5B32 G;  2Z9V A;  1P3F C;  3KXB D;  1PMO A;  4XUJ D;  1VP4 A;  3AZL C;  3AZM B;  3COG A;  4WYC A;  1Y4I A;  1PG8 A;  5AVB C;  5J8Q A;  5JRG B;  2FFF B;  1P3P C;  1RV3 A;  4GE9 A;  1ECX A;  2D66 A;  1IUG A;  1AOI C;  3JWA A;  3MC6 A;  1N2T A;  4X23 A;  1RVY A;  4XZQ A;  3DU4 A;  4Z5T A;  3AZM D;  1YNU A;  1JS3 A;  3LWS A;  1EQZ B;  1AKC A;  3P5J B;  3ZZK A;  4XJP A;  4XZQ D;  1H1C A;  4Z5T D;  5JRG D;  4TMR A;  3JW9 A;  3B8X A;  1AY8 A;  2YKV A;  1LW4 A;  2YKU A;  5FT5 A;  4LNJ A;  2BIA A;  2Y2Q A;  4JJN C;  2HP1 A;  1H3O A;  5DNN A;  4XJM A;  4ZWV A;  1P3G C;  4Z66 C;  1TAF A;  2C7T A;  3A6N C;  5DNN D;  1YOO A;  3EPK A;  4RIT A;  2EH6 A;  3AZF C;  1M0P A;  2O0R A;  4JF1 A;  2NQB C;  5CP6 A;  5BT1 D;  4A6U A;  3W97 A;  4UOY A;  4IXS A;  2O7C A;  3H0L C;  5AY8 C;  3W97 D;  4KAM A;  1ASA A;  3NRA A;  1WKH A;  3MAU A;  1P34 A;  4WU9 B;  4WXG A;  4P7Y A;  1DJU A;  5FT8 A;  2JG2 A;  1QIS A;  1P34 D;  5B31 A;  1D2F A;  4W5K A;  2CST A;  2Z1Y A;  4WZS B;  5B31 D;  3BS8 A;  5B33 A;  1BJW A;  5AVC C;  1P3F B;  3LZ1 C;  1C4K A;  3T32 A;  3WKS A;  4Y0I A;  3TQX A;  4F5G A;  5B1M A;  5B33 D;  5CPK A;  1KU5 A;  1LW5 A;  1V2D A;  3B46 A;  1M0N A;  1P3P B;  3AZJ C;  4WYD A;  3VP6 A;  4CSR A;  1SZS A;  2D64 A;  3W1J A;  1F1E A;  4NE6 A;  3AZL A;  3GSB A;  2CY8 A;  2HUE B;  1C7O A;  1P3F D;  1BT4 A;  3N7N A;  4YM6 C;  5AVB A;  1M0O A;  2GSA A;  2HZP A;  3H9X A;  3AZL D;  1ZLA C;  3N4S A;  2W8J A;  2BWP A;  5AVB D;  3A2B A;  3MGP C;  2AY3 A;  3REH A;  1X0M A;  1AOI A;  1GD9 A;  3O62 A;  5HDM A;  1P3P D;  3FQ8 A;  3USF A;  5DB5 A;  3MGQ A;  4LD9 C;  2HP2 A;  4ZM4 A;  4JEX A;  1AOI D;  4LNL A;  5BNV B;  4JJN B;  4CBR A;  1J32 A;  4DBC A;  1IJI A;  3MGS A;  1X29 A;  1R4V A;  1O62 A;  1V72 A;  3I5T A;  3AAT A;  1P3G B;  3TAT A;  5DJ9 A;  2CV5 C;  3A6N B;  3B6G B;  3MGS D;  5KDM A;  5C3I C;  3LZ0 C;  3HL2 A;  3PAA A;  3FVX A;  5G0A A;  2NQB B;  2D7Z A;  3AOW A;  4WNN A;  2FNU A;  3PDB A;  1QIT A;  1KMJ A;  3N0L A;  3VH6 W;  2YFV B;  4W91 A;  5AY8 B;  4JJN D;  4Z66 A;  1G7X A;  5BJ3 A;  2YCN A;  1W7N A;  3ZZJ A;  3AZF A;  4Z66 D;  1E5E A;  3CQ5 A;  2YKY A;  3A6N D;  3WA9 A;  1D7U A;  2VMS A;  5CHL B;  4WU8 A;  3AZF D;  3ASA A;  