9AATA

X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase
Total Genus 150
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
150
sequence length
401
structure length
401
Chain Sequence
SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDINRDAWALRHFIEQGIDVVLSQSYAKNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ASPARTATE AMINOTRANSFERASE
publication title X-ray structure refinement and comparison of three forms of mitochondrial aspartate aminotransferase.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase(aminotransferase)
total genus 150
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature ec 2.6.1.1: Aspartate transaminase.
pdb deposition date 1991-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 9aatA02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 9aatA01
5FT4A 4GSAA 1I48A 3LV2A 1XEYA 4XQ2A 3BCAA 1G4VA 1FC4A 3GWPA 3FVSA 4GDYA 1UU2A 1B5PA 1V2EA 5LHAA 1TOIA 2VMYA 2VMXA 2W8UA 1JG8A 4A00A 4F5LA 1B8GA 3BN1A 4JE5A 3FRKA 4WYFA 2E7JA 1CZCA 3AENA 4UHOA 2YKXA 3NRAA 2C0RA 1ASCA 1C7OA 3GZCA 2YOBA 4M2KA 5EAVA 3MC6C 4WYCA 1LW4A 5D5SA 2YKYA 2VYCA 1MGVA 2E7UA 1W7NA 2OGAA 1SZUA 1DTYA 1TOKA 3H14A 1PG8A 4UQVA 3HBXA 1AMSA 1AKAA 3RI6A 2AY1A 2VMPA 1KL2A 3I16A 4RIZA 4W8IA 1EG5A 4N0BA 4MGRA 3E6GA 1MDZA 4AOAA 4IX8A 2QB3A 4RAEA 3WGCA 1TPLA 2D64A 3QPGA 4MQQA 2Z9UA 2D7ZA 1AMRA 4ADBA 2AY5A 4E77A 2GMUA 4A6RA 1TOEA 4ZM3A 2VGWA 3E2ZB 3UAKA 1J32A 3D6KA 3KGXA 2HUUA 4XJMA 1LKCA 1Z3ZA 4MQPA 4MKKA 2AATA 3WLXA 4XJOA 1AIBA 4NOGA 4RJ0A 1IAXA 1S07A 2QLRA 2CJHA 5EAAA 4AH3A 4OCAA 1LS3A 4P7YA 2VMSA 3RCHA 2JISA 3OP7A 4U1TA 2JG2A 3ZZJA 3QN6A 1H0CA 1M0OA 8AATA 3KGWA 4UHNA 1LC8A 2BI9A 2Z9VA 5EFSA 4Q6RA 1GC3A 1B5OA 2CB1A 4BA4A 1D7UA 4KYOA 5BJ4A 1BT4A 4M2JA 2VMWA 2VMZA 2R5CA 4F5MA 3N75A 3PA9A 4A0FA 2OGEA 2WK7A 4EMYA 1PMMA 2DOUA 2ZUKA 1W23A 1MAPA 4BA5A 4WD2A 1MLZA 4ATPA 3QHXA 1B4XA 1W7MA 1YJZA 3WY7A 4GE4A 1AHEA 4N0WA 1VJOA 1SF2A 2ZY3A 4RITA 1C4KA 2VI8A 4A6UA 2W7EA 4K2IA 4MY5A 2VLFA 1ARIA 3ASAA 3B1CA 3I5TA 4O6ZA 2QBTA 2W7JA 3GZDC 1PMOA 1JS3A 3MAFA 2VMTA 1YAAA 2VMNA 1AKBA 1ARSA 4WBTA 2D63A 5BJ3A 1VEFA 2HOXA 2BIEA 4RJYA 4ADCA 2CFBA 3EI5A 4IYOA 1N8PA 3WKSA 4RKCA 1QISA 1C7GA 3K40A 4RLGA 2VGSA 1YOOA 3I4JA 1GC4A 3GBXA 4WLJA 2W7KA 2D65A 3R9AA 3DC1A 3JW9A 2EPJA 4RM1A 1ARGA 1AICA 4R2NA 1UU0A 3GR9A 3A9ZA 3MKJA 1AJSB 3TATA 2W8JA 4TV7A 3P1TA 4ZDPA 2W8TA 4FL0A 1ELUA 2BHXA 3VP6A 1M32A 4ZDOA 1AAWA 4UOYA 3AATA 3BB8A 3PAAA 4JF0A 4OC9A 5EIGA 5HDMA 4F5GA 4ZWVA 5HXXA 3A2BA 2HZPA 1IAYA 1CQ6A 1Y4IA 1PFFA 1SZKA 1AHYA 2RFVA 2YKUA 1D2FA 3QI6A 2BIAA 1AMAA 4JEXA 4R5FA 2CTZA 3UWCA 2VGUA 5FT5A 2QA3A 2W7LA 3F9TA 3MADA 4J5UA 4EB5A 2VGZA 1WYVA 1W7LA 5E5IA 1YJYA 2YCPA 3BV0A 4W5KA 3AELA 2CH2A 2ZP7A 4WXFA 3EIBA 1M4NA 3E2FA 3QGUA 1V2FA 3IF2A 2YHKA 2DKBA 4XJPA 2AY9A 2YRRA 1QJ5A 1ZC9A 3P6KA 