2ZY5A

R487a mutant of l-aspartate beta-decarboxylase
Total Genus 183
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
183
sequence length
510
structure length
510
Chain Sequence
ELIKIASSDGNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHRPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGAGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords L-aspartate beta-decarboxylase
publication title Structure, Assembly, and Mechanism of a PLP-Dependent Dodecameric l-Aspartate beta-Decarboxylase
pubmed doi rcsb
source organism Alcaligenes faecalis subsp. faecalis
total genus 183
structure length 510
sequence length 510
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 2009-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.110 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 2zy5A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2zy5A01
1KL1A 1W7MA 2BI5A 2W8WA 3FQAA 1ECXA 4CBRA 4A0HA 1ELUA 3EI9A 3II0A 4HVKA 1ASNA 1M6SA 1IUGA 3JWAA 2W7GA 2YOBA 3WX9A 1DJEA 4OCAA 3GZDA 4XJOA 1KKPA 3B1CA 3NU8A 4GEBA 4R5FA 1JG8A 1G4XA 2BI3A 5DJ1A 1AIAA 4PFNA 4MSOA 5M4BA 4CXQA 9AATA 3TFTA 4GE9A 1WYUA 3QHXA 3HL2A 3BWNA 3RQ1A 1AHGA 4UHNA 1YJSA 1G7XA 2AY9A 2QB2A 2AATA 1J32A 3GR9A 4A72A 2VMPA 1BW0A 1M4NA 1ARGA 4JEXA 3GSBA 4XQ2A 2E7JA 2FNIA 3BWOA 3USFA 3AEMC 3DODA 2C81A 2BYLA 2VMRA 2G6WA 1GC0A 1YOOA 4LW4A 1X0MA 2CY8A 1CS1A 2HUIA 4AO4A 2E7IA 2HOYA 1N31A 2XH1A 1I29A 3A9ZA 1OATA 2VMOA 2CFBA 5DJ9A 5HXXA 2BIGA 4RAEA 1QITA 1IX8A 1U08A 2GB3A 3AEPA 3ASBA 1ASLA 3B1DA 3E2ZB 3EZ1A 4I8AA 4J5UA 4XJPA 5C6UA 2FNUA 1C7NA 3AOWA 4GE4A 4M2MA 1TOEA 3FDDA 3ZRQA 1MDOA 5DX5A 4EB7A 2VLHA 4E1OA 1GEWA 5E4ZA 3MEBA 2VIBA 3DXWA 3PGYA 2GMSA 5EIGB 2AY6A 3RCHA 1RVYA 3E6GA 1E5FA 1KMKA 2HORA 1M7YA 3N0LA 3NUBA 3I4JA 4WBTA 1ASEA 1WYVB 3AENB 1AMQA 1SPAA 1FG3A 2R2NA 1YJYA 4WYAA 5EUDA 1LKCA 1TOIA 1C4KA 2X5DA 2W8JA 2VMVA 1G4VA 1M0PA 3PAAA 3NU7A 2EH6A 3EI8A 4EFFA 1WYTB 3EI7A 3JW9A 1ZODA 2CJGA 3LVMA 4ZDLA 1LC5A 4IX8A 2DOUA 1LW5A 2C7TA 4RJYA 2GSAA 3ECDA 3MAFB 5FT5A 1I48A 1ZC9A 2ZSLA 5EUNA 5G09A 3BB8A 4LNLA 5DB5A 5E3KA 2HP2A 1W23A 2OGAA 4WP0A 3BN1A 3TFUA 1LS3A 1MDZA 3NTJA 4O6ZA 3DC1A 1UKJA 2Z61A 1MLZA 4OMAA 4A0FA 4JEWA 4F5FA 1SZUA 1UU0A 2JJFA 3GBXA 3LWSA 3NNKA 4WYEA 4E3RA 2R5CB 3KKIA 1GCKA 4A0RA 2VGVA 3RI6A 2ZSMA 3NYTA 1BKGA 2ZY3A 1AMAA 3FTBA 3PPLA 2FYFA 3BWNC 5BJ3A 4B9BA 3IHJA 4QGRA 4MKJA 1ASGA 3EI5A 2ZUKA 4P3MA 1H1CA 1WKGA 1D7VA 3CQ6A 4KXKA 4JEYA 2VLFA 3BCXA 2O0RA 4ADBA 4CXRA 2VMNA 4KAMA 1ARIA 4EB5A 4N0WA 2V1PA 1SZSA 4WB0A 4ZM3A 5G2PA 1QJ5A 2CH1A 2ZP7A 3RBFA 3B46A 2BWNA 1FC4A 1XI9A 1ASAA 2VMZA 3FVUA 1AHEA 3WKSA 4M2KA 2Q7WA 4MQRA 1UU2A 3PDXA 4JF1A 4F4EA 3FQ8A 1EG5A 1KKJA 1IJIA 1IBJA 2YCPA 2D64A 1Z7DA 3E2ZA 4PIWA 1W3UA 1B9HA 2W8TA 2ZYJA 4XAUA 4ADEA 4LW2A 1OXOA 1S0AA 1P3WA 3ZZKA 1CQ8A 3CQ5A 2DKBA 3FKDA 5K8BA 1LW4A 2EZ1A 4ZAHA 1Y4IA 3NX3A 5EIGA 2QB3A 4LNMA 1OHYA 2QBTA 1YAAA 4K2BA 2AY1A 3OKSA 1ASBA 3AENA 4TN4A 1B5OA 1N8PA 2BWPA 1ASCA 1N2TA 1WKHA 4ZDPA 1CJ0A 2GQNA 4A6TA 1CZEA 1QGNA 3FFHA 4EU1A 1G7WA 3H7FA 1M32A 1VP4A 4UQVA 5HDMA 4ZDOA 2BYJA 3N75A 4ZWMA 4Q6RA 3KGWA 4W91A 4R8DA 3HQTA 2V0YA 4F5IA 2JG2A 3MAFA 4BMKA 5FT8A 4WLHA 3HLMA 4E77A 2VYCA 1YJZA 1BJWA 4FL0A 4Q75A 3TCMA 1I41A 1O4SA 4OTLA 2FM1A 2C0RA 2CTZA 4AO9A 3R9AA 3MBBA 2YRIA 3AEJA 3Q8NA 1D7UA 2R5CA 3FQ7A 1AX4A 1IVRA 1TATA 3NRAA 4IW7A 5EUEA 4GE7A 2X8UA 3A8UX 2VI9A 1AY5A 1D7RA 2WKAA 1AKCA 3DYDA 1FG7A 3RBLA 2VGUA 4WXBA 3BC8A 2W7FA 2YCNA 5G4IA 3CBFA 3EIAA 3FFRA 3QM2A 2EPJA 4Q31A 4Y0HA 1YIYA 1BS0A 1SF2A 2EZ2A 4ADDA 5I92A 1ASFA 1JF9A 2VGSA 1E5EA 5D5SA 4Y0IA 2JGTA 2OGEA 5G0AA 1AAMA 2WK9A 2VMYA 2BI2A 4IYOB 2QLRA 3RUYA 5EAAA 2R5EA 4TMRA 3FCRA 4PFFA 4W5KA 2D61A 3UWCA 4WXFA 1IAYA 4DBCA 1DGDA 4AZKA 1V72A 3B8XA 2FQ6A 1AJSB 1LK9A 2HOZA 4WYCA 2AY8A 3VK3A 1C0NA 3ISLA 3P6KA 4M2JA 2HOXA 4ZSYA 5J8QA 1DFOA 1JS3A 3LY1A 1D7SA 1IAXA 4WYDA 3FVXA 1AHXA 1TASA 2Z9VA 2CB1A 5IWQA 1DGEA 1OXPA 2CH2A 2YKVA 1CQ6A 3WGBA 4ISYA 1ORDA 1TOJA 2HP1A 3GZDC 5TF5A 3HDOA 4Y0DA 3PA9A 3AEOA 4JF0A 3EI6A 1ARTA 1B4XA 1CZCA 2JJGA 2W8UA 5FT4A 3TQXA 2W7DA 3LVKA 4ZASA 3PDBB 3AEMA 4K2MA 3FRKA 3NYUA 2BWOA 2QMAA 4Q76A 3P1TA 4W1WA 1LC8A 2W7EA 3LV2A 1DJ9A 3DZZA 1ELQA 3NDNA 4OT8A 2YKYA 4LC3A 1DTYA 1B9IA 1O62A 2ZC0A 5EQCA 1D2FA 1GEYA 5AX8A 1B8GA 4JEVA 1AAWA 1M0OA 2D63A 2JJEA 5JAYA 4WYGA 1X29A 4JEZA 3AV7A 4R5ZA 3EUCA 3WKRA 1CL1A 3DU4A 2W7MA 4ZM4A 3QPGA 1MAPA 3ACZA 4WXGA 5BJ4A 1S09A 3AELA 1EJIA 2ORDA 1ZOBA 4W8IA 4GDYA 5M49A 1ASMA 5G4JA 2PB2A 2VMWA 4K2IA 1X2AA 2CJHA 1M0QA 4DQ6A 1BJ4A 1T3IA 2JJHA 3T32A 1DKAA 3FVSA 4AH3A 4WD2A 1GC3A 7AATA 1UU1A 4MQQA 3AATA 3E77A 4A0GA 4WYFA 1AKAA 4RKCA 4U1TA 2YHKA 1AHFA 3FDBA 3KE3A 3PD6B 3BCAA 1V2FA 3B1EA 5F8VA 1JS6A 5G2QA 1C9CA 2AY4A 1RV4A 4BHDA 4FFCA 1AKBA 1S07A 3OP7A 1S06A 1PFFA 3E2YA 3L8AA 2GMUA 4F5JA 3BS8A 3E9KA 2D7ZA 2HUFA 1ARHA 2VGTA 1WYVA 1AMRA 3ASAA 2F8JA 3WZFA 5M4DA 4ZLVA 4F5KA 2CANA 4MKKA 4BA4A 4UHOA 3WY7A 2ZY2A 2X5FA 1AJSA 4MY5A 4NOGA 1PG8A 1WYTA 3F9TA 2Z1ZA 1X28A 4XEWA 2XBNA 2OQXA 4GRXA 2BHXA 2VGWA 2W7LA 1EQBA 1OHWA 2TPLA 5D95A 2NMPA 4OC9A 3VOMA 1ASDA 4L0OA 1B5PA 4ATPA 2DR1A 2E7UA 4ITXA 3DR7A 4H51A 3LG0A 4UOYA 4ZSWA 1TOKA 1SVVA 4F5MA 2BIEA 3F6TA 1DJUA 3K28A 4F5GA 1ARSA 2W7JA 2YKUA 2YRRA 5M46A 3VAXA 2OATA 3BCBA 3K40A 3ELEA 1BT4A 4RKDA 1AMSA 1BQAA 5HHYA 3COGA 2VI8A 5E5IA 3ZRPA 3MAUA 3PDBA 2D65A 1RVUA 1WSTA 4W1XA 4XK1A 5EAVA 2W7KA 2Z9UA 4WB0B 3MKJA 2WK7A 1TARA 2DKJA 4P7YA 1YIZA 3A9XA 3DRDA 4OYTA 3NYSA 1LC7A 4WLJA 1W7NA 3GZCA 1CL2A 2BI9A 2EO5A 2VGZA 4A6RA 1H0CA 1BJOB 3MC6A 3WGCA 1QISA 1VEFA 1VJOA 2Z20A 2ZY5A 5FT6A 4MQPA 2VMSA 1I43A 1AY4A 2E54A 3EIBA 3ZRRA 4CVQA 2AY2A 2ZJGA 1BQDA 1GBNA 1QZ9A 1CQ7A 3G8MA 3JTXA 4ZWVA 2Z9XA 2W7IA 2YCTA 2Z1YA 4XJLA 2BI1A 2D5YA 4DGTA 2O1BA 3EZSA 4F5LA 2AY3A 2O7CA 2CINA 3K7YA 1QIRA 1YNUA 1TPLA 4KYOA 1W7LA 4UHMA 4EMYA 2HUUA 3A9YA 3PD6A 1MDXA 3ELPA 4A00A 2WK8A 1C7OA 1MGVA 1WYUB 3AOVA 2QA3A 2VMTA 5F9SA 3I5TA 3CAIA 1TOGA 4HF8A 4IXZA 1SFFA 1IX7A 1AIBA 2AY7A 2D7YA 2W7HA 1MAQA 2VMQA 3N5MA 1GDEA 1SZKA 2VMXA 2R0TA 3VK2A 3F0HA 2PO3A 3GETA 1GEXA 2EGYA 2C44A 3E2FA 1KMJA 3UE8A 4CBSA 1KL2A 4W1VA 4ATQA 2CSTA 4IY7A 1OHVA 4AOAA 3G7QA 3A2BA 1GD9A 1AICA 2BKWA 1C7GA 2FN6A 3BV0A 2VIAA 8AATA 4ADCA 3TATA 2AY5A 1Z3ZA 3ZZJA 1V2EA 3QGUA 1M0NA 1QJ3A 2CJDA 1GC4A 1RV3A 4XJMA 1O69A 4AZJA 2PB0A 4GSAA 3UAKA 2Z9WA 3LVLB 3HMUA 3QBOA 3QN6A 4BQ0A 3NUIA 2ZY4A 1AJRA 2VMUA 1O61A 4B98A 3AEJC 2RFVA 3L44A 4A6UA 2YKXA 3FSLA 5EFSA 3ATHA 2BIAA 3R4TA 3D6KA 1AHYA 1AY8A 3QI6A 1V2DA 1S08A 3PIUA 3WLXA 1MLYA 3MADA 3RCHB 4E3QA 2D66A 3PJ0A 2HZPA 1J04A 4PVFA 2W8VA 3JWBA 4IXOA 3KGXA 3GJUA 3LVJA 3CQ4A 4IYOA 1BJOA 1IX6A 4LNJA 3MC6C 3M5UA 1BJNA 1GC2A 4ITGA 4R2NA 3DXVA 4BA5A 4F5HA 3VK4A 3DR4A 4U2HA 4IXSA
chains in the Genus database with same CATH superfamily
4YM6B 3LJAD 3AZKA 1W7MA 2BI5A 4HVKA 1P3PC 1IUGA 2W7GA 3LJAB 1DJEA 4XJOA 4J8WC 3MGSB 1P3KD 3NU8A 4GEBA 4R5FA 2IO5C 2BI3A 5DJ1A 3X1TA 3REKD 3UTBA 5B2IB 1P3KB 3QHXA 3AZJA 3RQ1A 1AHGA 5B31A 5GSUC 2AY9A 3REKB 1BW0A 3BWOA 3WA9A 3AEMC 1N1JB 4OBUA 3B6FA 1GC0A 3V9RA 4YS3D 2HUIA 2E7IA 2NQBD 2XH1A 5B24C 3W99C 2CFBA 2FJ7C 5DJ9A 3AZFC 1IX8A 1U08A 3REHC 3ASBA 2X3LA 5DNMD 3C1BC 3AOWA 1P3MC 5AVCA 3FDDA 3ZRQA 4E44A 5FUGA 2VLHA 1GEWA 5E4ZA 3MEBA 2GMSA 5EIGB 3RCHA 2KFPA 1RVYA 2HORA 1M7YA 4WBTA 1ASEA 2BYKA 1P3AA 5EUDA 1BH8B 5AVBD 2EH6A 3EI8A 4EFFA 1WYTB 1ZODA 3KXBD 1LC5A 1LW5A 3N7NA 5AVBB 5FT5A 1ZC9A 5HDMA 3BB8A 5DB5A 3KXBB 2HP2A 2OGAA 4WP0A 1MDZA 4X23C 5B0YC 3NTJA 4WU9A 4OMAA 5B2JD 4A0FA 3NQJA 4F5FA 5CPIB 3NNKA 4WYEA 2R5CB 1M18D 2VGVA 2ZY3A 3BWNC 4J8VA 1ASGA 5CPJB 1S32D 4KXKA 1M19D 3BCXA 2V1PA 1SZSA 4UUZA 1M19B 4K05A 2ZP7A 3RBFA 1XI9A 5AV8C 1ASAA 3FVUA 2Q7WA 1UU2A 3MGPD 2F8NA 4KGCC 4JF1A 3AZHA 2ZM5A 1EG5A 4ZUXC 2D64A 1Z7DA 3MGPB 3WTPC 1W3UA 4WNNA 3FD0A 1S0AA 2BYMB 2AROB 4ZBJC 5K8BA 2DGMA 2QB3A 2QBTA 1YAAA 1ASBA 4J8LA 1B5OA 1N8PA 4KUDD 1P3GC 1N2TA 2Y2MA 4ZDPA 2GQNA 4EU1A 4ZDOA 3REIC 3HQTA 3AV2D 1JFIA 3MAFA 4WLHA 4H9OB 5B32C 4E77A 1YJZA 5GT0D 2FM1A 4QLCB 3REJB 1D7UA 1AX4A 5EUEA 1AY5A 5GT0B 1PMMA 1FG7A 1KAFA 3LELA 2VGUA 1P3BC 3BC8A 3AZID 3AV1D 3CBFA 3QM2A 2EPJA 1BS0A 2VGSA 3W96D 5D5SA 5B1LB 2CV5C 3AZIB 3AV1B 2BI2A 2QLRA 4R8PD 5EAAA 5AV9D 1IAYA 2JISA 1V72A 1AJSB 2HIOA 4YS3C 3ISLA 2NQBC 2G5HC 4RIZA 1KX5D 1JS3A 4YM6A 1IAXA 2Z9VA 2CB1A 4H9QA 2CH2A 2YKVA 5DNMC 1F66D 1ORDA 1TOJA 2HP1A 4WU8D 3GZDC 3MGSA 3HDOA 4Y0DA 2J8PA 2PYOA 3VH5A 5B2IA 1ULYA 3PDBB 2G5IC 5F99D 3X1UD 1P3ID 1DJ9A 3DZZA 5F99B 5EQCA 1O62A 3X1UB 1B8GA 1AAWA 3AV7A 5JRGC 3WKRA 1CL1A 3DU4A 5DNND 5C3IB 3AELA 5B1MC 5B2JC 1BJ4A 1M18C 3AATA 3AN2D 3FDBA 1Q9CA 4ADBA 4AOAA 3B1EA 1JS6A 4BHDA 5AY8B 4JJNB 4F5JA 1S32C 3BS8A 3E9KA 3AFAB 1XEYA 2VGTA 4UPKA 1AMRA 3AZMB 3ASAA 1BH8A 3O62D 4F5KA 4UHOA 3WY7A 4MY5A 