5JA4 B;  2NQB D;  2BWO A;  3HDO A;  2JE5 A;  1P3B C;  3FKD A;  3L8A A;  3WY7 A;  4CBS A;  1M1A C;  4XJO A;  2BYM B;  1YJZ A;  3D6K A;  5AY8 D;  5AVC B;  1T3U A;  2VYC A;  1YJY A;  1IBJ A;  1E5F A;  5AX8 A;  4QLC C;  1D7V A;  2Y2I A;  1JFI B;  1ZC9 A;  1M32 A;  2FJ7 A;  1V2F A;  1S09 A;  5B1L A;  3EI5 A;  3LZ1 A;  3AZI B;  3X1U C;  4RM1 A;  2BI5 A;  2VGS A;  4UPK A;  3DR7 A;  3LVM A;  5B1L D;  3LZ1 D;  3WKJ A;  3E2Z B;  3BCX A;  4MQP A;  3AV2 C;  2QMA A;  4GEB A;  3AZJ A;  4H9P B;  3WKJ D;  3MGP B;  3AEP A;  1ASB A;  1P3O C;  3AZG A;  1CZE A;  3AZJ D;  5B0Y C;  3PDX A;  4WBT A;  4J5U A;  2CFB A;  3AZH C;  4YM6 A;  5JAY A;  5G49 B;  1ZLA A;  5FT4 A;  2WK8 A;  2V1P A;  2VIA A;  4AO9 A;  3AZE B;  3R4T A;  4ATQ A;  4H9Q A;  1AJS B;  4YM6 D;  3G8M A;  1ZLA D;  4K05 A;  5EUD A;  4ADE A;  2Z1Z A;  2X8U A;  3LZ0 B;  1IAX A;  2JGT A;  4LD9 A;  2QSR A;  3AEM A;  2AY5 A;  1M6S A;  3W1I A;  3QI6 A;  4H9O A;  1WWS A;  1TZY C;  4LD9 D;  3NU7 A;  4R8P C;  3WTP A;  4ADC A;  1SZU A;  4XJL A;  1KMK A;  2BIE A;  4CAY A;  2CV5 A;  4W1V A;  3WTP D;  3AFA C;  2E7J A;  3E77 A;  1LK9 A;  1S08 A;  2CV5 D;  3LY1 A;  3LZ0 D;  4GDY A;  4ITG A;  2JIS A;  3LVK A;  1TOE A;  1VEF A;  3UTA A;  4E45 A;  3QBO A;  5F99 C;  1HQ3 A;  2DGM A;  1P3B B;  1ARG A;  4W8I A;  3WAA B;  3LJA A;  4OBU A;  4A6T A;  4YS3 B;  2QBT A;  2DKJ A;  2VMZ A;  3RBL A;  1M19 B;  5BNX B;  5FUG B;  2YHK A;  1TAT A;  4UUZ B;  3AEN A;  1S32 C;  3FQ7 A;  1P3M C;  1GEY A;  1I29 A;  5D5S A;  1AMR A;  2VMU A;  3REI B;  4NE5 A;  1M1A A;  5AV5 B;  1GBN A;  2F8N H;  1AKB A;  1P3B D;  3ELE A;  3FFH A;  3MGR A;  2AY7 A;  1M1A D;  4H9S A;  1SZK A;  4MKK A;  1ARS A;  4QLC A;  1B67 A;  3AV2 B;  2Y2G A;  4A0H A;  3TCM A;  4QLC D;  3X1U A;  2VMY A;  1P3O B;  4ZUX A;  1ID3 A;  5EFS A;  5DNM B;  3AEJ C;  5CPI B;  1DKA A;  3X1U D;  2F8N B;  4H9N A;  3AZH B;  5F8V A;  2VGW A;  4WYG A;  4HF8 A;  2G5H C;  2YCT A;  4OYT A;  3VK3 A;  3II0 A;  3EI6 A;  5E5A A;  2ZY2 A;  5M46 A;  3AV2 D;  3VH6 T;  2VMQ A;  3A9X A;  3I4J A;  4ADB A;  1N8P A;  5B0Y A;  1O61 A;  3R45 A;  2YKX A;  2EO5 A;  1P3O D;  3AZH A;  3B0B A;  3AN2 A;  1IX8 A;  1TZY B;  1FG7 A;  5B0Y D;  2R2N A;  2F8N D;  1GEW A;  2RVQ C;  