1T3IA 3MBBA 3ASBA 3VAXA 4EU1A 4XAUA 1LC5A 1KMJA 3NUIA 2YCTA 3B1EA 2CJDA 2Z67A 3A9XA 3FZ6A 2NMPA 5G09A 4AO4A 1ARHA 2W7FA 1ASEA 3II0A 5M4BA 3H7FA 3F0HA 4JEWA 4OYTA 2W7IA 3PPLA 2CJGA 3JTXA 1O69A 1OXOA 1O4SA 4QGRA 2D61A 4F5JA 1ORDA 3FQAA 3LVKA 4TN4A 2PB0A 2BIGA 3AEMC 1AAMA 1BJWA 3PDXA 3DXWA 3ELPA 3G8MA 4M2MA 4GE7A 1V72A 1SZSA 1TARA 1IX6A 1C0NA 1ASFA 2CINA 2E7IA 2EH6A 3JU7A 3JWBA 4ZSYA 3AV7A 2W7MA 5G4JA 3E2ZA 3CQ5A 2V0YA 1ASNA 3VK4A 2AY6A 5AX8A 2BI1A 3GETA 4OT8A 1DKAA 4UHMA 2CY8A 1M0PA 4ISYA 1ZOBA 3EUCA 3AEPA 5E3KA 4OTLA 4ADEA 4EB7A 1YNUA 3LVJA 1B9HA 3ELEA 3BCBA 3NDNA 4KAMA 3DU4A 3LG0A 1O61A 2AY3A 3FD0A 4OMAA 4A0RA 1OXPA 3ZRRA 2O7CA 3EZSA 1ECXA 3FFRA 3L8AA 2Z9WA 3NU8A 4ADDA 2VMQA 1WKGA 2FM1A 2JGTA 3BC8A 3A9YA 3BWOA 2VMRA 1IJIA 2TPLA 1DJUA 5EUDA 2WK8A 2EGYA 1WYUB 3MC6A 2FNIA 1AJRA 5EUEA 4ZLVA 1DFOA 3E2YA 4F5IA 3FKDA 1ASBA 1TOJA 2W7HA 1ASAA 3FTBA 1I41A 5M49A 4P3MA 5EUNA 1BJOB 1LK9A 4A6TA 4F5FA 4E3QA 1ASDA 5G4IA 1ARTA 1AY5A 1V2DA 2O0RA 1IVRA 3AOWA 3EI9A 5D95A 3W1HA 4IXZA 1SFFA 2W8WA 4ZSWA 2BWNA 3NYTA 3PJ0A 2VGTA 3VK3A 1ASLA 4DBCA 1JS6A 4MQRA 4WB0B 1BJ4A 2AY8A 3N5MA 3MEBA 4WYGA 1KKPA 4J8LA 1B9IA 3EIAA 3GJUA 1MAQA 4Y0HA 4A0GA 1EQBA 3F6TA 3M5UA 3PD6B 4WLHA 2DGKA 3B46A 2VI9A 4ZM4A 1DJEA 1X2AA 2VLHA 4GEBA 3USFA 2DGLA 4Y0DA 2VMOA 2W8VA 3FFHA 5G2QA 1LC7A 1OHVA 4R5ZA 2AY4A 3CQ6A 2JJGA 3FSLA 1M0NA 3ECDA 2R5EA 3G7QA 3RUYA 3DODA 1P3WA 3PDBB 1BS0A 5G2PA 4CXQA 2Q7WA 4CBSA 1WYTB 1MDOA 3TQXA 3NUBA 2BYJA 1AJSA 2D7YA 2JJEA 2VIBA 3FVXA 3KKIA 4Q31A 2C44A 1E5EA 2DGMA 4JE5D 3HDOA 3FDBA 3K7YA 4Q75A 3COGA 5LH9A 1S06A 3DYDA 1IX7A 2ZY4A 1OHWA 3N0LA 2F8JA 3LVMA 5C6UA 2FNUA 1IUGA 4ZDLA 3WKRA 2QB2A 2ZYJA 4RKDA 4JEVA 2D5YA 3FDDA 4K2MA 2JJHA 5I92A 4ITGA 2FYFA 1C9CA 4CBRA 4EFFA 1J04A 3BS8A 3GZDA 5M4DA 1RVUA 2X8UA 4A72A 1D7VA 2YRIA 2ZC0A 4BMKA 1QIRA 2Z1ZA 3DR7A 1IX8A 1GDEA 4GE9A 4LNJA 4PIWA 7AATA 3FZ7A 2BI3A 2ZJGA 4ZASA 2HORA 2C81A 3LWSA 4MKJA 3KE3A 3ZZKA 2ZY5A 2HP2A 2HP1A 3HQTA 3FVUA 3HVYA 2ZY2A 1AKCA 3WCOA 4E3RA 4PFNA 3DRDA 4XEWA 4I8AA 5F8VA 1AX4A 3WZFA 1ELQA 1SPAA 1BJNA 1AIAA 1N2TA 1QZ9A 2W7GA 2X3LA 4OBVA 4XJLA 1Z7DA 2Z61A 4Q76A 4W1XA 2DR1A 4AO9A 2VMUA 4R8DA 1CQ8A 1O62A 2AY2A 2E54A 2JJFA 3JZLA 4JEYA 3NNKA 4LW4A 4TMRA 3AENB 1GEYA 3CAIA 1I29A 5DX5A 3ACZA 5FT6A 2HUIA 4E1OA 1FG7A 3EI7A 1M0QA 1CZEA 1BKGA 4AZKA 3HMUA 4FFCA 1CJ0A 4A0HA 2ZSLA 1I43A 2XBNA 3WX9A 3AEJC 3NX3A 2BI2A 2EZ2A 1RV4A 4F5KA 5DJ1A 3A8UX 2V1PA 4WYDA 4BHDA 2HOZA 1D7SA 2GQNA 4WYAA 1AHFA 2Z1YA 4IXOA 2O1BA 1RVYA 1G7WA 3ATHA 3B8XA 3E9KA 5EQCA 3FQ8A 9AATA 2FQ6A 4WYEA 2ORDA 4PVFA 1QJ3A 2VMVA 2GB3A 1KL1A 1EJIA 3E77A 3CQ4A 1OHYA 2BWOA 3HT4A 3UE8A 4AZJA 2D66A 1GC2A 2G6WA 5G0AA 3R4TA 3RQ1A 1ASGA 1S0AA 1X28A 1CS1A 3Q8NA 1ZODA 5M46A 1GD9A 3FCRA 3NU7A 3WGBA 2QMAA 4DGTA 3RCHB 3LVLB 4KXKA 1XI9A 1WKHA 4GRXA 2YCNA 4B98A 3CBFA 2AY7A 2AEUA 