1WYTA 4H9SC 3F9TA 2Z1ZA 5BNXB 2XBNA 2OQXA 4GRXA 2QSRA 1OHWA 2TPLA 4OC9A 4ATPA 3DR7A 3MGQD 4UOYA 3MGRB 1SVVA 2W7JA 3K40A 4Z5TD 5B33B 1BQAA 1P3OA 2VI8A 3W97B 2W7KA 5CPJA 4Z5TB 1TARA 3W98A 4KUDC 4XUJD 1LC7A 4A6RA 3AZKD 1BJOB 2Y2JA 1QISA 2Z20A 1EQZA 2ZY5A 4WJ3C 2VMSA 3UT9A 3AV2C 1AY4A 3AZKB 2AY2A 3AYWD 3G8MA 4ZWVA 2Z9XA 2BI1A 3X1TD 3UTBD 3K7YA 3AZJD 4UHMA 4NE3A 5B31D 3MVDD 2HUUA 2BYMA 2AROA 1MDXA 2VMTA 5F9SA 3WCOA 4HF8A 3WA9D 1SFFA 5BS7C 3UTAA 2D7YA 1MAQA 3VK2A 3B6FD 3W96C 3WA9B 2JE5A 3UE8A 4R8PC 1KX4A 5AV9C 3B6FB 1OHVA 3V9RB 3EPJA 2VIAA 1Z3ZA 3ZZJA 3FZ8A 1TZYA 2NZDC 3NUIA 4H9RA 2ZY4A 1KX5C 4QLCA 1O61A 3REJA 3AEJC 2RFVA 5AVCB 3FSLA 4G91C 4Z2MG 1F66C 5FUGB 1AHYA 4WU8C 1AY8A 3RCHB 5G49B 3WAAA 1J04A 3AZGC 2BYKB 1P3AB 5B1LA 5CP6C 2FFFB 1M1AA 4LNJA 1P3IC 1BJNA 3DXVA 3VK4A 2W8WA 3FQAA 4CBRA 1ELUA 3EI9A 3II0A 4DRAA 1M6SA 3VH6A 3X1SC 3TU4A 1ID3C 2YOBA 4WU9B 3NQJB 5DNNC 4LD9C 1HQ3A 4J8VD 1G4XA 4MSOA 3RELA 2HUEB 9AATA 3TFTA 2YFVA 4J8VB 2QB2A 3AN2C 3FZ6A 4JEXA 2E7JA 4HGAB 2C81A 2F8ND 3AZHD 3WKJD 3AZNA 1P3LC 1CS1A 4AO4A 3O62C 4H63Q 3AZHB 3A9ZA 5E5AC 1OATA 4RAEA 3AEPA 3B1DA 1ASLA 3EZ1A 3MNNB 2G7JA 1TOEA 1MDOA 5DX5A 3N4SA 2AY6A 2AEVA 3E6GA 1KMKA 1FG3A 4NE6A 5AY8A 1C4KA 1TOIA 2X5DA 2W8JA 4DRBA 5BT1C 3KUYB 1G4VA 5KTBA 3EI7A 3JW9A 3LVMA 3AZMA 2JSSA 2Y2GA 4XUJC 2C7TA 2Y2LA 1JFIB 3MAFB 1I48A 2ZSLA 4CXQA 5E3KA 1W23A 1LS3A 5BNXA 2Z61A 3AYWC 5AV5D 1WWSA 4E3RA 4A0RA 3AZEC 3X1TC 3MGRA 3LELB 5B32G 3AZJC 4QGRA 5B31C 3MVDC 2ZUKA 1H1CA 1WKGA 3CQ6A 3VP6A 2O0RA 3C1CA 5GXQB 3W97A 2VMNA 5GT3A 1QJ5A 1FC4A 2HIOD 1AHEA 4J8UC 3PDXA 4YM6D 1IJIA 1AOIA 2HIOB 2YCPA 4ADEA 1OXOA 3MGSD 4H9QB 1P3WA 3CQ5A 3KWQC 2PYOD 3FKDA 5B2ID 3B6GC 2PYOB 4TN4A 1ASCA 4EO5C 1WKHA 4A6TA 1QGNA 3H7FA 1TAFA 1VP4A 5B0ZB 2F8NH 4Q6RA 1KX3B 4F5IA 4BMKA 5FT8A 4FL0A 1BJWA 4Q75A 4XZQC 2RIQA 1I41A 4OTLA 2CTZA 2YRIA 3Q8NA 3FQ7A 3NRAA 1TATA 4IW7A 4KHAA 1U35A 1P34C 4GE7A 3DYDA 4J8XB 2FKIA 2YCNA 4Q31A 1YIYA 2EZ2A 3A6NC 4M6BA 5G0AA 1AAMA 5G49A 1W2EA 2R5EA 3FCRA 4TMRA 4W5KA 1P3FA 2D61A 4H9PA 1DGDA 1ZLAC 3B8XA 3WKJC 2DGLA 2Y2QA 2AY8A 1C0NA 3P6KA 2HOXA 4ZSYA 2JCHA 4J8WA 1AHXA 5CPID 3LZ0B 1P3OD 5GSUA 3PA9A 5CPJD 1P3OB 5AV6B 4G92B 3W98D 4ZASA 3AEMA 2AEUA 3W98B 4W1WA 1LC8A 4OT8A 2YKYA 5B24A 3UT9D 1B9IA 2ZC0A 1GEYA 2FJ7A 2Y2PA 4JEVA 3AZFA 4WYGA 1EQZB 2DF4C 3REHA 3UT9B 3C1BA 3EUCA 2W7MA 1P3MA 3ACZA 5BJ4A 1S09A 1ZOBA 1ASMA 5G4JA 3MNNA 2AROD 4WD2A 4AH3A 5AV5C 4MQQA 3E77A 1AKAA 4RKCA 4U1TA 3UTAD 1V2FA 5G2QA 2AY4A 1RV4A 2Y2KA 3OP7A 3W1HA 3UTAB 1KX4D 2Y2OA 2D7ZA 1ARHA 3KUYA 1KX4B 2ZY2A 4NOGA 1PG8A 4X23A 1X28A 4XEWA 2W7LA 3I16A 1EQBA 5D95A 2NMPA 4YM6C 4QLCD 3REJD 4ITXA 1TZYB 5CPKB 4E45A 3LG0A 4H9RB 3LJAC 3F6TA 1DJUA 3K28A 1ARSA 2YKUA 3MGSC 2YRRA 5B40B 2VQRA 5HHYA 3COGA 4WV4B 5B2IC 1P3KC 5B1LD 1WSTA 2Z9UA 1M1AD 3MKJA 2RVQD 3REKC 3WAAB 1YIZA 5BO0A 4Z66B 5GXQA 3GZCA 2BI9A 4KGCA 1M1AB 3MC6A 3WGCA 3H0LC 1VJOA 1H3OB 5FT6A 3TU4D 3WTPA 4CVQA 1BQDA 2W7IA 3TU4B 1HQ3D 4WZSB 2O1BA 3RELD 2CINA 3VH5W 1YNUA 1HQ3B 3RELB 1P3GA 3ELPA 4A00A 2WK8A 1MGVA 3LZ1B 2YFVB 1TOGA 4IXZA 1AIBA 2VMQA 1GDEA 2R0TA 3F0HA 3REIA 3GETA 1GEXA 2DGKA 4CBSA 3R45B 5B0ZA 5B32A 3AZNB 3G7QA 1GD9A 1AICA 1C7GA 8AATA 1KX3A 2AY5A 5AVBC 3QGUA 1M0NA 1RV3A 2CJDA 4XJMA 1O69A 3KXBC 2PB0A 4GSAA 3HMUA 1AJRA 1P3BA 5CPIC 4B98A 4AWLB 4A6UA 2YKXA 3ATHA 2BIAA 3R4TA 4J8XA 2CV5A 1V2DA 1S08A 5AY8D 4JJND 4E3QA 3PJ0A 3WTPE 5CPJC 3JWBA 3AFAD 3AZMD 3GJUA 3CQ4A 1M19C 3M5UA 2NQBA 5M4BA 4U2HA 3FZ7A 1KL1A 3AZLB 2F2AC 1ASNA 3MGPC 4OCAA 3GZDA 3MGRD 3LZ0A 2AROC 4GE9A 5B33D 1WYUA 4H9NA 3W97D 4A72A 2VMPA 1M4NA 1ARGA 4XQ2A 5AV6A 2FNIA 3B0DB 3USFA 3C1CB 2BYLA 5GT3B 2VMRA 3VH5T 4LW4A 2CY8A 1AOID 5JRGA 5B1MA 2VMOA 5HXXA 1AOIB 5B2JA 3N4RA 2GB3A 2FNUA 4QLCC 1C7NA 4GE4A 2YFWA 3REJC 1HTAA 5GT0C 4OBVA 1E5FA 3N0LA 3NUBA 3X1VB 1AMQA 1SPAA 3A1KA 4WYAA 1LKCA 5B1LC 3AZIC 3AV1C 3PAAA 1TAFB 4H9SA 2CJGA 4IX8A 2GSAA 3ECDA 5G09A 5EUNA 4LNLA 3TFUA 1T3UA 1U35D 1UKJA 1MLZA 1SZUA 1UU0A 2JJFA 3LWSA 3KKIA 1GCKA 4KHAB 1U35B 5AVCD 2ZSMA 5CPKA 3WCNA 3FTBA 5BJ3A 3IHJA 4MKJA 4P3MA 5B40A 4KUDA 1P3AD 4KAMA 1ARIA 2XD1A 2W8SA 2LY8A 4N0WA 1P3FB 2CH1A 3B46A 4CAYA 4H9PB 4Z66A 2VMZA 3VH6W 3AV2A 3WKSA 5F99C 4J8WD 4F4EA 3X1UC 1P3PB 1IBJA 1H3OA 3E2ZA 4WU9D 4PIWA 2ZYJA 1B9HA 4J8WB 2W8TA 4XAUA 4LW2A 2IO5B 3H9XA 2F8NG 2DKBA 4EO5B 1LW4A 2EZ1A 5BS7A 5GSUB 3OKSA 3W96A 3AENA 2BWPA 2Y2NA 5AY8C 3LZ1A 4JJNC 3FFHA 3JZLA 1G7WA 5AV9A 5B24D 3AFAC 2BYJA 3KGWA 3AZMC 4W91A 3REHD 3R45A 2V0YA 5B24B 3W99B 3C1BD 2FJ7B 1P34B 1P3MD 3HLMA 3AZFB 2NZDA 2VYCA 1KX5A 3REHB 3C1BB 2C0RA 4AO9A 3R9AA 3MNND 1P3MB 3AEJA 2X8UA 2WKAA 3B0CW 1F66A 3MGRC 4WXBA 1B67A 2W7FA 3MGQC 3FFRA 1SF2A 1ASFA 3AZGA 1JF9A 5B33C 2OGEA 5CP6A 2WK9A 2VMYA 3W97C 4NE5A 3KUYD 4PFFA 4Z5TC 4X23D 1A7WA 1LK9A 4X23B 5B0YB 2HOZA 3X1SA 1ID3A 3VK3A 3LY1A 3AZKC 4LD9A 3AZLA 1DGEA 1OXPA 1CQ6A 3LELD 3VH6T 3AN2A 1ARTA 1B4XA 1CZCA 2JJGA 2W8UA 5FT4A 2W7DA 3LVKA 3UTBC 5GXQD 3NYUA 4KGCD 2BWOA 3P1TA 3EG5B 1P3LA 5AV8B 5BO0B 2W7EA 3O62A 1ELQA 1BH9A 3WA9C 4KGCB 1DTYA 5E5AA 1D2FA 4ZUXB 3B6FC 1M0OA 2JJEA 4JEZA 3WTPB 1MAPA 2CWEA 2ORDA 4W8IA 4GDYA 5M49A 2VMWA 1X2AA 4ZBJB 1T3IA 1DKAA 1GC3A 5AVCC 2YHKA 5F8VA 3KE3A 3BCAA 1P3GB 1C9CA 3REID 1AKBA 1S06A 3G0TA 1PFFA 3E2YA 2GMUA 3X1VA 4XUJA 5B0ZD 3REIB 2F8JA 1P3AC 3WZFA 5M4DA 3B0CT 1KX3D 2WB6A 5B32B 2BHXA 2VGWA 2EYQA 1ASDA 3VOMA 1B5PA 3AYWA 1P3BD 2DR1A 1B6WA 3B0BA 3AZEA 4H51A 1TOKA 4WU9C 4F5MA 3AL0C 1P3BB 4J8XD 2CV5D 3VAXA 3MVDA 3ELEA 1BT4A 1AMSA 2HUEC 2CV5B 5E5IA 3MAUA 4XK1A 2D65A 1RVUA 4W1XA 5EAVA 4J8VC 4WB0B 2WK7A 2DKJA 3P5JB 4P7YA 3A9XA 3DRDA 4J8UA 3NYSA 4WLJA 1W7NA 4HGAC 1CL2A 2EO5A 2VGZA 4CSRB 5JA4B 4YS3B 1VEFA 2NQBB 1I43A 2E54A 4DQYB 3AZHC 2ZJGA 1P3PA 1QZ9A 1CQ7A 3LZ0D 3KWQA 2Z1YA 4XJLA 5DNMB 4F5LA 2AY3A 3MNNC 1TPLA 1W7LA 2BG1A 3B6GA 3A9YA 3PD6A 1C7OA 1WYUB 3I5TA 5AV6D 3CAIA 4H9NB 1IX7A 2AY7A 4AZJA 3N5MA 1SZKA 2VMXA 1R4VA 3E2FA 2C44A 5JRGD 4W1VA 3KUYC 4IY7A 2UWXA 5B1MD 4XZQA 2BKWA 3A2BA 2FN6A 3BV0A 4ADCA 5JRGB 3TATA 1EQZD 3W99A 4RJ0A 5B1MB 1P34A 3QBOA 3QN6A 5B2JB 1M18B 2YFWB 1PZRA 3W1JA 3A6NA 3D6KA 3LELC 3WLXA 1MLYA 3MADA 1S32B 2HZPA 4PVFA 2W8VA 4IXOA 3KGXA 1ZLAA 5GXQC 3LVJA 1IX6A 3WKJA 4RLGA 3MC6C 1GC2A 4ITGA 4R2NA 4F5HA 3DR4A 1ECXA 4A0HA 5B0YA 2HIOC 3JWAA 1TZYD 3WX9A 5CPKD 1KKPA 3B1CA 1JG8A 5BNVA 1AIAA 4PFNA 5B40D 3HL2A 3BWNA 4UHNA 1YJSA 1G7XA 2AATA 1J32A 3GR9A 2PYOC 3GSBA 3WAAD 4KUDB 4Z66D 1BFMA 3DODA 2G6WA 1YOOA 5B0ZC 1X0MA 5AV8A 4CAYB 3AV2B 2HOYA 1N31A 1KX3C 1I29A 4ZUXA 2BIGA 1QITA 4I8AA 3E2ZB 4XJPA 4J5UA 5C6UA 5AV5A 4M2MA 4EB7A 4E1OA 4J8XC 2VIBA 3DXWA 3PGYA 3H0MC 3LZ1D 3I4JA 3W96B 1WYVB 3AENB 2R2NA 1YJYA 5KDMA 2VMVA 3NQUB 4R8PB 1M0PA 5AV9B 3NU7A 4ZDLA 2DOUA 3AZND 2NZDD 4RJYA 3BN1A 2NZDB 4O6ZA 3DC1A 1KX5B 3LJAA 4JEWA 3GBXA 3EPKA 3RI6A 3LZ0C 4G91B 3NYTA 1F66B 1BKGA 4WU8B 3AZGD 1AMAA 1P3KA 3PPLA 2FYFA 5CP6D 4B9BA 3REKA 3EI5A 3AZGB 1D7VA 4JEYA 2VLFA 4CXRA 5CHLB 5CP6B 5AV6C 4G92C 1P3OC 4EB5A 2DQNC 1N1JA 4WB0A 4ZM3A 1P3IB 5G2PA 1KU5A 2BWNA 3W98C 3X1SD 1ID3D 4M2KA 4MQRA 4CSRA 3FQ8A 5JA4A 1KKJA 1WWIA 4YS3A 3X1SB 3AZLD 1ID3B 4LD9D 1EQZC 5DNNB 3UT9C 2XD5A 4LD9B 3ZZKA 1CQ8A 5DNMA 2Y2IA 4ZAHA 1Y4IA 3NX3A 5EIGA 4LNMA 3AN2B 1OHYA 3EPLA 4K2BA 2AY1A 1P3LD 1CJ0A 3C1CD 1CZEA 1PMOA 2F8NK 1M32A 5GT3D 3UTAC 4UQVA 5E5AD 3N75A 4ZWMA 1P3LB 3O62B 4R8DA 5AVBA 1BH9B 2JG2A 5E5AB 1KX4C 3KXBA 3TCMA 5B31G 1O4SA 5CPIA 3MBBA 2R5CA 3MGQB 1IVRA 3GWPA 3A8UX 2VI9A 1TZYC 1D7RA 5CPKC 1AKCA 3RBLA 1M18A 5G4IA 5BT1D 3EIAA 4Y0HA 4ADDA 5I92A 1E5EA 5B40C 3H0RC 3X1VD 4Y0IA 2JGTA 4IYOB 1S32A 3RUYA 1M19A 3UWCA 3WAAC 4WXFA 4XUJB 4DBCA 4Z66C 4AZKA 2Y2HA 3KSYA 1M1AC 2FQ6A 2RVQC 4WYCA 3AZED 2L5AA 3HT4A 4M2JA 3MGPA 1DFOA 5J8QA 1D7SA 3AYWB 4WYDA 3FVXA 1TASA 1F1EA 5IWQA 3A1IA 3AZEB 3X1TB 3TU4C 3UTBB 3WGBA 4ISYA 5TF5A 3AZJB 5B31B 3AEOA 3MVDB 4JF0A 3EI6A 1HQ3C 3TQXA 3RELC 4J8UD 3LZ1C 4K2MA 3FRKA 2QMAA 4Q76A 1P3FD 3LV2A 4J8UB 3NDNA 4LC3A 5AX8A 3W1IA 4H9OA 2D63A 5JAYA 3AZNC 1P3PD 1X29A 4R5ZA 3KWQD 4ZM4A 3QPGA 4WXGA 1EJIA 2PB2A 4K2IA 2CJHA 3KWQB 1M0QA 5GT0A 3B6GD 4DQ6A 2JJHA 3T32A 3FVSA 7AATA 1UU1A 5C3IC 4AWLC 4A0GA 4WYFA 5GSUD 3B6GB 1AHFA 3PD6B 3AZIA 3AV1A 1S07A 4FFCA 3L8AA 2HUFA 1WYVA 4XZQD 4ZLVA 3NQUA 4R8PA 2CANA 4MKKA 4BA4A 2A1VA 2X5FA 1AJSA 3W99D 2FJ7D 1P34D 4XZQB 3AZFD 4L0OA 2E7UA 3AZLC 3EPHA 4ZSWA 3A6ND 4RM1A 2BIEA 4F5GA 5M46A 2OATA 3BCBA 3A6NB 4RKDA 4WU8A 3ZRPA 3PDBA 1ZLAD 4UUZB 2OKKA 4OYTA 3B0DC 5F99A 3C1CC 1ZLAB 2F8NB 1H0CA 5GT3C 3X1UA 3WKJB 1P3IA 5B0YD 4MQPA 3IP4C 3ZRRA 3EIBA 3KFUG 3HVYA 4WNNB 1GBNA 3JTXA 1AOIC 2YCTA 2D5YA 4DGTA 3EZSA 5DNNA 2O7CA 4NFTA 1QIRA 4KYOA 5BNVB 4EMYA 2OKJA 3AOVA 2QA3A 4JJNA 1Z2CB 2W7HA 3AFAA 3X1VC 2PO3A 2EGYA 5AV8D 1KMJA 1KL2A 3N4XA 4ATQA 2CSTA 4ZUXD 3WTPD 1V2EA 1QJ3A 1GC4A 3UAKA 2Z9WA 3LVLB 4BQ0A 5AV5B 2VMUA 3MGQA 3L44A 5EFSA 1U35C 3HBXA 5B33A 1P3GD 3QI6A 3PIUA 2D66A 4Z5TA 5KDMB 4IYOA 1BJOA 4RITA 1P3FC 4Z2MH 5B32D 4BA5A 4IXSA