3AZH D;  4H9R A;  5B2J B;  3B6F B;  1AY5 A;  2YCP A;  3MAF B;  2FN6 A;  1XI9 A;  2BI9 A;  3HT4 A;  3VAX A;  1X2A A;  3AFA B;  4LW2 A;  1KX5 C;  3X1T C;  2W8W A;  1BJO B;  2CJG A;  4IYO A;  3EG5 B;  4R8P A;  2HOZ A;  3AV7 A;  1KX4 A;  3VH6 A;  4R8P D;  3AFA A;  3NDN A;  1F66 B;  4KUD B;  2CH1 A;  3EPH A;  4XQ2 A;  1DJ9 A;  3CBF A;  1JF9 A;  4MSO A;  3B1D A;  2ZC0 A;  3DYD A;  3AFA D;  1DTY A;  3V9R B;  5B2I C;  1OHY A;  1S32 B;  2VIB A;  5B24 A;  1P3K C;  1P3M B;  5F99 A;  3DXW A;  2PB2 A;  5B32 A;  3B0C W;  1TOJ A;  4H51 A;  2HIO C;  5F99 D;  2Z9W A;  1JS6 A;  5AV9 A;  3MEB A;  2NMP A;  1U35 B;  1G4X A;  3A9Z A;  4PVF A;  3KXB A;  5GT3 B;  3EUC A;  2G7J A;  1AKA A;  3C1C B;  1LC5 A;  4RKC A;  1S32 D;  1W7M A;  1P3M D;  1N1J B;  4ZDL A;  3RCH A;  4ZLV A;  1P3L C;  5DJ1 A;  1BH9 A;  3REL C;  5AV8 C;  3KUY C;  1P3I C;  3HVY A;  2Z20 A;  4M6B A;  2UWX A;  2W8S A;  2HUE C;  3AZK C;  3AZM A;  3WTP E;  2HUU A;  3LEL B;  1BH8 B;  3OP7 A;  4NFT A;  3GJU A;  1D7R A;  5JRG A;  5HHY A;  4WLJ A;  1PMM A;  3NQU B;  4KGC C;  3I16 A;  1N31 A;  3NYU A;  2AAT A;  2JJG A;  3N4X A;  2VMO A;  1FC4 A;  4CVQ A;  3CAI A;  3PPL A;  4IW7 A;  1KX5 B;  2R5E A;  3X1T B;  1EQZ A;  4E77 A;  1D7S A;  5GXQ C;  2OGA A;  3P1T A;  3B6G C;  2AY6 A;  1EQZ D;  2RVQ D;  5BO0 B;  3KWQ C;  2EGY A;  1ARI A;  1KKP A;  1CL2 A;  3W1H A;  4WD2 A;  5GT0 C;  5B2I B;  2W7E A;  3EPL A;  2VGT A;  2HOY A;  1P3K B;  3X1T D;  2WK7 A;  3PD6 B;  4RKD A;  1ULY A;  5KTB A;  2W7J A;  2HIO B;  4FFC A;  5GSU C;  2ZJG A;  3G7Q A;  2CJH A;  2AY1 A;  1CS1 A;  4DGT A;  4RAE A;  1AJR A;  3E2F A;  2AEU A;  1I41 A;  1WWI A;  4LC3 A;  1UU1 A;  3IP4 C;  5B2I D;  3ZRP A;  2PB0 A;  4WU9 A;  1P3K D;  3DXV A;  2GMS A;  5CPJ C;  2HOX A;  4WU9 D;  4WXF A;  2HIO D;  2G6W A;  2R5C B;  1X28 A;  1P3L B;  2VGV A;  4AZK A;  2R0T A;  3REL B;  1IX6 A;  5AV8 B;  3KUY B;  1P3I B;  4ZBJ C;  3NQJ B;  1P3F A;  3AZI C;  3A1I A;  1FG3 A;  1LC7 A;  2VMR A;  4MY5 A;  1SFF A;  3AZK B;  4KXK A;  3R9A A;  2LY8 A;  4DRB A;  1P3P A;  2A1V A;  4F5J A;  4ZM3 A;  3KFU G;  5DX5 A;  3REL D;  4KGC B;  4UQV A;  3KUY D;  2PYO C;  1P3I D;  3NNK A;  1W3U A;  3W96 C;  3X1V C;  3NX3 A;  4HGA C;  2GMU A;  4DRA A;  1C9C