1X29A 3RBLA 4XK1A 2XH1A 5FT8A 4U2HA 1M6SA 1QGNA 1DGDA 1WYUA 2R5CB 4IY7A 3VK2A 3JWAA 2ZSMA 4PFFA 1IBJA 3B1DA 1BJOA 3OKSA 3VOMA 1RV3A 3NYSA 1UKJA 2GMSA 5HHYA 3RBFA 3BCXA 1G4XA 3NTJA 1S09A 4OBUA 1G7XA 3AEMA 3G0TA 4DQ6A 3IHJA 1D7RA 3K28A 4F4EA 1GEWA 3QM2A 1AY8A 1C7NA 3LY1A 1AHGA 4JF1A 3MAUA 4W1WA 3TFTA 3AEJA 1GC0A 3NYUA 1ASMA 2BKWA 4F5HA 4WB0A 3QBOA 1DJ9A 2R2NA 2W7DA 2CANA 1MDXA 4WXGA 3AEOA 3MAFB 3W1JA 3TFUA 5TF5A 1BQAA 2Z9XA 4CVQA 1BW0A 1BQDA 3BWNC 3PD6A 4IXSA 2BI5A 4LNMA 4WXBA 1WSTA 4ZWMA 2FN6A 1TASA 4ITXA 2BWPA 2PB2A 4L0OA 1FG3A 1GEXA 1YIYA 2BYLA 2EZ1A 2OKKA 2OQXA 2PO3A 3ISLA 4IYOB 3DR4A 3T32A 5JAYA 2X5FA 2HUFA 4W91A 2Z20A 2AEVA 4B9BA 3PDBA 5DB5A 1CL2A 1H1CA 4CXRA 1X0MA 4W1VA 4IW7A 1WYTA 1VP4A 3DXVA 4LNLA 4WP0A 5DJ9A 5IWQA 4LW2A 1CL1A 2GSAA 1DGEA 1N31A 2WK9A 4MSOA 3DZZA 2CH1A 3W1IA 3EI6A 4ATQA 1GBNA 3AOVA 4JEZA 2C7TA 1AMQA 3ZRPA 5J8QA 2VGVA 1JF9A 3FZ8A 1YIZA 2OATA 5E4ZA 3WCNA 3ZRQA 3GSBA 2VIAA 4HF8A 5EIGB 1TOGA 3HL2A 1CQ7A 1KMKA 2CSTA 3HLMA 1UU1A 2DKJA 3EI8A 1AHXA 1QITA 1YJSA 1OATA 1U08A 1TATA 1MLYA 3FQ7A 2EO5A 4Y0IA 1S08A 2R0TA 1AY4A 3L44A 3PGYA 5K8BA 1GCKA 4ZAHA 4BQ0A 5F9SA 1WYVB 4H51A 2WKAA 2YKVA 1KKJA 2OKJA 3PIUA 1W3UA 4LC3A 4HVKA 3TCMA 1E5FA 3BWNA 2X5DA 1LW5A 1SVVA 3EZ1A 2HOYA 4K2BA 1M7YA
chains in the Genus database with same CATH superfamily
5FT4A 4GSAA 1I48A 3LV2A 1XEYA 4XQ2A 3BCAA 1G4VA 1FC4A 3GWPA 3FVSA 4GDYA 1UU2A 1B5PA 1V2EA 5LHAA 1TOIA 2VMYA 2VMXA 2W8UA 1JG8A 4A00A 4F5LA 1B8GA 3BN1A 4JE5A 3FRKA 4WYFA 5KTBA 2E7JA 1CZCA 3AENA 4UHOA 2YKXA 3NRAA 2C0RA 1ASCA 1C7OA 3GZCA 2YOBA 4M2KA 5EAVA 3MC6C 4WYCA 1LW4A 5D5SA 2YKYA 2VYCA 1MGVA 2E7UA 1W7NA 2OGAA 1SZUA 1DTYA 1TOKA 3H14A 1PG8A 4UQVA 2WB6A 3HBXA 1AMSA 1AKAA 3RI6A 2AY1A 2VMPA 1KL2A 3I16A 4RIZA 4W8IA 1EG5A 4N0BA 4MGRA 3E6GA 1MDZA 4AOAA 4IX8A 2QB3A 4RAEA 3WGCA 1TPLA 2D64A 3QPGA 4MQQA 2Z9UA 2D7ZA 1AMRA 4ADBA 2AY5A 4E77A 2GMUA 4A6RA 1TOEA 4ZM3A 2VGWA 3E2ZB 3UAKA 1J32A 3D6KA 3KGXA 2HUUA 4XJMA 1LKCA 1Z3ZA 4MQPA 4MKKA 2AATA 3WLXA 4XJOA 1AIBA 4NOGA 4RJ0A 1IAXA 1S07A 2QLRA 2CJHA 5EAAA 4AH3A 4OCAA 1LS3A 4P7YA 2VMSA 3RCHA 2JISA 3OP7A 4U1TA 2JG2A 3ZZJA 3QN6A 1H0CA 1M0OA 8AATA 3KGWA 4UHNA 1LC8A 2BI9A 2Z9VA 5EFSA 4Q6RA 1GC3A 1B5OA 2CB1A 4BA4A 1D7UA 4KYOA 5BJ4A 1BT4A 4M2JA 2VMWA 2VMZA 2R5CA 4F5MA 3N75A 3PA9A 4A0FA 2OGEA 2WK7A 4EMYA 1PMMA 2DOUA 2ZUKA 1W23A 1MAPA 4BA5A 4WD2A 1MLZA 4ATPA 3QHXA 1B4XA 1W7MA 1YJZA 3WY7A 4GE4A 1AHEA 4N0WA 1VJOA 1SF2A 2ZY3A 4RITA 1C4KA 2VI8A 4A6UA 2W7EA 4K2IA 4MY5A 2VLFA 1ARIA 3ASAA 3B1CA 3I5TA 4O6ZA 2QBTA 2W7JA 3GZDC 1PMOA 1JS3A 3MAFA 2VMTA 1YAAA 2VMNA 1AKBA 1ARSA 4WBTA 2D63A 5BJ3A 4H63Q 1VEFA 2HOXA 2BIEA 4RJYA 4ADCA 2CFBA 3EI5A 4IYOA 1N8PA 3WKSA 4RKCA 1QISA 1C7GA 3K40A 4RLGA 2VGSA 1YOOA 3I4JA 1GC4A 3GBXA 4WLJA 2W7KA 2D65A 3R9AA 3DC1A 3JW9A 2EPJA 4RM1A 1ARGA 1AICA 4R2NA 1UU0A 3GR9A 