chains in the Genus database with same CATH topology
4YM6B 3LJAD 3AZKA 1W7MA 2BI5A 4HVKA 1P3PC 1IUGA 2W7GA 3LJAB 1DJEA 4XJOA 4J8WC 3MGSB 1P3KD 3NU8A 4GEBA 4R5FA 2IO5C 2BI3A 5DJ1A 3X1TA 3REKD 3UTBA 5B2IB 1P3KB 3QHXA 3AZJA 3RQ1A 1AHGA 5B31A 5GSUC 2AY9A 3REKB 1BW0A 3BWOA 3WA9A 3AEMC 1N1JB 4OBUA 3B6FA 1GC0A 3V9RA 4YS3D 2HUIA 2E7IA 2NQBD 2XH1A 5B24C 3W99C 2CFBA 2FJ7C 5DJ9A 3AZFC 1IX8A 1U08A 3REHC 3ASBA 2X3LA 5DNMD 3C1BC 3AOWA 1P3MC 5AVCA 3FDDA 3ZRQA 4E44A 5FUGA 2VLHA 1GEWA 5E4ZA 3MEBA 2GMSA 5EIGB 3RCHA 2KFPA 1RVYA 2HORA 1M7YA 4WBTA 1ASEA 2BYKA 1P3AA 5EUDA 1BH8B 5AVBD 2EH6A 3EI8A 4EFFA 1WYTB 1ZODA 3KXBD 1LC5A 1LW5A 3N7NA 5AVBB 5FT5A 1ZC9A 5HDMA 3BB8A 5DB5A 3KXBB 2HP2A 2OGAA 4WP0A 1MDZA 4X23C 5B0YC 3NTJA 4WU9A 4OMAA 5B2JD 4A0FA 3NQJA 4F5FA 5CPIB 3NNKA 4WYEA 2R5CB 1M18D 2VGVA 2ZY3A 3BWNC 4J8VA 1ASGA 5CPJB 1S32D 4KXKA 1M19D 3BCXA 2V1PA 1SZSA 4UUZA 1M19B 4K05A 2ZP7A 3RBFA 1XI9A 5AV8C 1ASAA 3FVUA 2Q7WA 1UU2A 3MGPD 2F8NA 4KGCC 4JF1A 3AZHA 2ZM5A 1EG5A 4ZUXC 2D64A 1Z7DA 3MGPB 3WTPC 1W3UA 4WNNA 3FD0A 1S0AA 2BYMB 2AROB 4ZBJC 5K8BA 2DGMA 2QB3A 2QBTA 1YAAA 1ASBA 4J8LA 1B5OA 1N8PA 4KUDD 1P3GC 1N2TA 2Y2MA 4ZDPA 2GQNA 4EU1A 4ZDOA 3REIC 3HQTA 3AV2D 1JFIA 3MAFA 4WLHA 4H9OB 5B32C 4E77A 1YJZA 5GT0D 2FM1A 4QLCB 3REJB 1D7UA 1AX4A 5EUEA 1AY5A 5GT0B 1PMMA 1FG7A 3LELA 2VGUA 1P3BC 3BC8A 3AZID 3AV1D 3CBFA 3QM2A 2EPJA 1BS0A 2VGSA 3W96D 5D5SA 5B1LB 2CV5C 3AZIB 3AV1B 2BI2A 2QLRA 4R8PD 5EAAA 5AV9D 1IAYA 2JISA 1V72A 1AJSB 2HIOA 4YS3C 3ISLA 2NQBC 2G5HC 4RIZA 1KX5D 1JS3A 4YM6A 1IAXA 2Z9VA 2CB1A 4H9QA 2CH2A 2YKVA 5DNMC 1F66D 1ORDA 1TOJA 2HP1A 4WU8D 3GZDC 3MGSA 3HDOA 4Y0DA 2J8PA 2PYOA 3VH5A 5B2IA 1ULYA 3PDBB 2G5IC 5F99D 3X1UD 1P3ID 1DJ9A 3DZZA 5F99B 5EQCA 1O62A 3X1UB 1B8GA 1AAWA 3AV7A 5JRGC 3WKRA 1CL1A 3DU4A 5DNND 5C3IB 3AELA 5B1MC 5B2JC 1BJ4A 1M18C 3AATA 3AN2D 3FDBA 1Q9CA 4ADBA 4AOAA 3B1EA 1JS6A 4BHDA 5AY8B 4JJNB 4F5JA 1S32C 3BS8A 3E9KA 3AFAB 1XEYA 2VGTA 4UPKA 1AMRA 3AZMB 3ASAA 1BH8A 3O62D 4F5KA 4UHOA 3WY7A 4MY5A 1WYTA 4H9SC 3F9TA 2Z1ZA 5BNXB 2XBNA 2OQXA 4GRXA 2QSRA 1OHWA 2TPLA 4OC9A 4ATPA 3DR7A 3MGQD 4UOYA 3MGRB 1SVVA 2W7JA 3K40A 4Z5TD 5B33B 1BQAA 1P3OA 2VI8A 3W97B 2W7KA 5CPJA 4Z5TB 1TARA 3W98A 4KUDC 4XUJD 1LC7A 4A6RA 3AZKD 1BJOB 2Y2JA 1QISA 2Z20A 1EQZA 2ZY5A 4WJ3C 2VMSA 3UT9A 3AV2C 1AY4A 3AZKB 2AY2A 3AYWD 3G8MA 4ZWVA 2Z9XA 2BI1A 3X1TD 3UTBD 3K7YA 3AZJD 4UHMA 4NE3A 5B31D 3MVDD 2HUUA 2BYMA 2AROA 1MDXA 2VMTA 5F9SA 3WCOA 4HF8A 3WA9D 1SFFA 5BS7C 3UTAA 2D7YA 1MAQA 3VK2A 3B6FD 3W96C 3WA9B 2JE5A 3UE8A 4R8PC 1KX4A 5AV9C 3B6FB 1OHVA 3V9RB 3EPJA 2VIAA 1Z3ZA 3ZZJA 3FZ8A 1TZYA 2NZDC 3NUIA 4H9RA 2ZY4A 1KX5C 4QLCA 1O61A 3REJA 3AEJC 2RFVA 5AVCB 3FSLA 4G91C 4Z2MG 1F66C 5FUGB 1AHYA 4WU8C 1AY8A 3RCHB 5G49B 3WAAA 1J04A 3AZGC 2BYKB 1P3AB 5B1LA 5CP6C 2FFFB 1M1AA 4LNJA 1P3IC 1BJNA 3DXVA 3VK4A 2W8WA 3FQAA 4CBRA 1ELUA 3EI9A 3II0A 4DRAA 1M6SA 3VH6A 3X1SC 3TU4A 1ID3C 2YOBA 4WU9B 3NQJB 5DNNC 4LD9C 1HQ3A 4J8VD 1G4XA 4MSOA 3RELA 2HUEB 9AATA 3TFTA 2YFVA 4J8VB 2QB2A 3AN2C 3FZ6A 4JEXA 2E7JA 4HGAB 2C81A 2F8ND 3AZHD 3WKJD 3AZNA 1P3LC 1CS1A 4AO4A 3O62C 4H63Q 3AZHB 3A9ZA 5E5AC 1OATA 4RAEA 3AEPA 3B1DA 1ASLA 3EZ1A 3MNNB 2G7JA 1TOEA 1MDOA 5DX5A 3N4SA 2AY6A 2AEVA 3E6GA 1KMKA 1FG3A 4NE6A 5AY8A 1C4KA 1TOIA 2X5DA 2W8JA 4DRBA 5BT1C 3KUYB 1G4VA 5KTBA 3EI7A 3JW9A 3LVMA 3AZMA 2JSSA 2Y2GA 4XUJC 2C7TA 2Y2LA 1JFIB 3MAFB 1I48A 2ZSLA 4CXQA 5E3KA 1W23A 1LS3A 5BNXA 2Z61A 3AYWC 5AV5D 1WWSA 4E3RA 4A0RA 3AZEC 3X1TC 3MGRA 3LELB 5B32G 3AZJC 4QGRA 5B31C 3MVDC 2ZUKA 1H1CA 1WKGA 3CQ6A 3VP6A 2O0RA 3C1CA 5GXQB 3W97A 2VMNA 5GT3A 1QJ5A 1FC4A 2HIOD 1AHEA 4J8UC 3PDXA 4YM6D 1IJIA 1AOIA 2HIOB 2YCPA 4ADEA 1OXOA 3MGSD 4H9QB 1P3WA 3CQ5A 3KWQC 2PYOD 3FKDA 5B2ID 3B6GC 2PYOB 4TN4A 1ASCA 4EO5C 1WKHA 4A6TA 1QGNA 3H7FA 1TAFA 1VP4A 5B0ZB 2F8NH 4Q6RA 1KX3B 4F5IA 4BMKA 5FT8A 4FL0A 1BJWA 4Q75A 4XZQC 2RIQA 1I41A 4OTLA 2CTZA 2YRIA 3Q8NA 3FQ7A 3NRAA 1TATA 4IW7A 4KHAA 1U35A 1P34C 4GE7A 3DYDA 4J8XB 2FKIA 2YCNA 4Q31A 1YIYA 2EZ2A 3A6NC 4M6BA 5G0AA 1AAMA 5G49A 1W2EA 2R5EA 3FCRA 4TMRA 4W5KA 1P3FA 2D61A 4H9PA 1DGDA 1ZLAC 3B8XA 3WKJC 2DGLA 2Y2QA 2AY8A 1C0NA 3P6KA 2HOXA 4ZSYA 2JCHA 4J8WA 1AHXA 5CPID 3LZ0B 1P3OD 5GSUA 3PA9A 5CPJD 1P3OB 5AV6B 4G92B 3W98D 4ZASA 3AEMA 2AEUA 3W98B 4W1WA 1LC8A 4OT8A 2YKYA 5B24A 3UT9D 1B9IA 2ZC0A 1GEYA 2FJ7A 2Y2PA 4JEVA 3AZFA 4WYGA 1EQZB 2DF4C 3REHA 3UT9B 3C1BA 3EUCA 2W7MA 1P3MA 3ACZA 5BJ4A 1S09A 1ZOBA 1ASMA 5G4JA 3MNNA 2AROD 4WD2A 4AH3A 5AV5C 4MQQA 3E77A 1AKAA 4RKCA 4U1TA 3UTAD 1V2FA 5G2QA 2AY4A 1RV4A 2Y2KA 3OP7A 3W1HA 3UTAB 1KX4D 2Y2OA 2D7ZA 1ARHA 3KUYA 1KX4B 2ZY2A 4NOGA 1PG8A 4X23A 1X28A 4XEWA 2W7LA 3I16A 1EQBA 5D95A 2NMPA 4YM6C 4QLCD 3REJD 4ITXA 1TZYB 5CPKB 4E45A 3LG0A 4H9RB 3LJAC 3F6TA 1DJUA 3K28A 1ARSA 2YKUA 3MGSC 2YRRA 5B40B 2VQRA 5HHYA 3COGA 4WV4B 5B2IC 1P3KC 5B1LD 1WSTA 2Z9UA 1M1AD 3MKJA 2RVQD 3REKC 3WAAB 1YIZA 5BO0A 4Z66B 5GXQA 3GZCA 2BI9A 4KGCA 1M1AB 3MC6A 3WGCA 3H0LC 1VJOA 1H3OB 5FT6A 3TU4D 3WTPA 4CVQA 1BQDA 2W7IA 3TU4B 1HQ3D 4WZSB 2O1BA 3RELD 2CINA 3VH5W 1YNUA 1HQ3B 3RELB 1P3GA 3ELPA 4A00A 2WK8A 1MGVA 3LZ1B 2YFVB 1TOGA 4IXZA 1AIBA 2VMQA 1GDEA 2R0TA 3F0HA 3REIA 3GETA 1GEXA 2DGKA 4CBSA 3R45B 5B0ZA 5B32A 3AZNB 3G7QA 1GD9A 1AICA 1C7GA 8AATA 1KX3A 2AY5A 5AVBC 3QGUA 1M0NA 1RV3A 2CJDA 4XJMA 1O69A 3KXBC 2PB0A 4GSAA 3HMUA 1AJRA 1P3BA 5CPIC 4B98A 4AWLB 4A6UA 2YKXA 3ATHA 2BIAA 3R4TA 4J8XA 2CV5A 1V2DA 1S08A 5AY8D 4JJND 4E3QA 3PJ0A 3WTPE 5CPJC 3JWBA 3AFAD 3AZMD 3GJUA 3CQ4A 1M19C 3M5UA 2NQBA 5M4BA 4U2HA 3FZ7A 1KL1A 3AZLB 2F2AC 1ASNA 3MGPC 4OCAA 3GZDA 3MGRD 3LZ0A 2AROC 4GE9A 5B33D 1WYUA 4H9NA 3W97D 4A72A 2VMPA 1M4NA 1ARGA 4XQ2A 5AV6A 2FNIA 3B0DB 3USFA 3C1CB 2BYLA 5GT3B 2VMRA 3VH5T 4LW4A 2CY8A 1AOID 5JRGA 5B1MA 2VMOA 5HXXA 1AOIB 5B2JA 3N4RA 2GB3A 2FNUA 4QLCC 1C7NA 4GE4A 2YFWA 3REJC 1HTAA 5GT0C 4OBVA 1E5FA 3N0LA 3NUBA 3X1VB 1AMQA 1SPAA 3A1KA 4WYAA 1LKCA 5B1LC 3AZIC 3AV1C 3PAAA 1TAFB 4H9SA 2CJGA 4IX8A 2GSAA 3ECDA 5G09A 5EUNA 4LNLA 3TFUA 1T3UA 1U35D 1UKJA 1MLZA 1SZUA 1UU0A 2JJFA 3LWSA 3KKIA 1GCKA 4KHAB 1U35B 5AVCD 2ZSMA 5CPKA 3WCNA 3FTBA 5BJ3A 3IHJA 4MKJA 4P3MA 5B40A 4KUDA 1P3AD 4KAMA 1ARIA 2XD1A 2W8SA 2LY8A 4N0WA 1P3FB 2CH1A 3B46A 4CAYA 4H9PB 4Z66A 2VMZA 3VH6W 3AV2A 3WKSA 5F99C 4J8WD 4F4EA 3X1UC 1P3PB 1IBJA 1H3OA 3E2ZA 4WU9D 4PIWA 2ZYJA 1B9HA 4J8WB 2W8TA 4XAUA 4LW2A 2IO5B 3H9XA 2F8NG 2DKBA 4EO5B 1LW4A 2EZ1A 5BS7A 5GSUB 3OKSA 3W96A 3AENA 2BWPA 2Y2NA 5AY8C 3LZ1A 4JJNC 3FFHA 3JZLA 1G7WA 5AV9A 5B24D 3AFAC 2BYJA 3KGWA 3AZMC 4W91A 3REHD 3R45A 2V0YA 5B24B 3W99B 3C1BD 2FJ7B 1P34B 1P3MD 3HLMA 3AZFB 2NZDA 2VYCA 1KX5A 3REHB 3C1BB 2C0RA 4AO9A 3R9AA 3MNND 1P3MB 3AEJA 2X8UA 2WKAA 3B0CW 1F66A 3MGRC 4WXBA 1B67A 2W7FA 3MGQC 3FFRA 1SF2A 1ASFA 3AZGA 1JF9A 5B33C 2OGEA 5CP6A 2WK9A 2VMYA 3W97C 4NE5A 3KUYD 4PFFA 4Z5TC 4X23D 1A7WA 1LK9A 4X23B 5B0YB 2HOZA 3X1SA 1ID3A 3VK3A 3LY1A 3AZKC 4LD9A 3AZLA 1DGEA 1OXPA 1CQ6A 3LELD 3VH6T 3AN2A 1ARTA 1B4XA 1CZCA 2JJGA 2W8UA 5FT4A 2W7DA 3LVKA 3UTBC 5GXQD 3NYUA 4KGCD 2BWOA 3P1TA 3EG5B 1P3LA 5AV8B 5BO0B 2W7EA 3O62A 1ELQA 1BH9A 3WA9C 4KGCB 1DTYA 5E5AA 1D2FA 4ZUXB 3B6FC 1M0OA 2JJEA 4JEZA 3WTPB 1MAPA 2CWEA 2ORDA 4W8IA 4GDYA 5M49A 2VMWA 1X2AA 4ZBJB 1T3IA 1DKAA 1GC3A 5AVCC 2YHKA 5F8VA 3KE3A 3BCAA 1P3GB 1C9CA 3REID 1AKBA 1S06A 3G0TA 1PFFA 3E2YA 2GMUA 3X1VA 4XUJA 5B0ZD 3REIB 2F8JA 1P3AC 3WZFA 5M4DA 3B0CT 1KX3D 2WB6A 5B32B 2BHXA 2VGWA 2EYQA 1ASDA 3VOMA 1B5PA 3AYWA 1P3BD 2DR1A 1B6WA 3B0BA 3AZEA 4H51A 1TOKA 4WU9C 4F5MA 3AL0C 1P3BB 4J8XD 2CV5D 3VAXA 3MVDA 3ELEA 1BT4A 1AMSA 2HUEC 2CV5B 5E5IA 3MAUA 4XK1A 2D65A 1RVUA 4W1XA 5EAVA 4J8VC 4WB0B 2WK7A 2DKJA 3P5JB 4P7YA 3A9XA 3DRDA 4J8UA 3NYSA 4WLJA 1W7NA 4HGAC 1CL2A 2EO5A 2VGZA 4CSRB 5JA4B 4YS3B 1VEFA 2NQBB 1I43A 2E54A 4DQYB 3AZHC 2ZJGA 1P3PA 1QZ9A 1CQ7A 3LZ0D 3KWQA 2Z1YA 4XJLA 5DNMB 4F5LA 2AY3A 3MNNC 1TPLA 1W7LA 2BG1A 3B6GA 3A9YA 3PD6A 1C7OA 1WYUB 3I5TA 5AV6D 3CAIA 4H9NB 1IX7A 2AY7A 4AZJA 3N5MA 1SZKA 2VMXA 1R4VA 3E2FA 2C44A 5JRGD 4W1VA 3KUYC 4IY7A 2UWXA 5B1MD 4XZQA 2BKWA 3A2BA 2FN6A 3BV0A 4ADCA 5JRGB 3TATA 1EQZD 3W99A 4RJ0A 5B1MB 1P34A 3QBOA 3QN6A 5B2JB 1M18B 2YFWB 1PZRA 3W1JA 3A6NA 3D6KA 3LELC 3WLXA 1MLYA 3MADA 1S32B 2HZPA 4PVFA 2W8VA 4IXOA 3KGXA 1ZLAA 5GXQC 3LVJA 1IX6A 3WKJA 4RLGA 3MC6C 1GC2A 4ITGA 4R2NA 4F5HA 3DR4A 1ECXA 4A0HA 5B0YA 2HIOC 3JWAA 1TZYD 3WX9A 5CPKD 1KKPA 3B1CA 1JG8A 5BNVA 1AIAA 4PFNA 5B40D 3HL2A 3BWNA 4UHNA 1YJSA 1G7XA 2AATA 1J32A 3GR9A 2PYOC 3GSBA 3WAAD 4KUDB 4Z66D 1BFMA 3DODA 2G6WA 1YOOA 5B0ZC 1X0MA 5AV8A 4CAYB 3AV2B 2HOYA 1N31A 1KX3C 1I29A 4ZUXA 2BIGA 1QITA 4I8AA 3E2ZB 4XJPA 4J5UA 5C6UA 5AV5A 4M2MA 4EB7A 4E1OA 4J8XC 2VIBA 3DXWA 3PGYA 3H0MC 3LZ1D 3I4JA 3W96B 