A;  1G7W A;  3AZE C;  1TOG A;  2OGE A;  2CTZ A;  4WP0 A;  5B40 C;  2ORD A;  5GXQ B;  1AIB A;  4W1W A;  3UTB B;  2X5F A;  3KWQ B;  3B0C T;  5BNV A;  4JJN A;  2VGZ A;  3AZN C;  2ARO C;  2AY4 A;  3E2Y A;  5GT0 B;  3N4R A;  2ZY3 A;  4F5M A;  1P3G A;  1BS0 A;  1M18 C;  3A6N A;  3B6G A;  1BFM A;  2DR1 A;  3ISL A;  1WYV B;  3GBX A;  5G2P A;  1ARH A;  1H0C A;  1P3G D;  2NQB A;  5GXQ D;  5GSU B;  3B6G D;  4NE3 A;  4ZAH A;  4IY7 A;  3A9Y A;  2YFV A;  2Y2M A;  3KWQ D;  4EB7 A;  5AY8 A;  1GDE A;  5B0Z B;  3WAA C;  3IHJ A;  2DGL A;  4ISY A;  4YS3 C;  1M0Q A;  2BG1 A;  1M19 C;  4J8W C;  1MAQ A;  2BKW A;  5CPJ B;  3X1S B;  3GZD C;  5JA4 A;  2EPJ A;  4WJ3 C;  1KX3 C;  3P6K A;  4A0G A;  3K28 A;  4Q6R A;  3REK B;  2Y2N A;  4LW4 A;  3REI C;  1QGN A;  5AV5 C;  4ZBJ B;  2BYM A;  4OTL A;  5AVC A;  3FZ8 A;  2VMW A;  3QN6 A;  1P3A C;  3VK4 A;  2VMX A;  5AVC D;  1S0A A;  1M4N A;  3C1B C;  1JFI A;  4BMK A;  1PFF A;  2QLR A;  1QZ9 A;  1GC2 A;  4BQ0 A;  3UT9 C;  2AY9 A;  1UU0 A;  3VH5 W;  1CZC A;  3AZI A;  3EI9 A;  5D95 A;  2PYO B;  2J8P A;  1AY4 A;  3B0D C;  1S06 A;  5DNM C;  3W96 B;  3CQ6 A;  5CPI C;  3X1V B;  3AZI D;  4HGA B;  3E2Z A;  1WYT B;  3H7F A;  4KYO A;  3PA9 A;  1ASN A;  4H9P A;  4J8V C;  3MGP A;  5AV6 C;  5B40 B;  1MLZ A;  1TOK A;  3FVS A;  3FRK A;  3WZF A;  1AAM A;  1DGE A;  3F0H A;  1RV4 A;  2OQX A;  3MGP D;  1ASF A;  2VLH A;  4XAU A;  5HXX A;  5G49 A;  3ACZ A;  3X1V D;  3AZN B;  2ARO B;  3AZE A;  1AJS A;  1XEY A;  5B2J C;  3B6F C;  1M18 B;  2E54 A;  4W1X A;  3RUY A;  3AZE D;  2YRR A;  3LZ0 A;  5EAA A;  3QGU A;  5B40 D;  3BN1 A;  3W99 C;  1AIC A;  1ASD A;  4J8U C;  3A8U X;  1MAP A;  3QM2 A;  2Y2P A;  3CQ4 A;  3AZN D;  2ARO D;  2AEV A;  4KHA B;  1MDX A;  1OXP A;  1ORD A;  4G92 B;  1F66 C;  4KUD C;  1KL1 A;  4RJY A;  1MDZ A;  3KSY A;  1M18 D;  4J8W B;  3AV1 B;  1BQA A;  3MVD C;  9AAT A;  4F5I A;  3WX9 A;  1KX3 B;  1JG8 A;  3VK2 A;  4WB0 B;  1P3B A;  3Q8N A;  5E5I A;  2YFW B;  3WAA A;  3E9K A;  4YS3 A;  5M4B A;  3REJ B;  1M19 A;  2KFP A;  5BNX A;  2ZM5 A;  3WAA D;  5FUG A;  4ZWM A;  1U35 C;  1P3A B;  4UUZ A;  3GZD A;  4YS3 D;  1ASC A;  4F4E A;  2VMT A;  1CQ8 A;  1M19 D;  5GT3 C;  4WXB A;  4M2J A;  5EQC A;  4J8W D;  4RJ0 