3A9ZA 3MKJA 1AJSB 3TATA 2W8JA 4TV7A 3P1TA 4ZDPA 2W8TA 4FL0A 1ELUA 2BHXA 3VP6A 1M32A 4ZDOA 1AAWA 4UOYA 3AATA 3BB8A 3PAAA 4JF0A 4OC9A 5EIGA 5HDMA 4F5GA 4ZWVA 5HXXA 3A2BA 2HZPA 1IAYA 1CQ6A 1Y4IA 1PFFA 1SZKA 1AHYA 2RFVA 2YKUA 1D2FA 3QI6A 2BIAA 1AMAA 4JEXA 4R5FA 2CTZA 3UWCA 2VGUA 5FT5A 2QA3A 2W7LA 3F9TA 3MADA 4J5UA 4EB5A 2VGZA 1WYVA 1W7LA 5E5IA 1YJYA 2YCPA 3BV0A 4W5KA 3AELA 2CH2A 2ZP7A 4WXFA 3EIBA 1M4NA 3E2FA 3QGUA 1V2FA 3IF2A 2YHKA 2DKBA 4XJPA 2AY9A 2YRRA 1QJ5A 1ZC9A 3P6KA 1T3IA 3MBBA 3ASBA 3VAXA 4EU1A 4XAUA 1LC5A 1KMJA 3NUIA 2YCTA 3B1EA 2CJDA 2Z67A 3A9XA 3FZ6A 2NMPA 5G09A 4AO4A 1ARHA 2W7FA 1ASEA 3II0A 5M4BA 3H7FA 3F0HA 4JEWA 4OYTA 2W7IA 3PPLA 2CJGA 3JTXA 1O69A 1OXOA 1O4SA 4QGRA 2D61A 4F5JA 1ORDA 3FQAA 3LVKA 4TN4A 2EYQA 2PB0A 2BIGA 3AEMC 1AAMA 1BJWA 3PDXA 3DXWA 3ELPA 3G8MA 4M2MA 4GE7A 1V72A 1SZSA 1TARA 1IX6A 1C0NA 1ASFA 2CINA 2E7IA 2EH6A 3JU7A 3JWBA 4ZSYA 3AV7A 2W7MA 5G4JA 3E2ZA 3CQ5A 2V0YA 1ASNA 3VK4A 2AY6A 5AX8A 2BI1A 3GETA 4OT8A 1DKAA 4UHMA 2CY8A 1M0PA 4ISYA 1ZOBA 3EUCA 3AEPA 5E3KA 4OTLA 4ADEA 4EB7A 1YNUA 3LVJA 1B9HA 3ELEA 3BCBA 3NDNA 4KAMA 3DU4A 3LG0A 1O61A 2AY3A 3FD0A 4OMAA 4A0RA 1OXPA 3ZRRA 2O7CA 3EZSA 1ECXA 3FFRA 3L8AA 2Z9WA 3NU8A 4ADDA 2VMQA 1WKGA 2FM1A 2JGTA 3BC8A 3A9YA 3BWOA 2VMRA 1IJIA 2TPLA 2KFPA 1DJUA 5EUDA 2WK8A 2QSRA 2EGYA 1WYUB 3MC6A 2FNIA 1AJRA 5EUEA 4ZLVA 1DFOA 3E2YA 4F5IA 3FKDA 1ASBA 1TOJA 2W7HA 1ASAA 3FTBA 1I41A 5M49A 4P3MA 3H9XA 5EUNA 1BJOB 1LK9A 4A6TA 4F5FA 4E3QA 1ASDA 5G4IA 1ARTA 1AY5A 1V2DA 2O0RA 1IVRA 3AOWA 3EI9A 5D95A 3W1HA 4IXZA 1SFFA 2W8WA 4ZSWA 2BWNA 3NYTA 3PJ0A 2VGTA 3VK3A 1ASLA 4DBCA 1JS6A 4MQRA 4WB0B 1BJ4A 2AY8A 3N5MA 3MEBA 4WYGA 1KKPA 4J8LA 1B9IA 3EIAA 3GJUA 1MAQA 4Y0HA 4A0GA 1EQBA 3F6TA 3M5UA 3PD6B 4WLHA 2DGKA 3B46A 2VI9A 4ZM4A 1DJEA 1X2AA 2VLHA 4GEBA 3USFA 2DGLA 4Y0DA 2VMOA 2W8VA 3FFHA 5G2QA 1LC7A 1OHVA 4R5ZA 2AY4A 3CQ6A 2JJGA 3FSLA 1M0NA 3ECDA 2R5EA 3G7QA 3RUYA 3DODA 1P3WA 3PDBB 1BS0A 5G2PA 4CXQA 2Q7WA 4CBSA 1WYTB 1MDOA 3TQXA 3NUBA 2BYJA 1AJSA 2D7YA 2JJEA 2VIBA 3FVXA 3KKIA 4Q31A 2C44A 1E5EA 2DGMA 4JE5D 3HDOA 3FDBA 3K7YA 4Q75A 3COGA 5LH9A 1S06A 3DYDA 1IX7A 2ZY4A 1OHWA 3N0LA 2F8JA 3LVMA 5C6UA 2FNUA 1IUGA 4ZDLA 3WKRA 2QB2A 2ZYJA 4RKDA 4JEVA 2D5YA 3FDDA 4K2MA 2JJHA 5I92A 4ITGA 2FYFA 1C9CA 4CBRA 4EFFA 1J04A 3BS8A 3GZDA 5M4DA 1RVUA 2X8UA 4A72A 1D7VA 2A1VA 2YRIA 2ZC0A 4BMKA 1QIRA 2Z1ZA 3DR7A 1IX8A 1GDEA 4GE9A 4LNJA 4PIWA 7AATA 3FZ7A 2BI3A 2ZJGA 4ZASA 2HORA 2C81A 3LWSA 4MKJA 3KE3A 3ZZKA 2ZY5A 2HP2A 2HP1A 3HQTA 3FVUA 3HVYA 2ZY2A 1AKCA 3WCOA 4E3RA 4PFNA 3DRDA 4XEWA 4I8AA 5F8VA 1AX4A 3WZFA 1ELQA 1SPAA 1BJNA 1AIAA 1N2TA 1QZ9A 2W7GA 2X3LA 4OBVA 4XJLA 1Z7DA 2Z61A 4Q76A 4W1XA 2DR1A 4AO9A 2VMUA 4R8DA 1CQ8A 1O62A 2AY2A 2E54A 2JJFA 3JZLA 4JEYA 3NNKA 4LW4A 4TMRA 3AENB 1GEYA 3CAIA 1I29A 5DX5A 3ACZA 5FT6A 2HUIA 4E1OA 1FG7A 3EI7A 1M0QA 