1WYVB 3AENB 2R2NA 1YJYA 5KDMA 2VMVA 3NQUB 4R8PB 1M0PA 5AV9B 3NU7A 4ZDLA 2DOUA 3AZND 2NZDD 4RJYA 3BN1A 2NZDB 4O6ZA 3DC1A 1KX5B 3LJAA 4JEWA 3GBXA 3EPKA 3RI6A 3LZ0C 4G91B 3NYTA 1F66B 1BKGA 4WU8B 3AZGD 1AMAA 1P3KA 3PPLA 2FYFA 5CP6D 4B9BA 3REKA 3EI5A 3AZGB 1D7VA 4JEYA 2VLFA 4CXRA 5CHLB 5CP6B 5AV6C 4G92C 1P3OC 4EB5A 2DQNC 1N1JA 4WB0A 4ZM3A 1P3IB 5G2PA 1KU5A 2BWNA 3W98C 3X1SD 1ID3D 4M2KA 4MQRA 4CSRA 3FQ8A 5JA4A 1KKJA 1WWIA 4YS3A 3X1SB 3AZLD 1ID3B 4LD9D 1EQZC 5DNNB 3UT9C 2XD5A 4LD9B 3ZZKA 1CQ8A 5DNMA 2Y2IA 4ZAHA 1Y4IA 3NX3A 5EIGA 4LNMA 3AN2B 1OHYA 3EPLA 4K2BA 2AY1A 1P3LD 1CJ0A 3C1CD 1CZEA 1PMOA 2F8NK 1M32A 5GT3D 3UTAC 4UQVA 5E5AD 3N75A 4ZWMA 1P3LB 3O62B 4R8DA 5AVBA 1BH9B 2JG2A 5E5AB 1KX4C 3KXBA 3TCMA 5B31G 1O4SA 5CPIA 3MBBA 2R5CA 3MGQB 1IVRA 3GWPA 3A8UX 2VI9A 1TZYC 1D7RA 5CPKC 1AKCA 3RBLA 1M18A 5G4IA 5BT1D 3EIAA 4Y0HA 4ADDA 5I92A 1E5EA 5B40C 3H0RC 3X1VD 4Y0IA 2JGTA 4IYOB 1S32A 3RUYA 1M19A 3UWCA 3WAAC 4WXFA 4XUJB 4DBCA 4Z66C 4AZKA 2Y2HA 3KSYA 1M1AC 2FQ6A 2RVQC 4WYCA 3AZED 2L5AA 3HT4A 4M2JA 3MGPA 1DFOA 5J8QA 1D7SA 3AYWB 4WYDA 3FVXA 1TASA 1F1EA 5IWQA 3A1IA 3AZEB 3X1TB 3TU4C 3UTBB 3WGBA 4ISYA 5TF5A 3AZJB 5B31B 3AEOA 3MVDB 4JF0A 3EI6A 1HQ3C 3TQXA 3RELC 4J8UD 3LZ1C 4K2MA 3FRKA 2QMAA 4Q76A 1P3FD 3LV2A 4J8UB 3NDNA 4LC3A 5AX8A 3W1IA 4H9OA 2D63A 5JAYA 3AZNC 1P3PD 1X29A 4R5ZA 3KWQD 4ZM4A 3QPGA 4WXGA 1EJIA 2PB2A 4K2IA 2CJHA 3KWQB 1M0QA 5GT0A 3B6GD 4DQ6A 2JJHA 3T32A 3FVSA 7AATA 1UU1A 5C3IC 4AWLC 4A0GA 4WYFA 5GSUD 3B6GB 1AHFA 3PD6B 3AZIA 3AV1A 1S07A 4FFCA 3L8AA 2HUFA 1WYVA 4XZQD 4ZLVA 3NQUA 4R8PA 2CANA 4MKKA 4BA4A 2A1VA 2X5FA 1AJSA 3W99D 2FJ7D 1P34D 4XZQB 3AZFD 4L0OA 2E7UA 3AZLC 3EPHA 4ZSWA 3A6ND 4RM1A 2BIEA 4F5GA 5M46A 2OATA 3BCBA 3A6NB 4RKDA 4WU8A 3ZRPA 3PDBA 1ZLAD 4UUZB 2OKKA 4OYTA 3B0DC 5F99A 3C1CC 1ZLAB 2F8NB 1H0CA 5GT3C 3X1UA 3WKJB 1P3IA 5B0YD 4MQPA 3IP4C 3ZRRA 3EIBA 3KFUG 3HVYA 4WNNB 1GBNA 3JTXA 1AOIC 2YCTA 2D5YA 4DGTA 3EZSA 5DNNA 2O7CA 4NFTA 1QIRA 4KYOA 5BNVB 4EMYA 2OKJA 3AOVA 2QA3A 4JJNA 1Z2CB 2W7HA 3AFAA 3X1VC 2PO3A 2EGYA 5AV8D 1KMJA 1KL2A 3N4XA 4ATQA 2CSTA 4ZUXD 3WTPD 1V2EA 1QJ3A 1GC4A 3UAKA 2Z9WA 3LVLB 4BQ0A 5AV5B 2VMUA 3MGQA 3L44A 5EFSA 1U35C 3HBXA 5B33A 1P3GD 3QI6A 3PIUA 2D66A 4Z5TA 5KDMB 4IYOA 1BJOA 4RITA 1P3FC 4Z2MH 5B32D 4BA5A 4IXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KL1 A;  1W7M A;  2BI5 A;  2W8W A;  3FQA A;  1ECX A;  4CBR A;  4A0H A;  1ELU A;  3EI9 A;  3II0 A;  4HVK A;  1ASN A;  1M6S A;  1IUG A;  3JWA A;  2W7G A;  2YOB A;  3WX9 A;  1DJE A;  4OCA A;  3GZD A;  4XJO A;  1KKP A;  3B1C A;  3NU8 A;  4GEB A;  4R5F A;  1JG8 A;  1G4X A;  2BI3 A;  5DJ1 A;  1AIA A;  4PFN A;  4MSO A;  5M4B A;  4CXQ A;  9AAT A;  3TFT A;  4GE9 A;  1WYU A;  3QHX A;  3HL2 A;  3BWN A;  3RQ1 A;  1AHG A;  4UHN A;  1YJS A;  1G7X A;  2AY9 A;  2QB2 A;  2AAT A;  1J32 A;  3GR9 A;  4A72 A;  2VMP A;  1BW0 A;  1M4N A;  1ARG A;  4JEX A;  3GSB A;  4XQ2 A;  2E7J A;  2FNI A;  3BWO A;  3USF A;  3AEM C;  3DOD A;  2C81 A;  2BYL A;  2VMR A;  2G6W A;  1GC0 A;  1YOO A;  4LW4 A;  1X0M A;  2CY8 A;  1CS1 A;  2HUI A;  4AO4 A;  2E7I A;  2HOY A;  1N31 A;  2XH1 A;  1I29 A;  3A9Z A;  1OAT A;  2VMO A;  2CFB A;  5DJ9 A;  5HXX A;  2BIG A;  4RAE A;  1QIT A;  1IX8 A;  1U08 A;  2GB3 A;  3AEP A;  3ASB A;  1ASL A;  3B1D A;  3E2Z B;  3EZ1 A;  4I8A A;  4J5U A;  4XJP A;  5C6U A;  2FNU A;  1C7N A;  3AOW A;  4GE4 A;  4M2M A;  1TOE A;  3FDD A;  3ZRQ A;  1MDO A;  5DX5 A;  4EB7 A;  2VLH A;  4E1O A;  1GEW A;  5E4Z A;  3MEB A;  2VIB A;  3DXW A;  3PGY A;  2GMS A;  5EIG B;  2AY6 A;  3RCH A;  1RVY A;  3E6G A;  1E5F A;  1KMK A;  2HOR A;  1M7Y A;  3N0L A;  3NUB A;  3I4J A;  4WBT A;  1ASE A;  1WYV B;  3AEN B;  1AMQ A;  1SPA A;  1FG3 A;  2R2N A;  1YJY A;  4WYA A;  5EUD A;  1LKC A;  1TOI A;  1C4K A;  2X5D A;  2W8J A;  2VMV A;  1G4V A;  1M0P A;  3PAA A;  3NU7 A;  2EH6 A;  3EI8 A;  4EFF A;  1WYT B;  3EI7 A;  3JW9 A;  1ZOD A;  2CJG A;  3LVM A;  4ZDL A;  1LC5 A;  4IX8 A;  2DOU A;  1LW5 A;  2C7T A;  4RJY A;  2GSA A;  3ECD A;  3MAF B;  5FT5 A;  1I48 A;  1ZC9 A;  2ZSL A;  5EUN A;  5G09 A;  3BB8 A;  4LNL A;  5DB5 A;  5E3K A;  2HP2 A;  1W23 A;  2OGA A;  4WP0 A;  3BN1 A;  3TFU A;  1LS3 A;  1MDZ A;  3NTJ A;  4O6Z A;  3DC1 A;  1UKJ A;  2Z61 A;  1MLZ A;  4OMA A;  4A0F A;  4JEW A;  4F5F A;  1SZU A;  1UU0 A;  2JJF A;  3GBX A;  3LWS A;  3NNK A;  4WYE A;  4E3R A;  2R5C B;  3KKI A;  1GCK A;  4A0R A;  2VGV A;  3RI6 A;  2ZSM A;  3NYT A;  1BKG A;  2ZY3 A;  1AMA A;  3FTB A;  3PPL A;  2FYF A;  3BWN C;  5BJ3 A;  4B9B A;  3IHJ A;  4QGR A;  4MKJ A;  1ASG A;  3EI5 A;  2ZUK A;  4P3M A;  1H1C A;  1WKG A;  1D7V A;  3CQ6 A;  4KXK A;  4JEY A;  2VLF A;  3BCX A;  2O0R A;  4ADB A;  4CXR A;  2VMN A;  4KAM A;  1ARI A;  4EB5 A;  4N0W A;  2V1P A;  1SZS A;  4WB0 A;  4ZM3 A;  5G2P A;  1QJ5 A;  2CH1 A;  2ZP7 A;  3RBF A;  3B46 A;  2BWN A;  1FC4 A;  1XI9 A;  1ASA A;  2VMZ A;  3FVU A;  1AHE A;  3WKS A;  4M2K A;  2Q7W A;  4MQR A;  1UU2 A;  3PDX A;  4JF1 A;  4F4E A;  3FQ8 A;  1EG5 A;  1KKJ A;  1IJI A;  1IBJ A;  2YCP A;  2D64 A;  1Z7D A;  3E2Z A;  4PIW A;  1W3U A;  1B9H A;  2W8T A;  2ZYJ A;  4XAU A;  4ADE A;  4LW2 A;  1OXO A;  1S0A A;  1P3W A;  3ZZK A;  1CQ8 A;  3CQ5 A;  2DKB A;  3FKD A;  5K8B A;  1LW4 A;  2EZ1 A;  4ZAH A;  1Y4I A;  3NX3 A;  5EIG A;  2QB3 A;  4LNM A;  1OHY A;  2QBT A;  1YAA A;  4K2B A;  2AY1 A;  3OKS A;  1ASB A;  3AEN A;  4TN4 A;  1B5O A;  1N8P A;  2BWP A;  1ASC A;  1N2T A;  1WKH A;  4ZDP A;  1CJ0 A;  2GQN A;  4A6T A;  1CZE A;  1QGN A;  3FFH A;  4EU1 A;  1G7W A;  3H7F A;  1M32 A;  1VP4 A;  4UQV A;  5HDM A;  4ZDO A;  2BYJ A;  3N75 A;  4ZWM A;  4Q6R A;  3KGW A;  4W91 A;  4R8D A;  3HQT A;  2V0Y A;  4F5I A;  2JG2 A;  3MAF A;  4BMK A;  5FT8 A;  4WLH A;  3HLM A;  4E77 A;  2VYC A;  1YJZ A;  1BJW A;  4FL0 A;  4Q75 A;  3TCM A;  1I41 A;  1O4S A;  4OTL A;  2FM1 A;  2C0R A;  2CTZ A;  4AO9 A;  3R9A A;  3MBB A;  2YRI A;  3AEJ A;  3Q8N A;  1D7U A;  2R5C A;  3FQ7 A;  1AX4 A;  1IVR A;  1TAT A;  3NRA A;  4IW7 A;  5EUE A;  4GE7 A;  2X8U A;  3A8U X;  2VI9 A;  1AY5 A;  1D7R A;  2WKA A;  1AKC A;  3DYD A;  1FG7 A;  3RBL A;  2VGU A;  4WXB A;  3BC8 A;  2W7F A;  2YCN A;  5G4I A;  3CBF A;  3EIA A;  3FFR A;  3QM2 A;  2EPJ A;  4Q31 A;  4Y0H A;  1YIY A;  1BS0 A;  1SF2 A;  2EZ2 A;  4ADD A;  5I92 A;  1ASF A;  1JF9 A;  2VGS A;  1E5E A;  5D5S A;  4Y0I A;  2JGT A;  2OGE A;  5G0A A;  1AAM A;  2WK9 A;  2VMY A;  2BI2 A;  4IYO B;  2QLR A;  3RUY A;  5EAA A;  2R5E A;  4TMR A;  3FCR A;  4PFF A;  4W5K A;  2D61 A;  3UWC A;  4WXF A;  1IAY A;  4DBC A;  1DGD A;  4AZK A;  1V72 A;  3B8X A;  2FQ6 A;  1AJS B;  1LK9 A;  2HOZ A;  4WYC A;  2AY8 A;  3VK3 A;  1C0N A;  3ISL A;  3P6K A;  4M2J A;  2HOX A;  4ZSY A;  5J8Q A;  1DFO A;  1JS3 A;  3LY1 A;  1D7S A;  1IAX A;  4WYD A;  3FVX A;  1AHX A;  1TAS A;  2Z9V A;  2CB1 A;  5IWQ A;  1DGE A;  1OXP A;  2CH2 A;  2YKV A;  1CQ6 A;  3WGB A;  4ISY A;  1ORD A;  1TOJ A;  2HP1 A;  3GZD C;  5TF5 A;  3HDO A;  4Y0D A;  3PA9 A;  3AEO A;  4JF0 A;  3EI6 A;  1ART A;  1B4X A;  1CZC A;  2JJG A;  2W8U A;  5FT4 A;  3TQX A;  2W7D A;  3LVK A;  4ZAS A;  3PDB B;  3AEM A;  4K2M A;  3FRK A;  3NYU A;  2BWO A;  2QMA A;  4Q76 A;  3P1T A;  4W1W A;  1LC8 A;  2W7E A;  3LV2 A;  1DJ9 A;  3DZZ A;  1ELQ A;  3NDN A;  4OT8 A;  2YKY A;  4LC3 A;  1DTY A;  1B9I A;  1O62 A;  2ZC0 A;  5EQC A;  1D2F A;  1GEY A;  5AX8 A;  1B8G A;  4JEV A;  1AAW A;  1M0O A;  2D63 A;  2JJE A;  5JAY A;  4WYG A;  1X29 A;  4JEZ A;  3AV7 A;  4R5Z A;  3EUC A;  3WKR A;  1CL1 A;  3DU4 A;  2W7M A;  4ZM4 A;  3QPG A;  1MAP A;  3ACZ A;  4WXG A;  5BJ4 A;  1S09 A;  3AEL A;  1EJI A;  2ORD A;  1ZOB A;  4W8I A;  4GDY A;  5M49 A;  1ASM A;  5G4J A;  2PB2 A;  2VMW A;  4K2I A;  1X2A A;  2CJH A;  1M0Q A;  4DQ6 A;  1BJ4 A;  1T3I A;  2JJH A;  3T32 A;  1DKA A;  3FVS A;  4AH3 A;  4WD2 A;  1GC3 A;  7AAT A;  1UU1 A;  4MQQ A;  3AAT A;  3E77 A;  4A0G A;  4WYF A;  1AKA A;  4RKC A;  4U1T A;  2YHK A;  1AHF A;  3FDB A;  3KE3 A;  3PD6 B;  3BCA A;  1V2F A;  3B1E A;  5F8V A;  1JS6 A;  5G2Q A;  1C9C A;  2AY4 A;  1RV4 A;  4BHD A;  4FFC A;  1AKB A;  1S07 A;  3OP7 A;  1S06 A;  1PFF A;  3E2Y A;  3L8A A;  2GMU A;  4F5J A;  3BS8 A;  3E9K A;  2D7Z A;  2HUF A;  1ARH A;  2VGT A;  1WYV A;  1AMR A;  3ASA A;  2F8J A;  3WZF A;  5M4D A;  4ZLV A;  4F5K A;  2CAN A;  4MKK A;  4BA4 A;  4UHO A;  3WY7 A;  2ZY2 A;  2X5F A;  1AJS A;  4MY5 A;  4NOG A;  1PG8 A;  1WYT A;  3F9T A;  2Z1Z A;  1X28 A;  4XEW A;  2XBN A;  2OQX A;  4GRX A;  2BHX A;  2VGW A;  2W7L A;  1EQB A;  1OHW A;  2TPL A;  5D95 A;  2NMP A;  4OC9 A;  3VOM A;  1ASD A;  4L0O A;  1B5P A;  4ATP A;  2DR1 A;  2E7U A;  4ITX A;  3DR7 A;  4H51 A;  3LG0 A;  4UOY A;  4ZSW A;  1TOK A;  1SVV A;  4F5M A;  2BIE A;  3F6T A;  1DJU