A;  1QJ5 A;  3C1B B;  3REI A;  3C1C C;  3FDD A;  5AV5 A;  2OKK A;  3RI6 A;  1MLY A;  1KX3 D;  5EAV A;  2DQN C;  3UT9 B;  1Z7D A;  3N5M A;  3REI D;  3PGY A;  2Y2L A;  3NTJ A;  3B0D B;  5AV5 D;  5EIG B;  4E3R A;  5BS7 C;  4AH3 A;  3ELP A;  3ECD A;  4Q31 A;  3FZ7 A;  2W7H A;  1WST A;  4RLG A;  3UWC A;  1ZOB A;  1AMA A;  2YRI A;  3AYW B;  3AV2 A;  1P3A D;  1WYU B;  2EZ2 A;  1OHW A;  1M7Y A;  4J8V B;  5AV6 B;  4GRX A;  1P3O A;  2ZSL A;  4X23 C;  4IXZ A;  1HTA A;  2Y2J A;  5DNM A;  3LEL C;  4MQQ A;  5CPI A;  3UT9 D;  2JJH A;  4A0R A;  2F8N A;  4UHO A;  3PJ0 A;  4EB5 A;  5DNM D;  5CPI D;  3UAK A;  3JWB A;  4J8X B;  1CJ0 A;  3AEO A;  1Z2C B;  1DFO A;  4J8V D;  4A00 A;  5AV6 D;  3W99 B;  3M5U A;  1P3W A;  1TZY A;  4CXQ A;  4J8U B;  5FT6 A;  5BT1 C;  5B2J A;  3B6F A;  3AL0 C;  2W7L A;  4B98 A;  1TZY D;  3MAF A;  2Z9U A;  2HUF A;  1GC0 A;  2DKB A;  5CP6 C;  1OAT A;  3DOD A;  2CWE A;  3BV0 A;  8AAT A;  5B2J D;  3B6F D;  1G4V A;  2W8U A;  2BYK B;  3FZ6 A;  1W2E A;  1BJO A;  2F8J A;  3TU4 C;  3MVD B;  4Z2M G;  3KGX A;  1ELU A;  3W99 D;  2X5D A;  1C7G A;  4JEZ A;  2TPL A;  3ATH A;  3UE8 A;  3LVL B;  4MQR A;  1F66 A;  4KUD A;  1J04 A;  3FDB A;  4FL0 A;  2C0R A;  5G4J A;  2NZD B;  2DOU A;  4MKJ A;  5B31 C;  3VH5 T;  3WGB A;  1C0N A;  1F66 D;  3V9R A;  4KUD D;  4OCA A;  4BHD A;  1S32 A;  1BKG A;  4GE4 A;  1P3M A;  4XUJ B;  1S07 A;  5K8B A;  2PO3 A;  3BCA A;  3WGC A;  4EFF A;  4WYE A;  3NYS A;  4R5F A;  5B1M C;  5CPK C;  3GET A;  4PFF A;  1U35 A;  4K2M A;  2D5Y A;  5GT3 A;  1TPL A;  2QA3 A;  1U35 D;  4B9B A;  3C1C A;  3BWN C;  2W7F A;  4WV4 B;  5GT3 D;  2GB3 A;  3EZS A;  3C1C D;  2F2A C;  3BC8 A;  4X23 B;  1N1J A;  1B6W A;  1ASE A;  5BS7 A;  3AEJ A;  3VH5 A;  4XZQ B;  4Z5T B;  2VMP A;  3F6T A;  4DQ6 A;  3REH C;  4IXO A;  4ADD A;  4RIZ A;  3O62 C;  5C6U A;  3B1E A;  3MGQ C;  5EUE A;  4GE7 A;  3LEL A;  1BH8 A;  1AX4 A;  1H3O B;  4X23 D;  3ZRR A;  5DNN B;  3MGS C;  2XH1 A;  4AWL B;  2FNI A;  3LEL D;  5EUN A;  2XD1 A;  1AHF A;  5M4D A;  3NQU A;  2DF4 C;  3E6G A;  1TAF B;  4U1T A;  4ZDO A;  1IAY A;  3H0M C;  3DRD A;  3UTB C;  5CP6 B;  4CXR A;  3W97 B;  1YAA A;  3DC1 A;  3L44 A;  1MDO A;  1KX5 A;  1ZOD A;  3X1T A;  2ZSM A;  3TU4 