1CZEA 1BKGA 4AZKA 3HMUA 4FFCA 1CJ0A 4A0HA 2ZSLA 1I43A 2XBNA 3WX9A 3AEJC 3NX3A 2BI2A 2EZ2A 1RV4A 4F5KA 5DJ1A 3A8UX 2V1PA 4WYDA 4BHDA 2HOZA 1D7SA 2GQNA 4WYAA 1AHFA 2Z1YA 4IXOA 2O1BA 1RVYA 1G7WA 3ATHA 3B8XA 3E9KA 5EQCA 3FQ8A 3N7NA 9AATA 2FQ6A 4WYEA 2ORDA 4PVFA 1QJ3A 4K05A 2VMVA 2GB3A 1KL1A 1EJIA 3E77A 3CQ4A 1OHYA 2BWOA 3HT4A 3UE8A 4AZJA 2D66A 1GC2A 2G6WA 5G0AA 3R4TA 3RQ1A 1ASGA 1S0AA 1X28A 1CS1A 3Q8NA 1ZODA 5M46A 1GD9A 3FCRA 3NU7A 3WGBA 2QMAA 3N4XA 4DGTA 3RCHB 3LVLB 4KXKA 1XI9A 1WKHA 4GRXA 2YCNA 4B98A 3CBFA 2AY7A 2AEUA 1X29A 3RBLA 4XK1A 2XH1A 5FT8A 4U2HA 1M6SA 1QGNA 1DGDA 1WYUA 2R5CB 1KAFA 4IY7A 3VK2A 3JWAA 2ZSMA 4PFFA 1IBJA 3B1DA 1BJOA 3OKSA 3VOMA 1RV3A 3NYSA 1UKJA 2GMSA 5HHYA 3RBFA 3BCXA 1G4XA 3NTJA 1S09A 4OBUA 1G7XA 3AEMA 3G0TA 4DQ6A 3IHJA 1D7RA 3K28A 4F4EA 1GEWA 3QM2A 1AY8A 1C7NA 3LY1A 1AHGA 4JF1A 3MAUA 4W1WA 3TFTA 3AEJA 1GC0A 3NYUA 1ASMA 2BKWA 4F5HA 4WB0A 3QBOA 1DJ9A 2R2NA 2W7DA 2CANA 1MDXA 4WXGA 3AEOA 3MAFB 3W1JA 3TFUA 5TF5A 1BQAA 2Z9XA 4CVQA 1BW0A 1BQDA 3BWNC 3PD6A 4IXSA 2BI5A 4LNMA 4WXBA 1WSTA 4ZWMA 2FN6A 1TASA 4ITXA 2BWPA 2PB2A 4L0OA 1FG3A 1GEXA 1YIYA 2BYLA 2EZ1A 2OKKA 2OQXA 2PO3A 3ISLA 4IYOB 3DR4A 3T32A 5JAYA 2X5FA 2HUFA 4W91A 2Z20A 2AEVA 4B9BA 3PDBA 5DB5A 1CL2A 1H1CA 4CXRA 1X0MA 4W1VA 4IW7A 1WYTA 1VP4A 3DXVA 4LNLA 4WP0A 5DJ9A 5IWQA 4LW2A 1CL1A 2GSAA 1DGEA 1N31A 2WK9A 3N4SA 4MSOA 3DZZA 2CH1A 3W1IA 3EI6A 4ATQA 1GBNA 3AOVA 4JEZA 2C7TA 1AMQA 3ZRPA 5J8QA 2VGVA 1JF9A 3FZ8A 1YIZA 2OATA 5E4ZA 3WCNA 3ZRQA 3GSBA 2VIAA 4HF8A 5EIGB 1TOGA 3HL2A 3N4RA 1CQ7A 1KMKA 2CSTA 3HLMA 1UU1A 2DKJA 3EI8A 1AHXA 1QITA 1YJSA 1OATA 1U08A 1TATA 1MLYA 3FQ7A 2EO5A 4Y0IA 1S08A 2R0TA 1AY4A 3L44A 3PGYA 5K8BA 1GCKA 4ZAHA 4BQ0A 5F9SA 1WYVB 4H51A 2WKAA 2FKIA 2YKVA 1KKJA 2OKJA 3PIUA 1W3UA 4LC3A 4HVKA 3TCMA 1E5FA 3BWNA 2X5DA 1LW5A 1SVVA 3EZ1A 2HOYA 2G7JA 4K2BA 1M7YA
chains in the Genus database with same CATH topology
5FT4A 4GSAA 1I48A 3LV2A 1XEYA 4XQ2A 3BCAA 1G4VA 1FC4A 3GWPA 3FVSA 4GDYA 1UU2A 1B5PA 1V2EA 5LHAA 1TOIA 2VMYA 2VMXA 2W8UA 1JG8A 4A00A 4F5LA 1B8GA 3BN1A 4JE5A 3FRKA 4WYFA 5KTBA 2E7JA 1CZCA 3AENA 4UHOA 2YKXA 3NRAA 2C0RA 1ASCA 1C7OA 3GZCA 2YOBA 4M2KA 5EAVA 3MC6C 4WYCA 1LW4A 5D5SA 2YKYA 2VYCA 1MGVA 2E7UA 1W7NA 2OGAA 1SZUA 1DTYA 1TOKA 3H14A 1PG8A 4UQVA 2WB6A 3HBXA 1AMSA 1AKAA 3RI6A 2AY1A 2VMPA 1KL2A 3I16A 4RIZA 4W8IA 1EG5A 4N0BA 4MGRA 3E6GA 1MDZA 4AOAA 4IX8A 2QB3A 4RAEA 3WGCA 1TPLA 2D64A 3QPGA 4MQQA 2Z9UA 2D7ZA 1AMRA 4ADBA 2AY5A 4E77A 2GMUA 4A6RA 1TOEA 4ZM3A 2VGWA 3E2ZB 3UAKA 1J32A 3D6KA 3KGXA 2HUUA 4XJMA 1LKCA 1Z3ZA 4MQPA 4MKKA 2AATA 3WLXA 4XJOA 1AIBA 4NOGA 4RJ0A 1IAXA 1S07A 2QLRA 2CJHA 5EAAA 4AH3A 4OCAA 1LS3A 4P7YA 2VMSA 3RCHA 2JISA 3OP7A 4U1TA 2JG2A 3ZZJA 3QN6A 1H0CA 1M0OA 8AATA 3KGWA 4UHNA 1LC8A 2BI9A 2Z9VA 5EFSA 4Q6RA 1GC3A 1B5OA 2CB1A 4BA4A 1D7UA 4KYOA 5BJ4A 1BT4A 