A;  3K28 A;  4F5G A;  1ARS A;  2W7J A;  2YKU A;  2YRR A;  5M46 A;  3VAX A;  2OAT A;  3BCB A;  3K40 A;  3ELE A;  1BT4 A;  4RKD A;  1AMS A;  1BQA A;  5HHY A;  3COG A;  2VI8 A;  5E5I A;  3ZRP A;  3MAU A;  3PDB A;  2D65 A;  1RVU A;  1WST A;  4W1X A;  4XK1 A;  5EAV A;  2W7K A;  2Z9U A;  4WB0 B;  3MKJ A;  2WK7 A;  1TAR A;  2DKJ A;  4P7Y A;  1YIZ A;  3A9X A;  3DRD A;  4OYT A;  3NYS A;  1LC7 A;  4WLJ A;  1W7N A;  3GZC A;  1CL2 A;  2BI9 A;  2EO5 A;  2VGZ A;  4A6R A;  1H0C A;  1BJO B;  3MC6 A;  3WGC A;  1QIS A;  1VEF A;  1VJO A;  2Z20 A;  2ZY5 A;  5FT6 A;  4MQP A;  2VMS A;  1I43 A;  1AY4 A;  2E54 A;  3EIB A;  3ZRR A;  4CVQ A;  2AY2 A;  2ZJG A;  1BQD A;  1GBN A;  1QZ9 A;  1CQ7 A;  3G8M A;  3JTX A;  4ZWV A;  2Z9X A;  2W7I A;  2YCT A;  2Z1Y A;  4XJL A;  2BI1 A;  2D5Y A;  4DGT A;  2O1B A;  3EZS A;  4F5L A;  2AY3 A;  2O7C A;  2CIN A;  3K7Y A;  1QIR A;  1YNU A;  1TPL A;  4KYO A;  1W7L A;  4UHM A;  4EMY A;  2HUU A;  3A9Y A;  3PD6 A;  1MDX A;  3ELP A;  4A00 A;  2WK8 A;  1C7O A;  1MGV A;  1WYU B;  3AOV A;  2QA3 A;  2VMT A;  5F9S A;  3I5T A;  3CAI A;  1TOG A;  4HF8 A;  4IXZ A;  1SFF A;  1IX7 A;  1AIB A;  2AY7 A;  2D7Y A;  2W7H A;  1MAQ A;  2VMQ A;  3N5M A;  1GDE A;  1SZK A;  2VMX A;  2R0T A;  3VK2 A;  3F0H A;  2PO3 A;  3GET A;  1GEX A;  2EGY A;  2C44 A;  3E2F A;  1KMJ A;  3UE8 A;  4CBS A;  1KL2 A;  4W1V A;  4ATQ A;  2CST A;  4IY7 A;  1OHV A;  4AOA A;  3G7Q A;  3A2B A;  1GD9 A;  1AIC A;  2BKW A;  1C7G A;  2FN6 A;  3BV0 A;  2VIA A;  8AAT A;  4ADC A;  3TAT A;  2AY5 A;  1Z3Z A;  3ZZJ A;  1V2E A;  3QGU A;  1M0N A;  1QJ3 A;  2CJD A;  1GC4 A;  1RV3 A;  4XJM A;  1O69 A;  4AZJ A;  2PB0 A;  4GSA A;  3UAK A;  2Z9W A;  3LVL B;  3HMU A;  3QBO A;  3QN6 A;  4BQ0 A;  3NUI A;  2ZY4 A;  1AJR A;  2VMU A;  1O61 A;  4B98 A;  3AEJ C;  2RFV A;  3L44 A;  4A6U A;  2YKX A;  3FSL A;  5EFS A;  3ATH A;  2BIA A;  3R4T A;  3D6K A;  1AHY A;  1AY8 A;  3QI6 A;  1V2D A;  1S08 A;  3PIU A;  3WLX A;  1MLY A;  3MAD A;  3RCH B;  4E3Q A;  2D66 A;  3PJ0 A;  2HZP A;  1J04 A;  4PVF A;  2W8V A;  3JWB A;  4IXO A;  3KGX A;  3GJU A;  3LVJ A;  3CQ4 A;  4IYO A;  1BJO A;  1IX6 A;  4LNJ A;  3MC6 C;  3M5U A;  1BJN A;  1GC2 A;  4ITG A;  4R2N A;  3DXV A;  4BA5 A;  4F5H A;  3VK4 A;  3DR4 A;  4U2H A;  4IXS A; 
#chains in the Genus database with same CATH topology
 4YM6 B;  3LJA D;  3AZK A;  1W7M A;  2BI5 A;  4HVK A;  1P3P C;  1IUG A;  2W7G A;  3LJA B;  1DJE A;  4XJO A;  4J8W C;  3MGS B;  1P3K D;  3NU8 A;  4GEB A;  4R5F A;  2IO5 C;  2BI3 A;  5DJ1 A;  3X1T A;  3REK D;  3UTB A;  5B2I B;  1P3K B;  3QHX A;  3AZJ A;  3RQ1 A;  1AHG A;  5B31 A;  5GSU C;  2AY9 A;  3REK B;  1BW0 A;  3BWO A;  3WA9 A;  3AEM C;  1N1J B;  4OBU A;  3B6F A;  1GC0 A;  3V9R A;  4YS3 D;  2HUI A;  2E7I A;  2NQB D;  2XH1 A;  5B24 C;  3W99 C;  2CFB A;  2FJ7 C;  5DJ9 A;  3AZF C;  1IX8 A;  1U08 A;  3REH C;  3ASB A;  2X3L A;  5DNM D;  3C1B C;  3AOW A;  1P3M C;  5AVC A;  3FDD A;  3ZRQ A;  4E44 A;  5FUG A;  2VLH A;  1GEW A;  5E4Z A;  3MEB A;  2GMS A;  5EIG B;  3RCH A;  2KFP A;  1RVY A;  2HOR A;  1M7Y A;  4WBT A;  1ASE A;  2BYK A;  1P3A A;  5EUD A;  1BH8 B;  5AVB D;  2EH6 A;  3EI8 A;  4EFF A;  1WYT B;  1ZOD A;  3KXB D;  1LC5 A;  1LW5 A;  3N7N A;  5AVB B;  5FT5 A;  1ZC9 A;  5HDM A;  3BB8 A;  5DB5 A;  3KXB B;  2HP2 A;  2OGA A;  4WP0 A;  1MDZ A;  4X23 C;  5B0Y C;  3NTJ A;  4WU9 A;  4OMA A;  5B2J D;  4A0F A;  3NQJ A;  4F5F A;  5CPI B;  3NNK A;  4WYE A;  2R5C B;  1M18 D;  2VGV A;  2ZY3 A;  3BWN C;  4J8V A;  1ASG A;  5CPJ B;  1S32 D;  4KXK A;  1M19 D;  3BCX A;  2V1P A;  1SZS A;  4UUZ A;  1M19 B;  4K05 A;  2ZP7 A;  3RBF A;  1XI9 A;  5AV8 C;  1ASA A;  3FVU A;  2Q7W A;  1UU2 A;  3MGP D;  2F8N A;  4KGC C;  4JF1 A;  3AZH A;  2ZM5 A;  1EG5 A;  4ZUX C;  2D64 A;  1Z7D A;  3MGP B;  3WTP C;  1W3U A;  4WNN A;  3FD0 A;  1S0A A;  2BYM B;  2ARO B;  4ZBJ C;  5K8B A;  2DGM A;  2QB3 A;  2QBT A;  1YAA A;  1ASB A;  4J8L A;  1B5O A;  1N8P A;  4KUD D;  1P3G C;  1N2T A;  2Y2M A;  4ZDP A;  2GQN A;  4EU1 A;  4ZDO A;  3REI C;  3HQT A;  3AV2 D;  1JFI A;  3MAF A;  4WLH A;  4H9O B;  5B32 C;  4E77 A;  1YJZ A;  5GT0 D;  2FM1 A;  4QLC B;  3REJ B;  1D7U A;  1AX4 A;  5EUE A;  1AY5 A;  5GT0 B;  1PMM A;  1FG7 A;  1KAF A;  3LEL A;  2VGU A;  1P3B C;  3BC8 A;  3AZI D;  3AV1 D;  3CBF A;  3QM2 A;  2EPJ A;  1BS0 A;  2VGS A;  3W96 D;  5D5S A;  5B1L B;  2CV5 C;  3AZI B;  3AV1 B;  2BI2 A;  2QLR A;  4R8P D;  5EAA A;  5AV9 D;  1IAY A;  2JIS A;  1V72 A;  1AJS B;  2HIO A;  4YS3 C;  3ISL A;  2NQB C;  2G5H C;  4RIZ A;  1KX5 D;  1JS3 A;  4YM6 A;  1IAX A;  2Z9V A;  2CB1 A;  4H9Q A;  2CH2 A;  2YKV A;  5DNM C;  1F66 D;  1ORD A;  1TOJ A;  2HP1 A;  4WU8 D;  3GZD C;  3MGS A;  3HDO A;  4Y0D A;  2J8P A;  2PYO A;  3VH5 A;  5B2I A;  1ULY A;  3PDB B;  2G5I C;  5F99 D;  3X1U D;  1P3I D;  1DJ9 A;  3DZZ A;  5F99 B;  5EQC A;  1O62 A;  3X1U B;  1B8G A;  1AAW A;  3AV7 A;  5JRG C;  3WKR A;  1CL1 A;  3DU4 A;  5DNN D;  5C3I B;  3AEL A;  5B1M C;  5B2J C;  1BJ4 A;  1M18 C;  3AAT A;  3AN2 D;  3FDB A;  1Q9C A;  4ADB A;  4AOA A;  3B1E A;  1JS6 A;  4BHD A;  5AY8 B;  4JJN B;  4F5J A;  1S32 C;  3BS8 A;  3E9K A;  3AFA B;  1XEY A;  2VGT A;  4UPK A;  1AMR A;  3AZM B;  3ASA A;  1BH8 A;  3O62 D;  4F5K A;  4UHO A;  3WY7 A;  4MY5 A;  1WYT A;  4H9S C;  3F9T A;  2Z1Z A;  5BNX B;  2XBN A;  2OQX A;  4GRX A;  2QSR A;  1OHW A;  2TPL A;  4OC9 A;  4ATP A;  3DR7 A;  3MGQ D;  4UOY A;  3MGR B;  1SVV A;  2W7J A;  3K40 A;  4Z5T D;  5B33 B;  1BQA A;  1P3O A;  2VI8 A;  3W97 B;  2W7K A;  5CPJ A;  4Z5T B;  1TAR A;  3W98 A;  4KUD C;  4XUJ D;  1LC7 A;  4A6R A;  3AZK D;  1BJO B;  2Y2J A;  1QIS A;  2Z20 A;  1EQZ A;  2ZY5 A;  4WJ3 C;  2VMS A;  3UT9 A;  3AV2 C;  1AY4 A;  3AZK B;  2AY2 A;  3AYW D;  3G8M A;  4ZWV A;  2Z9X A;  2BI1 A;  3X1T D;  3UTB D;  3K7Y A;  3AZJ D;  4UHM A;  4NE3 A;  5B31 D;  3MVD D;  2HUU A;  2BYM A;  2ARO A;  1MDX A;  2VMT A;  5F9S A;  3WCO A;  4HF8 A;  3WA9 D;  1SFF A;  5BS7 C;  3UTA A;  2D7Y A;  1MAQ A;  3VK2 A;  3B6F D;  3W96 C;  3WA9 B;  2JE5 A;  3UE8 A;  4R8P C;  1KX4 A;  5AV9 C;  3B6F B;  1OHV A;  3V9R B;  3EPJ A;  2VIA A;  1Z3Z A;  3ZZJ A;  3FZ8 A;  1TZY A;  2NZD C;  3NUI A;  4H9R A;  2ZY4 A;  1KX5 C;  4QLC A;  1O61 A;  3REJ A;  3AEJ C;  2RFV A;  5AVC B;  3FSL A;  4G91 C;  4Z2M G;  1F66 C;  5FUG B;  1AHY A;  4WU8 C;  1AY8 A;  3RCH B;  5G49 B;  3WAA A;  1J04 A;  3AZG C;  2BYK B;  1P3A B;  5B1L A;  5CP6 C;  2FFF B;  1M1A A;  4LNJ A;  1P3I C;  1BJN A;  3DXV A;  3VK4 A;  2W8W A;  3FQA A;  4CBR A;  1ELU A;  3EI9 A;  3II0 A;  4DRA A;  1M6S A;  3VH6 A;  3X1S C;  3TU4 A;  1ID3 C;  2YOB A;  4WU9 B;  3NQJ B;  5DNN C;  4LD9 C;  1HQ3 A;  4J8V D;  1G4X A;  4MSO A;  3REL A;  2HUE B;  9AAT A;  3TFT A;  2YFV A;  4J8V B;  2QB2 A;  3AN2 C;  3FZ6 A;  4JEX A;  2E7J A;  4HGA B;  2C81 A;  2F8N D;  3AZH D;  3WKJ D;  3AZN A;  1P3L C;  1CS1 A;  4AO4 A;  3O62 C;  4H63 Q;  3AZH B;  3A9Z A;  5E5A C;  1OAT A;  4RAE A;  3AEP A;  3B1D A;  1ASL A;  3EZ1 A;  3MNN B;  2G7J A;  1TOE A;  1MDO A;  5DX5 A;  3N4S A;  2AY6 A;  2AEV A;  3E6G A;  1KMK A;  1FG3 A;  4NE6 A;  5AY8 A;  1C4K A;  1TOI A;  2X5D A;  2W8J A;  4DRB A;  5BT1 C;  3KUY B;  1G4V A;  5KTB A;  3EI7 A;  3JW9 A;  3LVM A;  3AZM A;  2JSS A;  2Y2G A;  4XUJ C;  2C7T A;  2Y2L A;  1JFI B;  3MAF B;  1I48 A;  2ZSL A;  4CXQ A;  5E3K A;  1W23 A;  1LS3 A;  5BNX A;  2Z61 A;  3AYW C;  5AV5 D;  1WWS A;  4E3R A;  4A0R A;  3AZE C;  3X1T C;  3MGR A;  3LEL B;  5B32 G;  3AZJ C;  4QGR A;  5B31 C;  3MVD C;  2ZUK A;  1H1C A;  1WKG A;  3CQ6 A;  3VP6 A;  2O0R A;  3C1C A;  5GXQ B;  3W97 A;  2VMN A;  5GT3 A;  1QJ5 A;  1FC4 A;  2HIO D;  1AHE A;  4J8U C;  3PDX A;  4YM6 D;  1IJI A;  1AOI A;  2HIO B;  2YCP A;  4ADE A;  1OXO A;  3MGS D;  4H9Q B;  1P3W A;  3CQ5 A;  3KWQ C;  2PYO D;  3FKD A;  5B2I D;  3B6G C;  2PYO B;  4TN4 A;  1ASC A;  4EO5 C;  1WKH A;  4A6T A;  1QGN A;  3H7F A;  1TAF A;  1VP4 A;  5B0Z B;  2F8N H;  4Q6R A;  1KX3 B;  4F5I A;  4BMK A;  5FT8 A;  4FL0 A;  1BJW A;  4Q75 A;  4XZQ C;  2RIQ A;  1I41 A;  4OTL A;  2CTZ A;  2YRI A;  3Q8N A;  3FQ7 A;  3NRA A;  1TAT A;  4IW7 A;  4KHA A;  1U35 A;  1P34 C;  4GE7 A;  3DYD A;  4J8X B;  2FKI A;  2YCN A;  4Q31 A;  1YIY A;  2EZ2 A;  3A6N C;  4M6B A;  5G0A A;  1AAM A;  5G49 A;  1W2E A;  2R5E A;  3FCR A;  4TMR A;  4W5K A;  1P3F A;  2D61 A;  4H9P A;  1DGD A;  1ZLA C;  3B8X A;  3WKJ C;  2DGL A;  2Y2Q A;  2AY8 A;  1C0N A;  3P6K A;  2HOX A;  4ZSY A;  2JCH A;  4J8W A;  1AHX A;  5CPI D;  3LZ0 B;  1P3O D;  5GSU A;  3PA9 A;  5CPJ D;  1P3O B;  5AV6 B;  4G92 B;  3W98 D;  4ZAS A;  3AEM A;  2AEU A;  3W98 B;  4W1W A;  1LC8 A;  4OT8 A;  2YKY A;  5B24 A;  3UT9 D;  1B9I A;  2ZC0 A;  1GEY A;  2FJ7 A;  2Y2P A;  4JEV A;  