B;  1U08 A;  2VMV A;  4J8L A;  1KX5 D;  4F5K A;  2OAT A;  1V2E A;  1P34 B;  5BO0 A;  3WA9 C;  1CQ7 A;  4WU8 C;  2QB2 A;  2W7M A;  5B31 B;  5CP6 D;  5B2I A;  3TU4 A;  1CQ6 A;  1LKC A;  4IX8 A;  1P3K A;  5B0Z C;  3EPJ A;  4PIW A;  3FSL A;  4OC9 A;  4Q76 A;  2BHX A;  1AIA A;  2CJD A;  5B33 B;  3TU4 D;  3PD6 A;  4AO4 A;  4AZJ A;  4R2N A;  2HIO A;  4ATP A;  4G91 C;  5B1M B;  3X1S C;  5CPK B;  1SVV A;  3N75 A;  4N0W A;  3REK C;  3B1C A;  2ZP7 A;  1CL1 A;  3EI7 A;  4L0O A;  4OMA A;  2FJ7 C;  1IX7 A;  1UU2 A;  2BYJ A;  5B1L C;  5G2Q A;  4CSR B;  2ZUK A;  3TFU A;  4ZSW A;  4E1O A;  4R5Z A;  1B9H A;  3AZL B;  3NUB A;  2OKJ A;  2W8V A;  5AVB B;  5B31 G;  3WKJ C;  2W7D A;  2R5C A;  4R8D A;  1P3L A;  3REL A;  5B1M D;  5AV8 A;  5CPK D;  3KUY A;  1P3I A;  3BWN A;  3NQJ A;  1P3L D;  1B9I A;  2AY8 A;  5AV8 D;  4F5F A;  3REH B;  3AZG C;  1AOI B;  5G09 A;  3O62 B;  1B8G A;  1TAS A;  3MGQ B;  3AZK A;  2VI8 A;  2L5A A;  3AZK D;  4LNM A;  3MGS B;  4UHM A;  2W7I A;  2Y2K A;  1SF2 A;  4KGC A;  3FFR A;  3FQA A;  2GQN A;  2JJE A;  5KDM B;  2CH2 A;  4P3M A;  5I92 A;  4KGC D;  3AEM C;  4GSA A;  3REH D;  3NYT A;  3O62 D;  4WNN B;  3MNN C;  3PDB B;  3MGQ D;  3WTP C;  2FYF A;  2Q7W A;  3NU8 A;  1GC3 A;  4Z66 B;  2FQ6 A;  5GXQ A;  4F5H A;  4XK1 A;  2JSS A;  2XBN A;  3AZF B;  4E3Q A;  1LS3 A;  3UTB A;  1UKJ A;  2O1B A;  3KWQ A;  3WA9 B;  2F8N K;  4WU8 B;  4WYA A;  3UTB D;  3UTA C;  3EIA A;  5GT0 A;  3W98 C;  3LVJ A;  1OXO A;  1HQ3 C;  1RVU A;  2BI3 A;  2BWN A;  3LJA C;  4G92 C;  1AMS A;  5GT0 D;  1WYV A;  3DZZ A;  1ASL A;  1I48 A;  3WCN A;  4U2H A;  2ZYJ A;  5GSU A;  3PIU A;  3AV1 C;  3HLM A;  4G91 B;  4ZSY A;  1MGV A;  4EMY A;  3GR9 A;  3WA9 D;  5GSU D;  3NUI A;  1ART A;  2CB1 A;  4WU8 D;  5B0Z A;  4ITX A;  1AHY A;  1SPA A;  3AEL A;  2FJ7 B;  4O6Z A;  5B1L B;  3LZ1 B;  1AHX A;  3RQ1 A;  3MGR C;  3REJ C;  4JEW A;  5B0Z D;  2C44 A;  4H9S C;  2FKI A;  5CPJ A;  4UHN A;  5IWQ A;  3X1S A;  1PZR A;  2W7G A;  3WKJ B;  3TFT A;  3HQT A;  2VLF A;  3REK A;  5CPJ D;  1B5P A;  3X1S D;  2CAN A;  3AZJ B;  4XEW A;  3BWO A;  2JJF A;  3REK D;  4ZUX C;  2C81 A;  1ID3 C;  1KKJ A;  4OBV A;  3AZG B;  2FJ7 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...