4M2JA 2VMWA 2VMZA 2R5CA 4F5MA 3N75A 3PA9A 4A0FA 2OGEA 2WK7A 4EMYA 1PMMA 2DOUA 2ZUKA 1W23A 1MAPA 4BA5A 4WD2A 1MLZA 4ATPA 3QHXA 1B4XA 1W7MA 1YJZA 3WY7A 4GE4A 1AHEA 4N0WA 1VJOA 1SF2A 2ZY3A 4RITA 1C4KA 2VI8A 4A6UA 2W7EA 4K2IA 4MY5A 2VLFA 1ARIA 3ASAA 3B1CA 3I5TA 4O6ZA 2QBTA 2W7JA 3GZDC 1PMOA 1JS3A 3MAFA 2VMTA 1YAAA 2VMNA 1AKBA 1ARSA 4WBTA 2D63A 5BJ3A 4H63Q 1VEFA 2HOXA 2BIEA 4RJYA 4ADCA 2CFBA 3EI5A 4IYOA 1N8PA 3WKSA 4RKCA 1QISA 1C7GA 3K40A 4RLGA 2VGSA 1YOOA 3I4JA 1GC4A 3GBXA 4WLJA 2W7KA 2D65A 3R9AA 3DC1A 3JW9A 2EPJA 4RM1A 1ARGA 1AICA 4R2NA 1UU0A 3GR9A 3A9ZA 3MKJA 1AJSB 3TATA 2W8JA 4TV7A 3P1TA 4ZDPA 2W8TA 4FL0A 1ELUA 2BHXA 3VP6A 1M32A 4ZDOA 1AAWA 4UOYA 3AATA 3BB8A 3PAAA 4JF0A 4OC9A 5EIGA 5HDMA 4F5GA 4ZWVA 5HXXA 3A2BA 2HZPA 1IAYA 1CQ6A 1Y4IA 1PFFA 1SZKA 1AHYA 2RFVA 2YKUA 1D2FA 3QI6A 2BIAA 1AMAA 4JEXA 4R5FA 2CTZA 3UWCA 2VGUA 5FT5A 2QA3A 2W7LA 3F9TA 3MADA 4J5UA 4EB5A 2VGZA 1WYVA 1W7LA 5E5IA 1YJYA 2YCPA 3BV0A 4W5KA 3AELA 2CH2A 2ZP7A 4WXFA 3EIBA 1M4NA 3E2FA 3QGUA 1V2FA 3IF2A 2YHKA 2DKBA 4XJPA 2AY9A 2YRRA 1QJ5A 1ZC9A 3P6KA 1T3IA 3MBBA 3ASBA 3VAXA 4EU1A 4XAUA 1LC5A 1KMJA 3NUIA 2YCTA 3B1EA 2CJDA 2Z67A 3A9XA 3FZ6A 2NMPA 5G09A 4AO4A 1ARHA 2W7FA 1ASEA 3II0A 5M4BA 3H7FA 3F0HA 4JEWA 4OYTA 2W7IA 3PPLA 2CJGA 3JTXA 1O69A 1OXOA 1O4SA 4QGRA 2D61A 4F5JA 1ORDA 3FQAA 3LVKA 4TN4A 2EYQA 2PB0A 2BIGA 3AEMC 1AAMA 1BJWA 3PDXA 3DXWA 3ELPA 3G8MA 4M2MA 4GE7A 1V72A 1SZSA 1TARA 1IX6A 1C0NA 1ASFA 2CINA 2E7IA 2EH6A 3JU7A 3JWBA 4ZSYA 3AV7A 2W7MA 5G4JA 3E2ZA 3CQ5A 2V0YA 1ASNA 3VK4A 2AY6A 5AX8A 2BI1A 3GETA 4OT8A 1DKAA 4UHMA 2CY8A 1M0PA 4ISYA 1ZOBA 3EUCA 3AEPA 5E3KA 4OTLA 4ADEA 4EB7A 1YNUA 3LVJA 1B9HA 3ELEA 3BCBA 3NDNA 4KAMA 3DU4A 3LG0A 1O61A 2AY3A 3FD0A 4OMAA 4A0RA 1OXPA 3ZRRA 2O7CA 3EZSA 1ECXA 3FFRA 3L8AA 2Z9WA 3NU8A 4ADDA 2VMQA 1WKGA 2FM1A 2JGTA 3BC8A 3A9YA 3BWOA 2VMRA 1IJIA 2TPLA 2KFPA 1DJUA 5EUDA 2WK8A 2QSRA 2EGYA 1WYUB 3MC6A 2FNIA 1AJRA 5EUEA 4ZLVA 1DFOA 3E2YA 4F5IA 3FKDA 1ASBA 1TOJA 2W7HA 1ASAA 3FTBA 1I41A 5M49A 4P3MA 3H9XA 5EUNA 1BJOB 1LK9A 4A6TA 4F5FA 4E3QA 1ASDA 5G4IA 1ARTA 1AY5A 1V2DA 2O0RA 1IVRA 3AOWA 3EI9A 5D95A 3W1HA 4IXZA 1SFFA 2W8WA 4ZSWA 2BWNA 3NYTA 3PJ0A 2VGTA 3VK3A 1ASLA 4DBCA 1JS6A 4MQRA 4WB0B 1BJ4A 2AY8A 3N5MA 3MEBA 4WYGA 1KKPA 4J8LA 1B9IA 3EIAA 3GJUA 1MAQA 4Y0HA 4A0GA 1EQBA 3F6TA 3M5UA 3PD6B 4WLHA 2DGKA 3B46A 2VI9A 4ZM4A 1DJEA 1X2AA 2VLHA 4GEBA 3USFA 2DGLA 4Y0DA 2VMOA 2W8VA 3FFHA 5G2QA 1LC7A 1OHVA 4R5ZA 2AY4A 3CQ6A 2JJGA 3FSLA 1M0NA 3ECDA 2R5EA 3G7QA 3RUYA 3DODA 1P3WA 3PDBB 1BS0A 5G2PA 4CXQA 2Q7WA 4CBSA 1WYTB 1MDOA 3TQXA 3NUBA 2BYJA 1AJSA 2D7YA 2JJEA 2VIBA 3FVXA 3KKIA 4Q31A 2C44A 1E5EA 2DGMA 4JE5D 3HDOA 3FDBA 3K7YA 4Q75A 3COGA 5LH9A 1S06A 3DYDA 1IX7A 2ZY4A 1OHWA 3N0LA 2F8JA 3LVMA 5C6UA 2FNUA 1IUGA 4ZDLA 3WKRA 2QB2A 2ZYJA 4RKDA 4JEVA 2D5YA 3FDDA 4K2MA 2JJHA 5I92A 4ITGA 