3AZF A;  4WYG A;  1EQZ B;  2DF4 C;  3REH A;  3UT9 B;  3C1B A;  3EUC A;  2W7M A;  1P3M A;  3ACZ A;  5BJ4 A;  1S09 A;  1ZOB A;  1ASM A;  5G4J A;  3MNN A;  2ARO D;  4WD2 A;  4AH3 A;  5AV5 C;  4MQQ A;  3E77 A;  1AKA A;  4RKC A;  4U1T A;  3UTA D;  1V2F A;  5G2Q A;  2AY4 A;  1RV4 A;  2Y2K A;  3OP7 A;  3W1H A;  3UTA B;  1KX4 D;  2Y2O A;  2D7Z A;  1ARH A;  3KUY A;  1KX4 B;  2ZY2 A;  4NOG A;  1PG8 A;  4X23 A;  1X28 A;  4XEW A;  2W7L A;  3I16 A;  1EQB A;  5D95 A;  2NMP A;  4YM6 C;  4QLC D;  3REJ D;  4ITX A;  1TZY B;  5CPK B;  4E45 A;  3LG0 A;  4H9R B;  3LJA C;  3F6T A;  1DJU A;  3K28 A;  1ARS A;  2YKU A;  3MGS C;  2YRR A;  5B40 B;  2VQR A;  5HHY A;  3COG A;  4WV4 B;  5B2I C;  1P3K C;  5B1L D;  1WST A;  2Z9U A;  1M1A D;  3MKJ A;  2RVQ D;  3REK C;  3WAA B;  1YIZ A;  5BO0 A;  4Z66 B;  5GXQ A;  3GZC A;  2BI9 A;  4KGC A;  1M1A B;  3MC6 A;  3WGC A;  3H0L C;  1VJO A;  1H3O B;  5FT6 A;  3TU4 D;  3WTP A;  4CVQ A;  1BQD A;  2W7I A;  3TU4 B;  1HQ3 D;  4WZS B;  2O1B A;  3REL D;  2CIN A;  3VH5 W;  1YNU A;  1HQ3 B;  3REL B;  1P3G A;  3ELP A;  4A00 A;  2WK8 A;  1MGV A;  3LZ1 B;  2YFV B;  1TOG A;  4IXZ A;  1AIB A;  2VMQ A;  1GDE A;  2R0T A;  3F0H A;  3REI A;  3GET A;  1GEX A;  2DGK A;  4CBS A;  3R45 B;  5B0Z A;  5B32 A;  3AZN B;  3G7Q A;  1GD9 A;  1AIC A;  1C7G A;  8AAT A;  1KX3 A;  2AY5 A;  5AVB C;  3QGU A;  1M0N A;  1RV3 A;  2CJD A;  4XJM A;  1O69 A;  3KXB C;  2PB0 A;  4GSA A;  3HMU A;  1AJR A;  1P3B A;  5CPI C;  4B98 A;  4AWL B;  4A6U A;  2YKX A;  3ATH A;  2BIA A;  3R4T A;  4J8X A;  2CV5 A;  1V2D A;  1S08 A;  5AY8 D;  4JJN D;  4E3Q A;  3PJ0 A;  3WTP E;  5CPJ C;  3JWB A;  3AFA D;  3AZM D;  3GJU A;  3CQ4 A;  1M19 C;  3M5U A;  2NQB A;  5M4B A;  4U2H A;  3FZ7 A;  1KL1 A;  3AZL B;  2F2A C;  1ASN A;  3MGP C;  4OCA A;  3GZD A;  3MGR D;  3LZ0 A;  2ARO C;  4GE9 A;  5B33 D;  1WYU A;  4H9N A;  3W97 D;  4A72 A;  2VMP A;  1M4N A;  1ARG A;  4XQ2 A;  5AV6 A;  2FNI A;  3B0D B;  3USF A;  3C1C B;  2BYL A;  5GT3 B;  2VMR A;  3VH5 T;  4LW4 A;  2CY8 A;  1AOI D;  5JRG A;  5B1M A;  2VMO A;  5HXX A;  1AOI B;  5B2J A;  3N4R A;  2GB3 A;  2FNU A;  4QLC C;  1C7N A;  4GE4 A;  2YFW A;  3REJ C;  1HTA A;  5GT0 C;  4OBV A;  1E5F A;  3N0L A;  3NUB A;  3X1V B;  1AMQ A;  1SPA A;  3A1K A;  4WYA A;  1LKC A;  5B1L C;  3AZI C;  3AV1 C;  3PAA A;  1TAF B;  4H9S A;  2CJG A;  4IX8 A;  2GSA A;  3ECD A;  5G09 A;  5EUN A;  4LNL A;  3TFU A;  1T3U A;  1U35 D;  1UKJ A;  1MLZ A;  1SZU A;  1UU0 A;  2JJF A;  3LWS A;  3KKI A;  1GCK A;  4KHA B;  1U35 B;  5AVC D;  2ZSM A;  5CPK A;  3WCN A;  3FTB A;  5BJ3 A;  3IHJ A;  4MKJ A;  4P3M A;  5B40 A;  4KUD A;  1P3A D;  4KAM A;  1ARI A;  2XD1 A;  2W8S A;  2LY8 A;  4N0W A;  1P3F B;  2CH1 A;  3B46 A;  4CAY A;  4H9P B;  4Z66 A;  2VMZ A;  3VH6 W;  3AV2 A;  3WKS A;  5F99 C;  4J8W D;  4F4E A;  3X1U C;  1P3P B;  1IBJ A;  1H3O A;  3E2Z A;  4WU9 D;  4PIW A;  2ZYJ A;  1B9H A;  4J8W B;  2W8T A;  4XAU A;  4LW2 A;  2IO5 B;  3H9X A;  2F8N G;  2DKB A;  4EO5 B;  1LW4 A;  2EZ1 A;  5BS7 A;  5GSU B;  3OKS A;  3W96 A;  3AEN A;  2BWP A;  2Y2N A;  5AY8 C;  3LZ1 A;  4JJN C;  3FFH A;  3JZL A;  1G7W A;  5AV9 A;  5B24 D;  3AFA C;  2BYJ A;  3KGW A;  3AZM C;  4W91 A;  3REH D;  3R45 A;  2V0Y A;  5B24 B;  3W99 B;  3C1B D;  2FJ7 B;  1P34 B;  1P3M D;  3HLM A;  3AZF B;  2NZD A;  2VYC A;  1KX5 A;  3REH B;  3C1B B;  2C0R A;  4AO9 A;  3R9A A;  3MNN D;  1P3M B;  3AEJ A;  2X8U A;  2WKA A;  3B0C W;  1F66 A;  3MGR C;  4WXB A;  1B67 A;  2W7F A;  3MGQ C;  3FFR A;  1SF2 A;  1ASF A;  3AZG A;  1JF9 A;  5B33 C;  2OGE A;  5CP6 A;  2WK9 A;  2VMY A;  3W97 C;  4NE5 A;  3KUY D;  4PFF A;  4Z5T C;  4X23 D;  1A7W A;  1LK9 A;  4X23 B;  5B0Y B;  2HOZ A;  3X1S A;  1ID3 A;  3VK3 A;  3LY1 A;  3AZK C;  4LD9 A;  3AZL A;  1DGE A;  1OXP A;  1CQ6 A;  3LEL D;  3VH6 T;  3AN2 A;  1ART A;  1B4X A;  1CZC A;  2JJG A;  2W8U A;  5FT4 A;  2W7D A;  3LVK A;  3UTB C;  5GXQ D;  3NYU A;  4KGC D;  2BWO A;  3P1T A;  3EG5 B;  1P3L A;  5AV8 B;  5BO0 B;  2W7E A;  3O62 A;  1ELQ A;  1BH9 A;  3WA9 C;  4KGC B;  1DTY A;  5E5A A;  1D2F A;  4ZUX B;  3B6F C;  1M0O A;  2JJE A;  4JEZ A;  3WTP B;  1MAP A;  2CWE A;  2ORD A;  4W8I A;  4GDY A;  5M49 A;  2VMW A;  1X2A A;  4ZBJ B;  1T3I A;  1DKA A;  1GC3 A;  5AVC C;  2YHK A;  5F8V A;  3KE3 A;  3BCA A;  1P3G B;  1C9C A;  3REI D;  1AKB A;  1S06 A;  3G0T A;  1PFF A;  3E2Y A;  2GMU A;  3X1V A;  4XUJ A;  5B0Z D;  3REI B;  2F8J A;  1P3A C;  3WZF A;  5M4D A;  3B0C T;  1KX3 D;  2WB6 A;  5B32 B;  2BHX A;  2VGW A;  2EYQ A;  1ASD A;  3VOM A;  1B5P A;  3AYW A;  1P3B D;  2DR1 A;  1B6W A;  3B0B A;  3AZE A;  4H51 A;  1TOK A;  4WU9 C;  4F5M A;  3AL0 C;  1P3B B;  4J8X D;  2CV5 D;  3VAX A;  3MVD A;  3ELE A;  1BT4 A;  1AMS A;  2HUE C;  2CV5 B;  5E5I A;  3MAU A;  4XK1 A;  2D65 A;  1RVU A;  4W1X A;  5EAV A;  4J8V C;  4WB0 B;  2WK7 A;  2DKJ A;  3P5J B;  4P7Y A;  3A9X A;  3DRD A;  4J8U A;  3NYS A;  4WLJ A;  1W7N A;  4HGA C;  1CL2 A;  2EO5 A;  2VGZ A;  4CSR B;  5JA4 B;  4YS3 B;  1VEF A;  2NQB B;  1I43 A;  2E54 A;  4DQY B;  3AZH C;  2ZJG A;  1P3P A;  1QZ9 A;  1CQ7 A;  3LZ0 D;  3KWQ A;  2Z1Y A;  4XJL A;  5DNM B;  4F5L A;  2AY3 A;  3MNN C;  1TPL A;  1W7L A;  2BG1 A;  3B6G A;  3A9Y A;  3PD6 A;  1C7O A;  1WYU B;  3I5T A;  5AV6 D;  3CAI A;  4H9N B;  1IX7 A;  2AY7 A;  4AZJ A;  3N5M A;  1SZK A;  2VMX A;  1R4V A;  3E2F A;  2C44 A;  5JRG D;  4W1V A;  3KUY C;  4IY7 A;  2UWX A;  5B1M D;  4XZQ A;  2BKW A;  3A2B A;  2FN6 A;  3BV0 A;  4ADC A;  5JRG B;  3TAT A;  1EQZ D;  3W99 A;  4RJ0 A;  5B1M B;  1P34 A;  3QBO A;  3QN6 A;  5B2J B;  1M18 B;  2YFW B;  1PZR A;  3W1J A;  3A6N A;  3D6K A;  3LEL C;  3WLX A;  1MLY A;  3MAD A;  1S32 B;  2HZP A;  4PVF A;  2W8V A;  4IXO A;  3KGX A;  1ZLA A;  5GXQ C;  3LVJ A;  1IX6 A;  3WKJ A;  4RLG A;  3MC6 C;  1GC2 A;  4ITG A;  4R2N A;  4F5H A;  3DR4 A;  1ECX A;  4A0H A;  5B0Y A;  2HIO C;  3JWA A;  1TZY D;  3WX9 A;  5CPK D;  1KKP A;  3B1C A;  1JG8 A;  5BNV A;  1AIA A;  4PFN A;  5B40 D;  3HL2 A;  3BWN A;  4UHN A;  1YJS A;  1G7X A;  2AAT A;  1J32 A;  3GR9 A;  2PYO C;  3GSB A;  3WAA D;  4KUD B;  4Z66 D;  1BFM A;  3DOD A;  2G6W A;  1YOO A;  5B0Z C;  1X0M A;  5AV8 A;  4CAY B;  3AV2 B;  2HOY A;  1N31 A;  1KX3 C;  1I29 A;  4ZUX A;  2BIG A;  1QIT A;  4I8A A;  3E2Z B;  4XJP A;  4J5U A;  5C6U A;  5AV5 A;  4M2M A;  4EB7 A;  4E1O A;  4J8X C;  2VIB A;  3DXW A;  3PGY A;  3H0M C;  3LZ1 D;  3I4J A;  3W96 B;  1WYV B;  3AEN B;  2R2N A;  1YJY A;  5KDM A;  2VMV A;  3NQU B;  4R8P B;  1M0P A;  5AV9 B;  3NU7 A;  4ZDL A;  2DOU A;  3AZN D;  2NZD D;  4RJY A;  3BN1 A;  2NZD B;  4O6Z A;  3DC1 A;  1KX5 B;  3LJA A;  4JEW A;  3GBX A;  3EPK A;  3RI6 A;  3LZ0 C;  4G91 B;  3NYT A;  1F66 B;  1BKG A;  4WU8 B;  3AZG D;  1AMA A;  1P3K A;  3PPL A;  2FYF A;  5CP6 D;  4B9B A;  3REK A;  3EI5 A;  3AZG B;  1D7V A;  4JEY A;  2VLF A;  4CXR A;  5CHL B;  5CP6 B;  5AV6 C;  4G92 C;  1P3O C;  4EB5 A;  2DQN C;  1N1J A;  4WB0 A;  4ZM3 A;  1P3I B;  5G2P A;  1KU5 A;  2BWN A;  3W98 C;  3X1S D;  1ID3 D;  4M2K A;  4MQR A;  4CSR A;  3FQ8 A;  5JA4 A;  1KKJ A;  1WWI A;  4YS3 A;  3X1S B;  3AZL D;  1ID3 B;  4LD9 D;  1EQZ C;  5DNN B;  3UT9 C;  2XD5 A;  4LD9 B;  3ZZK A;  1CQ8 A;  5DNM A;  2Y2I A;  4ZAH A;  1Y4I A;  3NX3 A;  5EIG A;  4LNM A;  3AN2 B;  1OHY A;  3EPL A;  4K2B A;  2AY1 A;  1P3L D;  1CJ0 A;  3C1C D;  1CZE A;  1PMO A;  2F8N K;  1M32 A;  5GT3 D;  3UTA C;  4UQV A;  5E5A D;  3N75 A;  4ZWM A;  1P3L B;  3O62 B;  4R8D A;  5AVB A;  1BH9 B;  2JG2 A;  5E5A B;  1KX4 C;  3KXB A;  3TCM A;  5B31 G;  1O4S A;  5CPI A;  3MBB A;  2R5C A;  3MGQ B;  1IVR A;  3GWP A;  3A8U X;  2VI9 A;  1TZY C;  1D7R A;  5CPK C;  1AKC A;  3RBL A;  1M18 A;  5G4I A;  5BT1 D;  3EIA A;  4Y0H A;  4ADD A;  5I92 A;  1E5E A;  5B40 C;  3H0R C;  3X1V D;  4Y0I A;  2JGT A;  4IYO B;  1S32 A;  3RUY A;  1M19 A;  3UWC A;  3WAA C;  4WXF A;  4XUJ B;  4DBC A;  4Z66 C;  4AZK A;  2Y2H A;  3KSY A;  1M1A C;  2FQ6 A;  2RVQ C;  4WYC A;  3AZE D;  2L5A A;  3HT4 A;  4M2J A;  3MGP A;  1DFO A;  5J8Q A;  1D7S A;  3AYW B;  4WYD A;  3FVX A;  1TAS A;  1F1E A;  5IWQ A;  3A1I A;  3AZE B;  3X1T B;  3TU4 C;  3UTB B;  3WGB A;  4ISY A;  5TF5 A;  3AZJ B;  5B31 B;  3AEO A;  3MVD B;  4JF0 A;  3EI6 A;  1HQ3 C;  3TQX A;  3REL C;  4J8U D;  3LZ1 C;  4K2M A;  3FRK A;  2QMA A;  4Q76 A;  1P3F D;  3LV2 A;  4J8U B;  3NDN A;  4LC3 A;  5AX8 A;  3W1I A;  4H9O A;  2D63 A;  5JAY A;  3AZN C;  1P3P D;  1X29 A;  4R5Z A;  3KWQ D;  4ZM4 A;  3QPG A;  4WXG A;  1EJI A;  2PB2 A;  4K2I A;  2CJH A;  3KWQ B;  1M0Q A;  5GT0 A;  3B6G D;  4DQ6 A;  2JJH A;  3T32 A;  3FVS A;  7AAT A;  1UU1 A;  5C3I C;  4AWL C;  4A0G A;  4WYF A;  5GSU D;  3B6G B;  1AHF A;  3PD6 B;  3AZI A;  3AV1 A;  1S07 A;  4FFC A;  3L8A A;  2HUF A;  1WYV A;  4XZQ D;  4ZLV A;  3NQU A;  4R8P A;  2CAN A;  4MKK A;  4BA4 A;  2A1V A;  2X5F A;  1AJS A;  3W99 D;  2FJ7 D;  1P34 D;  4XZQ B;  3AZF D;  4L0O A;  2E7U A;  3AZL C;  3EPH A;  4ZSW A;  3A6N D;  4RM1 A;  2BIE A;  4F5G A;  5M46 A;  2OAT A;  3BCB A;  3A6N B;  4RKD A;  4WU8 A;  3ZRP A;  3PDB A;  1ZLA D;  4UUZ B;  2OKK A;  4OYT A;  3B0D C;  5F99 A;  3C1C C;  1ZLA B;  2F8N B;  1H0C A;  5GT3 C;  3X1U A;  3WKJ B;  1P3I A;  5B0Y D;  4MQP A;  3IP4 C;  3ZRR A;  3EIB A;  3KFU G;  3HVY A;  4WNN B;  1GBN A;  3JTX A;  1AOI C;  2YCT A;  2D5Y A;  4DGT A;  3EZS A;  5DNN A;  2O7C A;  4NFT A;  1QIR A;  4KYO A;  5BNV B;  4EMY A;  2OKJ A;  3AOV A;  2QA3 A;  4JJN A;  1Z2C B;  2W7H A;  3AFA A;  3X1V C;  2PO3 A;  2EGY A;  5AV8 D;  1KMJ A;  1KL2 A;  3N4X A;  4ATQ A;  2CST A;  4ZUX D;  3WTP D;  1V2E A;  1QJ3 A;  1GC4 A;  3UAK A;  2Z9W A;  3LVL B;  4BQ0 A;  5AV5 B;  2VMU A;  3MGQ A;  3L44 A;  5EFS A;  1U35 C;  3HBX A;  5B33 A;  1P3G D;  3QI6 A;  3PIU A;  2D66 A;  4Z5T A;  5KDM B;  4IYO A;  1BJO A;  4RIT A;  1P3F C;  4Z2M H;  5B32 D;  4BA5 A;  4IXS A; 
#chains in the Genus database with same CATH homology
 4YM6 B;  3LJA D;  3AZK A;  1W7M A;  2BI5 A;  4HVK A;  1P3P C;  1IUG A;  2W7G A;  3LJA B;  1DJE A;  4XJO A;  4J8W C;  3MGS B;  1P3K D;  3NU8 A;  4GEB A;  4R5F A;  2IO5 C;  2BI3 A;  5DJ1 A;  3X1T A;  3REK D;  3UTB A;  5B2I B;  1P3K B;  3QHX A;  3AZJ A;  3RQ1 A;  1AHG A;  5B31 A;  5GSU C;  2AY9 A;  3REK B;  1BW0 A;  3BWO A;  3WA9 A;  3AEM C;  1N1J B;  4OBU A;  3B6F A;  1GC0 A;  3V9R A;  4YS3 D;  2HUI A;  2E7I A;  2NQB D;  2XH1 A;  5B24 C;  3W99 C;  2CFB A;  2FJ7 C;  5DJ9 A;  3AZF C;  1IX8 A;  1U08 A;  3REH C;  3ASB A;  2X3L A;  5DNM D;  3C1B C;  3AOW A;  1P3M C;  5AVC A;  3FDD A;  3ZRQ A;  4E44 A;  5FUG A;  2VLH A;  1GEW A;  5E4Z A;  3MEB A;  2GMS A;  5EIG B;  3RCH A;  2KFP A;  1RVY A;  2HOR A;  1M7Y A;  4WBT A;  1ASE A;  2BYK A;  1P3A A;  5EUD A;  1BH8 B;  5AVB D;  2EH6 A;  3EI8 A;  4EFF A;  1WYT B;  1ZOD A;  3KXB D;  1LC5 A;  1LW5 A;  3N7N A;  5AVB B;  5FT5 A;  1ZC9 A;  5HDM A;  3BB8 A;  5DB5 A;  3KXB B;  2HP2 A;  2OGA A;  4WP0 A;  1MDZ A;  4X23 C;  5B0Y C;  3NTJ A;  4WU9 A;  4OMA A;  5B2J D;  4A0F A;  3NQJ A;  4F5F A;  5CPI B;  3NNK A;  4WYE A;  2R5C B;  1M18 D;  2VGV A;  2ZY3 A;  3BWN C;  4J8V A;  1ASG A;  5CPJ B;  1S32 D;  4KXK A;  1M19 D;  3BCX A;  2V1P A;  1SZS A;  4UUZ A;  1M19 B;  4K05 A;  2ZP7 A;  3RBF A;  1XI9 A;  5AV8 C;  1ASA A;  3FVU A;  2Q7W A;  1UU2 A;  3MGP D;  2F8N A;  4KGC C;  4JF1 A;  3AZH A;  2ZM5 A;  1EG5 A;  4ZUX C;  2D64 A;  1Z7D A;  3MGP B;  3WTP C;  1W3U A;  4WNN A;  3FD0 A;  1S0A A;  2BYM B;  2ARO B;  4ZBJ C;  5K8B A;  2DGM A;  2QB3 A;  2QBT A;  1YAA A;  1ASB A;  4J8L A;  1B5O A;  1N8P A;  4KUD D;  1P3G C;  1N2T A;  2Y2M A;  4ZDP A;  2GQN A;  4EU1 A;  4ZDO A;  3REI C;  3HQT A;  3AV2 D;  1JFI A;  3MAF A;  4WLH A;  4H9O B;  5B32 C;  4E77 A;  1YJZ A;  5GT0 D;  2FM1 A;  4QLC B;  3REJ B;  1D7U A;  1AX4 A;  5EUE A;  1AY5 A;  5GT0 B;  1PMM A;  1FG7 A;  3LEL A;  2VGU A;  1P3B C;  3BC8 A;  3AZI D;  3AV1 D;  3CBF A;  3QM2 A;  2EPJ A;  1BS0 A;  2VGS A;  3W96 D;  5D5S A;  5B1L B;  2CV5 C;  3AZI B;  3AV1 B;  2BI2 A;  2QLR A;  4R8P D;  5EAA A;  5AV9 D;  1IAY A;  2JIS A;  1V72 A;  1AJS B;  2HIO A;  4YS3 C;  3ISL A;  2NQB C;  2G5H C;  4RIZ A;  1KX5 D;  1JS3 A;  4YM6 A;  1IAX A;  2Z9V A;  2CB1 A;  4H9Q A;  2CH2 A;  2YKV A;  5DNM C;  1F66 D;  1ORD A;  1TOJ A;  2HP1 A;  4WU8 D;  3GZD C;  3MGS A;  3HDO A;  4Y0D A;  2J8P A;  2PYO A;  3VH5 A;  5B2I A;  1ULY A;  3PDB B;  2G5I C;  5F99 D;  3X1U D;  1P3I D;  1DJ9 A;  3DZZ A;  5F99 B;  5EQC A;  1O62 A;  3X1U B;  1B8G A;  1AAW A;  3AV7 A;  5JRG C;  3WKR A;  1CL1 A;  3DU4 A;  5DNN D;  5C3I B;  3AEL A;  5B1M C;  5B2J C;  1BJ4 A;  1M18 C;  3AAT A;  3AN2 D;  3FDB A;  1Q9C A;  4ADB A;  4AOA A;  3B1E A;  1JS6 A;  4BHD A;  5AY8 B;  4JJN B;  4F5J A;  1S32 C;  3BS8 A;  3E9K A;  3AFA B;  1XEY A;  2VGT A;  4UPK A;  1AMR A;  3AZM B;  3ASA A;  1BH8 A;  3O62 D;  4F5K A;  4UHO A;  3WY7 A;  4MY5 A;  1WYT A;  4H9S C;  3F9T A;  2Z1Z A;  5BNX B;  2XBN A;  2OQX A;  4GRX A;  2QSR A;  1OHW A;  2TPL A;  4OC9 A;  4ATP A;  3DR7 A;  3MGQ D;  4UOY A;  3MGR B;  1SVV A;  2W7J A;  3K40 A;  4Z5T D;  5B33 B;  1BQA A;  1P3O A;  2VI8 A;  3W97 B;  2W7K A;  5CPJ A;  4Z5T B;  1TAR A;  3W98 A;  4KUD C;  4XUJ D;  1LC7 A;  4A6R A;  3AZK D;  1BJO B;  2Y2J A;  1QIS A;  2Z20 A;  1EQZ A;  2ZY5 A;  4WJ3 C;  2VMS A;  3UT9 A;  3AV2 C;  1AY4 A;  3AZK B;  2AY2 A;  3AYW D;  3G8M A;  4ZWV A;  2Z9X A;  2BI1 A;  3X1T D;  3UTB D;  3K7Y A;  3AZJ D;  4UHM A;  4NE3 A;  5B31 D;  3MVD D;  2HUU A;  2BYM A;  2ARO A;  1MDX A;  2VMT A;  5F9S A;  3WCO A;  4HF8 A;  3WA9 D;  1SFF A;  5BS7 C;  3UTA A;  2D7Y A;  1MAQ A;  3VK2 A;  3B6F D;  3W96 C;  3WA9 B;  2JE5 A;  3UE8 A;  4R8P C;  1KX4 A;  5AV9 C;  3B6F B;  1OHV A;  3V9R B;  3EPJ A;  2VIA A;  1Z3Z A;  3ZZJ A;  3FZ8 A;  1TZY A;  2NZD C;  3NUI A;  4H9R A;  2ZY4 A;  1KX5 C;  4QLC A;  1O61 A;  3REJ A;  3AEJ C;  2RFV A;  5AVC B;  3FSL A;  4G91 C;  4Z2M G;  1F66 C;  5FUG B;  1AHY A;  4WU8 C;  1AY8 A;  3RCH B;  5G49 B;  3WAA A;  1J04 A;  3AZG C;  2BYK B;  1P3A B;  5B1L A;  5CP6 C;  2FFF B;  1M1A A;  4LNJ A;  1P3I C;  1BJN A;  3DXV A;  3VK4 A;  2W8W A;  3FQA A;  4CBR A;  1ELU A;  3EI9 A;  3II0 A;  4DRA A;  1M6S A;  3VH6 A;  3X1S C;  3TU4 A;  1ID3 C;  2YOB A;  4WU9 B;  3NQJ B;  5DNN C;  4LD9 C;  1HQ3 A;  4J8V D;  1G4X A;  4MSO A;  3REL A;  2HUE B;  9AAT A;  3TFT A;  2YFV A;  4J8V B;  2QB2 A;  3AN2 C;  3FZ6 A;  4JEX A;  2E7J A;  4HGA B;  2C81 A;  2F8N D;  3AZH D;  3WKJ D;  3AZN A;  1P3L C;  1CS1 A;  4AO4 A;  3O62 C;  4H63 Q;  3AZH B;  3A9Z A;  5E5A C;  1OAT A;  4RAE A;  3AEP A;  3B1D A;  1ASL A;  3EZ1 A;  3MNN B;  2G7J A;  1TOE A;  1MDO A;  5DX5 A;  3N4S A;  2AY6 A;  2AEV A;  3E6G A;  1KMK A;  1FG3 A;  4NE6 A;  5AY8 A;  1C4K A;  1TOI A;  2X5D A;  2W8J A;  4DRB A;  5BT1 C;  3KUY B;  1G4V A;  5KTB A;  3EI7 A;  3JW9 A;  3LVM A;  3AZM A;  2JSS A;  2Y2G A;  4XUJ C;  2C7T A;  2Y2L A;  1JFI B;  3MAF B;  1I48 A;  2ZSL A;  4CXQ A;  5E3K A;  1W23 A;  1LS3 A;  5BNX A;  2Z61 A;  3AYW C;  5AV5 D;  1WWS A;  4E3R A;  4A0R A;  3AZE C;  3X1T C;  3MGR A;  3LEL B;  5B32 G;  3AZJ C;  4QGR A;  5B31 C;  3MVD C;  2ZUK A;  1H1C A;  1WKG A;  3CQ6 A;  3VP6 A;  2O0R A;  3C1C A;  5GXQ B;  3W97 A;  2VMN A;  5GT3 A;  1QJ5 A;  1FC4 A;  2HIO D;  1AHE A;  4J8U C;  3PDX A;  4YM6 D;  1IJI A;  1AOI A;  2HIO B;  2YCP A;  4ADE A;  1OXO A;  3MGS D;  4H9Q B;  1P3W A;  3CQ5 A;  3KWQ C;  2PYO D;  3FKD A;  5B2I D;  3B6G C;  2PYO B;  4TN4 A;  1ASC A;  4EO5 C;  1WKH A;  4A6T A;  1QGN A;  3H7F A;  1TAF A;  1VP4 A;  5B0Z B;  2F8N H;  4Q6R A;  1KX3 B;  4F5I A;  4BMK A;  5FT8 A;  4FL0 A;  1BJW A;  4Q75 A;  4XZQ C;  2RIQ A;  1I41 A;  4OTL A;  2CTZ A;  2YRI A;  3Q8N A;  3FQ7 A;  3NRA A;  1TAT A;  4IW7 A;  4KHA A;  1U35 A;  1P34 C;  4GE7 A;  3DYD A;  4J8X B;  2FKI A;  2YCN A;  4Q31 A;  1YIY A;  2EZ2 A;  3A6N C;  4M6B A;  5G0A A;  1AAM A;  5G49 A;  1W2E A;  2R5E A;  3FCR A;  4TMR A;  4W5K A;  1P3F A;  2D61 A;  4H9P A;  1DGD A;  1ZLA C;  3B8X A;  3WKJ C;  2DGL A;  2Y2Q A;  2AY8 A;  1C0N A;  3P6K A;  2HOX A;  4ZSY A;  2JCH A;  4J8W A;  1AHX A;  5CPI D;  3LZ0 B;  1P3O D;  5GSU A;  3PA9 A;  5CPJ D;  1P3O B;  5AV6 B;  4G92 B;  3W98 D;  4ZAS A;  3AEM A;  2AEU A;  3W98 B;  4W1W A;  1LC8 A;  4OT8 A;  2YKY A;  5B24 A;  3UT9 D;  1B9I A;  2ZC0 A;  1GEY A;  2FJ7 A;  2Y2P A;  4JEV A;  3AZF A;  4WYG A;  1EQZ B;  2DF4 C;  3REH A;  3UT9 B;  3C1B A;  3EUC A;  2W7M A;  1P3M A;  3ACZ A;  5BJ4 A;  1S09 A;  1ZOB A;  1ASM A;  5G4J A;  3MNN A;  2ARO D;  4WD2 A;  4AH3 A;  5AV5 C;  4MQQ A;  3E77 A;  1AKA A;  4RKC A;  4U1T A;  3UTA D;  1V2F A;  5G2Q A;  2AY4 A;  1RV4 A;  2Y2K A;  3OP7 A;  3W1H A;  3UTA B;  1KX4 D;  2Y2O A;  2D7Z A;  1ARH A;  3KUY A;  1KX4 B;  2ZY2 A;  4NOG A;  1PG8 A;  4X23 A;  1X28 A;  4XEW A;  2W7L A;  3I16 A;  1EQB A;  5D95 A;  2NMP A;  4YM6 C;  4QLC D;  3REJ D;  4ITX A;  1TZY B;  5CPK B;  4E45 A;  3LG0 A;  4H9R B;  3LJA C;  3F6T A;  1DJU A;  3K28 A;  1ARS A;  2YKU A;  3MGS C;  2YRR A;  5B40 B;  2VQR A;  5HHY A;  3COG A;  4WV4 B;  5B2I C;  1P3K C;  5B1L D;  1WST A;  2Z9U A;  1M1A D;  3MKJ A;  2RVQ D;  3REK C;  3WAA B;  1YIZ A;  5BO0 A;  4Z66 B;  5GXQ A;  3GZC A;  2BI9 A;  4KGC A;  1M1A B;  3MC6 A;  3WGC A;  3H0L C;  1VJO A;  1H3O B;  5FT6 A;  3TU4 D;  3WTP A;  4CVQ A;  1BQD A;  2W7I A;  3TU4 B;  1HQ3 D;  4WZS B;  2O1B A;  3REL D;  2CIN A;  3VH5 W;  1YNU A;  1HQ3 B;  3REL B;  1P3G A;  3ELP A;  4A00 A;  2WK8 A;  1MGV A;  3LZ1 B;  2YFV B;  1TOG A;  4IXZ A;  1AIB A;  2VMQ A;  