2FYFA 1C9CA 4CBRA 4EFFA 1J04A 3BS8A 3GZDA 5M4DA 1RVUA 2X8UA 4A72A 1D7VA 2A1VA 2YRIA 2ZC0A 4BMKA 1QIRA 2Z1ZA 3DR7A 1IX8A 1GDEA 4GE9A 4LNJA 4PIWA 7AATA 3FZ7A 2BI3A 2ZJGA 4ZASA 2HORA 2C81A 3LWSA 4MKJA 3KE3A 3ZZKA 2ZY5A 2HP2A 2HP1A 3HQTA 3FVUA 3HVYA 2ZY2A 1AKCA 3WCOA 4E3RA 4PFNA 3DRDA 4XEWA 4I8AA 5F8VA 1AX4A 3WZFA 1ELQA 1SPAA 1BJNA 1AIAA 1N2TA 1QZ9A 2W7GA 2X3LA 4OBVA 4XJLA 1Z7DA 2Z61A 4Q76A 4W1XA 2DR1A 4AO9A 2VMUA 4R8DA 1CQ8A 1O62A 2AY2A 2E54A 2JJFA 3JZLA 4JEYA 3NNKA 4LW4A 4TMRA 3AENB 1GEYA 3CAIA 1I29A 5DX5A 3ACZA 5FT6A 2HUIA 4E1OA 1FG7A 3EI7A 1M0QA 1CZEA 1BKGA 4AZKA 3HMUA 4FFCA 1CJ0A 4A0HA 2ZSLA 1I43A 2XBNA 3WX9A 3AEJC 3NX3A 2BI2A 2EZ2A 1RV4A 4F5KA 5DJ1A 3A8UX 2V1PA 4WYDA 4BHDA 2HOZA 1D7SA 2GQNA 4WYAA 1AHFA 2Z1YA 4IXOA 2O1BA 1RVYA 1G7WA 3ATHA 3B8XA 3E9KA 5EQCA 3FQ8A 3N7NA 9AATA 2FQ6A 4WYEA 2ORDA 4PVFA 1QJ3A 4K05A 2VMVA 2GB3A 1KL1A 1EJIA 3E77A 3CQ4A 1OHYA 2BWOA 3HT4A 3UE8A 4AZJA 2D66A 1GC2A 2G6WA 5G0AA 3R4TA 3RQ1A 1ASGA 1S0AA 1X28A 1CS1A 3Q8NA 1ZODA 5M46A 1GD9A 3FCRA 3NU7A 3WGBA 2QMAA 3N4XA 4DGTA 3RCHB 3LVLB 4KXKA 1XI9A 1WKHA 4GRXA 2YCNA 4B98A 3CBFA 2AY7A 2AEUA 1X29A 3RBLA 4XK1A 2XH1A 5FT8A 4U2HA 1M6SA 1QGNA 1DGDA 1WYUA 2R5CB 4IY7A 3VK2A 3JWAA 2ZSMA 4PFFA 1IBJA 3B1DA 1BJOA 3OKSA 3VOMA 1RV3A 3NYSA 1UKJA 2GMSA 5HHYA 3RBFA 3BCXA 1G4XA 3NTJA 1S09A 4OBUA 1G7XA 3AEMA 3G0TA 4DQ6A 3IHJA 1D7RA 3K28A 4F4EA 1GEWA 3QM2A 1AY8A 1C7NA 3LY1A 1AHGA 4JF1A 3MAUA 4W1WA 3TFTA 3AEJA 1GC0A 3NYUA 1ASMA 2BKWA 4F5HA 4WB0A 3QBOA 1DJ9A 2R2NA 2W7DA 2CANA 1MDXA 4WXGA 3AEOA 3MAFB 3W1JA 3TFUA 5TF5A 1BQAA 2Z9XA 4CVQA 1BW0A 1BQDA 3BWNC 3PD6A 4IXSA 2BI5A 4LNMA 4WXBA 1WSTA 4ZWMA 2FN6A 1TASA 4ITXA 2BWPA 2PB2A 4L0OA 1FG3A 1GEXA 1YIYA 2BYLA 2EZ1A 2OKKA 2OQXA 2PO3A 3ISLA 4IYOB 3DR4A 3T32A 5JAYA 2X5FA 2HUFA 4W91A 2Z20A 2AEVA 4B9BA 3PDBA 5DB5A 1CL2A 1H1CA 4CXRA 1X0MA 4W1VA 4IW7A 1WYTA 1VP4A 3DXVA 4LNLA 4WP0A 5DJ9A 5IWQA 4LW2A 1CL1A 2GSAA 1DGEA 1N31A 2WK9A 3N4SA 4MSOA 3DZZA 2CH1A 3W1IA 3EI6A 4ATQA 1GBNA 3AOVA 4JEZA 2C7TA 1AMQA 3ZRPA 5J8QA 2VGVA 1JF9A 3FZ8A 1YIZA 2OATA 5E4ZA 3WCNA 3ZRQA 3GSBA 2VIAA 4HF8A 5EIGB 1TOGA 3HL2A 3N4RA 1CQ7A 1KMKA 2CSTA 3HLMA 1UU1A 2DKJA 3EI8A 1AHXA 1QITA 1YJSA 1OATA 1U08A 1TATA 1MLYA 3FQ7A 2EO5A 4Y0IA 1S08A 2R0TA 1AY4A 3L44A 3PGYA 5K8BA 1GCKA 4ZAHA 4BQ0A 5F9SA 1WYVB 4H51A 2WKAA 2FKIA 2YKVA 1KKJA 2OKJA 3PIUA 1W3UA 4LC3A 4HVKA 3TCMA 1E5FA 3BWNA 2X5DA 1LW5A 1SVVA 3EZ1A 2HOYA 2G7JA 4K2BA 1M7YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FT4 A;  4GSA A;  1I48 A;  3LV2 A;  1XEY A;  4XQ2 A;  3BCA A;  1G4V A;  1FC4 A;  3GWP A;  3FVS A;  4GDY A;  1UU2 A;  1B5P A;  1V2E A;  5LHA A;  1TOI A;  2VMY A;  2VMX A;  2W8U A;  1JG8 A;  4A00 A;  4F5L A;  1B8G A;  3BN1 A;  4JE5 A;  3FRK A;  4WYF A;  2E7J A;  1CZC A;  3AEN A;  4UHO A;  2YKX A;  3NRA A;  2C0R A;  1ASC A;  1C7O A;  3GZC