1GDE A;  2R0T A;  3F0H A;  3REI A;  3GET A;  1GEX A;  2DGK A;  4CBS A;  3R45 B;  5B0Z A;  5B32 A;  3AZN B;  3G7Q A;  1GD9 A;  1AIC A;  1C7G A;  8AAT A;  1KX3 A;  2AY5 A;  5AVB C;  3QGU A;  1M0N A;  1RV3 A;  2CJD A;  4XJM A;  1O69 A;  3KXB C;  2PB0 A;  4GSA A;  3HMU A;  1AJR A;  1P3B A;  5CPI C;  4B98 A;  4AWL B;  4A6U A;  2YKX A;  3ATH A;  2BIA A;  3R4T A;  4J8X A;  2CV5 A;  1V2D A;  1S08 A;  5AY8 D;  4JJN D;  4E3Q A;  3PJ0 A;  3WTP E;  5CPJ C;  3JWB A;  3AFA D;  3AZM D;  3GJU A;  3CQ4 A;  1M19 C;  3M5U A;  2NQB A;  5M4B A;  4U2H A;  3FZ7 A;  1KL1 A;  3AZL B;  2F2A C;  1ASN A;  3MGP C;  4OCA A;  3GZD A;  3MGR D;  3LZ0 A;  2ARO C;  4GE9 A;  5B33 D;  1WYU A;  4H9N A;  3W97 D;  4A72 A;  2VMP A;  1M4N A;  1ARG A;  4XQ2 A;  5AV6 A;  2FNI A;  3B0D B;  3USF A;  3C1C B;  2BYL A;  5GT3 B;  2VMR A;  3VH5 T;  4LW4 A;  2CY8 A;  1AOI D;  5JRG A;  5B1M A;  2VMO A;  5HXX A;  1AOI B;  5B2J A;  3N4R A;  2GB3 A;  2FNU A;  4QLC C;  1C7N A;  4GE4 A;  2YFW A;  3REJ C;  1HTA A;  5GT0 C;  4OBV A;  1E5F A;  3N0L A;  3NUB A;  3X1V B;  1AMQ A;  1SPA A;  3A1K A;  4WYA A;  1LKC A;  5B1L C;  3AZI C;  3AV1 C;  3PAA A;  1TAF B;  4H9S A;  2CJG A;  4IX8 A;  2GSA A;  3ECD A;  5G09 A;  5EUN A;  4LNL A;  3TFU A;  1T3U A;  1U35 D;  1UKJ A;  1MLZ A;  1SZU A;  1UU0 A;  2JJF A;  3LWS A;  3KKI A;  1GCK A;  4KHA B;  1U35 B;  5AVC D;  2ZSM A;  5CPK A;  3WCN A;  3FTB A;  5BJ3 A;  3IHJ A;  4MKJ A;  4P3M A;  5B40 A;  4KUD A;  1P3A D;  4KAM A;  1ARI A;  2XD1 A;  2W8S A;  2LY8 A;  4N0W A;  1P3F B;  2CH1 A;  3B46 A;  4CAY A;  4H9P B;  4Z66 A;  2VMZ A;  3VH6 W;  3AV2 A;  3WKS A;  5F99 C;  4J8W D;  4F4E A;  3X1U C;  1P3P B;  1IBJ A;  1H3O A;  3E2Z A;  4WU9 D;  4PIW A;  2ZYJ A;  1B9H A;  4J8W B;  2W8T A;  4XAU A;  4LW2 A;  2IO5 B;  3H9X A;  2F8N G;  2DKB A;  4EO5 B;  1LW4 A;  2EZ1 A;  5BS7 A;  5GSU B;  3OKS A;  3W96 A;  3AEN A;  2BWP A;  2Y2N A;  5AY8 C;  3LZ1 A;  4JJN C;  3FFH A;  3JZL A;  1G7W A;  5AV9 A;  5B24 D;  3AFA C;  2BYJ A;  3KGW A;  3AZM C;  4W91 A;  3REH D;  3R45 A;  2V0Y A;  5B24 B;  3W99 B;  3C1B D;  2FJ7 B;  1P34 B;  1P3M D;  3HLM A;  3AZF B;  2NZD A;  2VYC A;  1KX5 A;  3REH B;  3C1B B;  2C0R A;  4AO9 A;  3R9A A;  3MNN D;  1P3M B;  3AEJ A;  2X8U A;  2WKA A;  3B0C W;  1F66 A;  3MGR C;  4WXB A;  1B67 A;  2W7F A;  3MGQ C;  3FFR A;  1SF2 A;  1ASF A;  3AZG A;  1JF9 A;  5B33 C;  2OGE A;  5CP6 A;  2WK9 A;  2VMY A;  3W97 C;  4NE5 A;  3KUY D;  4PFF A;  4Z5T C;  4X23 D;  1A7W A;  1LK9 A;  4X23 B;  5B0Y B;  2HOZ A;  3X1S A;  1ID3 A;  3VK3 A;  3LY1 A;  3AZK C;  4LD9 A;  3AZL A;  1DGE A;  1OXP A;  1CQ6 A;  3LEL D;  3VH6 T;  3AN2 A;  1ART A;  1B4X A;  1CZC A;  2JJG A;  2W8U A;  5FT4 A;  2W7D A;  3LVK A;  3UTB C;  5GXQ D;  3NYU A;  4KGC D;  2BWO A;  3P1T A;  3EG5 B;  1P3L A;  5AV8 B;  5BO0 B;  2W7E A;  3O62 A;  1ELQ A;  1BH9 A;  3WA9 C;  4KGC B;  1DTY A;  5E5A A;  1D2F A;  4ZUX B;  3B6F C;  1M0O A;  2JJE A;  4JEZ A;  3WTP B;  1MAP A;  2CWE A;  2ORD A;  4W8I A;  4GDY A;  5M49 A;  2VMW A;  1X2A A;  4ZBJ B;  1T3I A;  1DKA A;  1GC3 A;  5AVC C;  2YHK A;  5F8V A;  3KE3 A;  3BCA A;  1P3G B;  1C9C A;  3REI D;  1AKB A;  1S06 A;  3G0T A;  1PFF A;  3E2Y A;  2GMU A;  3X1V A;  4XUJ A;  5B0Z D;  3REI B;  2F8J A;  1P3A C;  3WZF A;  5M4D A;  3B0C T;  1KX3 D;  2WB6 A;  5B32 B;  2BHX A;  2VGW A;  2EYQ A;  1ASD A;  3VOM A;  1B5P A;  3AYW A;  1P3B D;  2DR1 A;  1B6W A;  3B0B A;  3AZE A;  4H51 A;  1TOK A;  4WU9 C;  4F5M A;  3AL0 C;  1P3B B;  4J8X D;  2CV5 D;  3VAX A;  3MVD A;  3ELE A;  1BT4 A;  1AMS A;  2HUE C;  2CV5 B;  5E5I A;  3MAU A;  4XK1 A;  2D65 A;  1RVU A;  4W1X A;  5EAV A;  4J8V C;  4WB0 B;  2WK7 A;  2DKJ A;  3P5J B;  4P7Y A;  3A9X A;  3DRD A;  4J8U A;  3NYS A;  4WLJ A;  1W7N A;  4HGA C;  1CL2 A;  2EO5 A;  2VGZ A;  4CSR B;  5JA4 B;  4YS3 B;  1VEF A;  2NQB B;  1I43 A;  2E54 A;  4DQY B;  3AZH C;  2ZJG A;  1P3P A;  1QZ9 A;  1CQ7 A;  3LZ0 D;  3KWQ A;  2Z1Y A;  4XJL A;  5DNM B;  4F5L A;  2AY3 A;  3MNN C;  1TPL A;  1W7L A;  2BG1 A;  3B6G A;  3A9Y A;  3PD6 A;  1C7O A;  1WYU B;  3I5T A;  5AV6 D;  3CAI A;  4H9N B;  1IX7 A;  2AY7 A;  4AZJ A;  3N5M A;  1SZK A;  2VMX A;  1R4V A;  3E2F A;  2C44 A;  5JRG D;  4W1V A;  3KUY C;  4IY7 A;  2UWX A;  5B1M D;  4XZQ A;  2BKW A;  3A2B A;  2FN6 A;  3BV0 A;  4ADC A;  5JRG B;  3TAT A;  1EQZ D;  3W99 A;  4RJ0 A;  5B1M B;  1P34 A;  3QBO A;  3QN6 A;  5B2J B;  1M18 B;  2YFW B;  1PZR A;  3W1J A;  3A6N A;  3D6K A;  3LEL C;  3WLX A;  1MLY A;  3MAD A;  1S32 B;  2HZP A;  4PVF A;  2W8V A;  4IXO A;  3KGX A;  1ZLA A;  5GXQ C;  3LVJ A;  1IX6 A;  3WKJ A;  4RLG A;  3MC6 C;  1GC2 A;  4ITG A;  4R2N A;  4F5H A;  3DR4 A;  1ECX A;  4A0H A;  5B0Y A;  2HIO C;  3JWA A;  1TZY D;  3WX9 A;  5CPK D;  1KKP A;  3B1C A;  1JG8 A;  5BNV A;  1AIA A;  4PFN A;  5B40 D;  3HL2 A;  3BWN A;  4UHN A;  1YJS A;  1G7X A;  2AAT A;  1J32 A;  3GR9 A;  2PYO C;  3GSB A;  3WAA D;  4KUD B;  4Z66 D;  1BFM A;  3DOD A;  2G6W A;  1YOO A;  5B0Z C;  1X0M A;  5AV8 A;  4CAY B;  3AV2 B;  2HOY A;  1N31 A;  1KX3 C;  1I29 A;  4ZUX A;  2BIG A;  1QIT A;  4I8A A;  3E2Z B;  4XJP A;  4J5U A;  5C6U A;  5AV5 A;  4M2M A;  4EB7 A;  4E1O A;  4J8X C;  2VIB A;  3DXW A;  3PGY A;  3H0M C;  3LZ1 D;  3I4J A;  3W96 B;  1WYV B;  3AEN B;  2R2N A;  1YJY A;  5KDM A;  2VMV A;  3NQU B;  4R8P B;  1M0P A;  5AV9 B;  3NU7 A;  4ZDL A;  2DOU A;  3AZN D;  2NZD D;  4RJY A;  3BN1 A;  2NZD B;  4O6Z A;  3DC1 A;  1KX5 B;  3LJA A;  4JEW A;  3GBX A;  3EPK A;  3RI6 A;  3LZ0 C;  4G91 B;  3NYT A;  1F66 B;  1BKG A;  4WU8 B;  3AZG D;  1AMA A;  1P3K A;  3PPL A;  2FYF A;  5CP6 D;  4B9B A;  3REK A;  3EI5 A;  3AZG B;  1D7V A;  4JEY A;  2VLF A;  4CXR A;  5CHL B;  5CP6 B;  5AV6 C;  4G92 C;  1P3O C;  4EB5 A;  2DQN C;  1N1J A;  4WB0 A;  4ZM3 A;  1P3I B;  5G2P A;  1KU5 A;  2BWN A;  3W98 C;  3X1S D;  1ID3 D;  4M2K A;  4MQR A;  4CSR A;  3FQ8 A;  5JA4 A;  1KKJ A;  1WWI A;  4YS3 A;  3X1S B;  3AZL D;  1ID3 B;  4LD9 D;  1EQZ C;  5DNN B;  3UT9 C;  2XD5 A;  4LD9 B;  3ZZK A;  1CQ8 A;  5DNM A;  2Y2I A;  4ZAH A;  1Y4I A;  3NX3 A;  5EIG A;  4LNM A;  3AN2 B;  1OHY A;  3EPL A;  4K2B A;  2AY1 A;  1P3L D;  1CJ0 A;  3C1C D;  1CZE A;  1PMO A;  2F8N K;  1M32 A;  5GT3 D;  3UTA C;  4UQV A;  5E5A D;  3N75 A;  4ZWM A;  1P3L B;  3O62 B;  4R8D A;  5AVB A;  1BH9 B;  2JG2 A;  5E5A B;  1KX4 C;  3KXB A;  3TCM A;  5B31 G;  1O4S A;  5CPI A;  3MBB A;  2R5C A;  3MGQ B;  1IVR A;  3GWP A;  3A8U X;  2VI9 A;  1TZY C;  1D7R A;  5CPK C;  1AKC A;  3RBL A;  1M18 A;  5G4I A;  5BT1 D;  3EIA A;  4Y0H A;  4ADD A;  5I92 A;  1E5E A;  5B40 C;  3H0R C;  3X1V D;  4Y0I A;  2JGT A;  4IYO B;  1S32 A;  3RUY A;  1M19 A;  3UWC A;  3WAA C;  4WXF A;  4XUJ B;  4DBC A;  4Z66 C;  4AZK A;  2Y2H A;  3KSY A;  1M1A C;  2FQ6 A;  2RVQ C;  4WYC A;  3AZE D;  2L5A A;  3HT4 A;  4M2J A;  3MGP A;  1DFO A;  5J8Q A;  1D7S A;  3AYW B;  4WYD A;  3FVX A;  1TAS A;  1F1E A;  5IWQ A;  3A1I A;  3AZE B;  3X1T B;  3TU4 C;  3UTB B;  3WGB A;  4ISY A;  5TF5 A;  3AZJ B;  5B31 B;  3AEO A;  3MVD B;  4JF0 A;  3EI6 A;  1HQ3 C;  3TQX A;  3REL C;  4J8U D;  3LZ1 C;  4K2M A;  3FRK A;  2QMA A;  4Q76 A;  1P3F D;  3LV2 A;  4J8U B;  3NDN A;  4LC3 A;  5AX8 A;  3W1I A;  4H9O A;  2D63 A;  5JAY A;  3AZN C;  1P3P D;  1X29 A;  4R5Z A;  3KWQ D;  4ZM4 A;  3QPG A;  4WXG A;  1EJI A;  2PB2 A;  4K2I A;  2CJH A;  3KWQ B;  1M0Q A;  5GT0 A;  3B6G D;  4DQ6 A;  2JJH A;  3T32 A;  3FVS A;  7AAT A;  1UU1 A;  5C3I C;  4AWL C;  4A0G A;  4WYF A;  5GSU D;  3B6G B;  1AHF A;  3PD6 B;  3AZI A;  3AV1 A;  1S07 A;  4FFC A;  3L8A A;  2HUF A;  1WYV A;  4XZQ D;  4ZLV A;  3NQU A;  4R8P A;  2CAN A;  4MKK A;  4BA4 A;  2A1V A;  2X5F A;  1AJS A;  3W99 D;  2FJ7 D;  1P34 D;  4XZQ B;  3AZF D;  4L0O A;  2E7U A;  3AZL C;  3EPH A;  4ZSW A;  3A6N D;  4RM1 A;  2BIE A;  4F5G A;  5M46 A;  2OAT A;  3BCB A;  3A6N B;  4RKD A;  4WU8 A;  3ZRP A;  3PDB A;  1ZLA D;  4UUZ B;  2OKK A;  4OYT A;  3B0D C;  5F99 A;  3C1C C;  1ZLA B;  2F8N B;  1H0C A;  5GT3 C;  3X1U A;  3WKJ B;  1P3I A;  5B0Y D;  4MQP A;  3IP4 C;  3ZRR A;  3EIB A;  3KFU G;  3HVY A;  4WNN B;  1GBN A;  3JTX A;  1AOI C;  2YCT A;  2D5Y A;  4DGT A;  3EZS A;  5DNN A;  2O7C A;  4NFT A;  1QIR A;  4KYO A;  5BNV B;  4EMY A;  2OKJ A;  3AOV A;  2QA3 A;  4JJN A;  1Z2C B;  2W7H A;  3AFA A;  3X1V C;  2PO3 A;  2EGY A;  5AV8 D;  1KMJ A;  1KL2 A;  3N4X A;  4ATQ A;  2CST A;  4ZUX D;  3WTP D;  1V2E A;  1QJ3 A;  1GC4 A;  3UAK A;  2Z9W A;  3LVL B;  4BQ0 A;  5AV5 B;  2VMU A;  3MGQ A;  3L44 A;  5EFS A;  1U35 C;  3HBX A;  5B33 A;  1P3G D;  3QI6 A;  3PIU A;  2D66 A;  4Z5T A;  5KDM B;  4IYO A;  1BJO A;  4RIT A;  1P3F C;  4Z2M H;  5B32 D;  4BA5 A;  4IXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...