A;  2YOB A;  4M2K A;  5EAV A;  3MC6 C;  4WYC A;  1LW4 A;  5D5S A;  2YKY A;  2VYC A;  1MGV A;  2E7U A;  1W7N A;  2OGA A;  1SZU A;  1DTY A;  1TOK A;  3H14 A;  1PG8 A;  4UQV A;  3HBX A;  1AMS A;  1AKA A;  3RI6 A;  2AY1 A;  2VMP A;  1KL2 A;  3I16 A;  4RIZ A;  4W8I A;  1EG5 A;  4N0B A;  4MGR A;  3E6G A;  1MDZ A;  4AOA A;  4IX8 A;  2QB3 A;  4RAE A;  3WGC A;  1TPL A;  2D64 A;  3QPG A;  4MQQ A;  2Z9U A;  2D7Z A;  1AMR A;  4ADB A;  2AY5 A;  4E77 A;  2GMU A;  4A6R A;  1TOE A;  4ZM3 A;  2VGW A;  3E2Z B;  3UAK A;  1J32 A;  3D6K A;  3KGX A;  2HUU A;  4XJM A;  1LKC A;  1Z3Z A;  4MQP A;  4MKK A;  2AAT A;  3WLX A;  4XJO A;  1AIB A;  4NOG A;  4RJ0 A;  1IAX A;  1S07 A;  2QLR A;  2CJH A;  5EAA A;  4AH3 A;  4OCA A;  1LS3 A;  4P7Y A;  2VMS A;  3RCH A;  2JIS A;  3OP7 A;  4U1T A;  2JG2 A;  3ZZJ A;  3QN6 A;  1H0C A;  1M0O A;  8AAT A;  3KGW A;  4UHN A;  1LC8 A;  2BI9 A;  2Z9V A;  5EFS A;  4Q6R A;  1GC3 A;  1B5O A;  2CB1 A;  4BA4 A;  1D7U A;  4KYO A;  5BJ4 A;  1BT4 A;  4M2J A;  2VMW A;  2VMZ A;  2R5C A;  4F5M A;  3N75 A;  3PA9 A;  4A0F A;  2OGE A;  2WK7 A;  4EMY A;  1PMM A;  2DOU A;  2ZUK A;  1W23 A;  1MAP A;  4BA5 A;  4WD2 A;  1MLZ A;  4ATP A;  3QHX A;  1B4X A;  1W7M A;  1YJZ A;  3WY7 A;  4GE4 A;  1AHE A;  4N0W A;  1VJO A;  1SF2 A;  2ZY3 A;  4RIT A;  1C4K A;  2VI8 A;  4A6U A;  2W7E A;  4K2I A;  4MY5 A;  2VLF A;  1ARI A;  3ASA A;  3B1C A;  3I5T A;  4O6Z A;  2QBT A;  2W7J A;  3GZD C;  1PMO A;  1JS3 A;  3MAF A;  2VMT A;  1YAA A;  2VMN A;  1AKB A;  1ARS A;  4WBT A;  2D63 A;  5BJ3 A;  1VEF A;  2HOX A;  2BIE A;  4RJY A;  4ADC A;  2CFB A;  3EI5 A;  4IYO A;  1N8P A;  3WKS A;  4RKC A;  1QIS A;  1C7G A;  3K40 A;  4RLG A;  2VGS A;  1YOO A;  3I4J A;  1GC4 A;  3GBX A;  4WLJ A;  2W7K A;  2D65 A;  3R9A A;  3DC1 A;  3JW9 A;  2EPJ A;  4RM1 A;  1ARG A;  1AIC A;  4R2N A;  1UU0 A;  3GR9 A;  3A9Z A;  3MKJ A;  1AJS B;  3TAT A;  2W8J A;  4TV7 A;  3P1T A;  4ZDP A;  2W8T A;  4FL0 A;  1ELU A;  2BHX A;  3VP6 A;  1M32 A;  4ZDO A;  1AAW A;  4UOY A;  3AAT A;  3BB8 A;  3PAA A;  4JF0 A;  4OC9 A;  5EIG A;  5HDM A;  4F5G A;  4ZWV A;  5HXX A;  3A2B A;  2HZP A;  1IAY A;  1CQ6 A;  1Y4I A;  1PFF A;  1SZK A;  1AHY A;  2RFV A;  2YKU A;  1D2F A;  3QI6 A;  2BIA A;  1AMA A;  4JEX A;  4R5F A;  2CTZ A;  3UWC A;  2VGU A;  5FT5 A;  2QA3 A;  2W7L A;  3F9T A;  3MAD A;  4J5U A;  4EB5 A;  2VGZ A;  1WYV A;  1W7L A;  5E5I A;  1YJY A;  2YCP A;  3BV0 A;  4W5K A;  3AEL A;  2CH2 A;  2ZP7 A;  4WXF A;  3EIB A;  1M4N A;  3E2F A;  3QGU A;  1V2F A;  3IF2 A;  2YHK A;  2DKB A;  4XJP A;  2AY9 A;  2YRR A;  1QJ5 A;  1ZC9 A;  3P6K A;  1T3I A;  3MBB A;  3ASB A;  3VAX A;  4EU1 A;  4XAU A;  1LC5 A;  1KMJ A;  3NUI A;  2YCT A;  3B1E A;  2CJD A;  2Z67 A;  3A9X A;  3FZ6 A;  2NMP A;  5G09 A;  4AO4 A;  1ARH A;  2W7F A;  1ASE A;  3II0 A;  5M4B A;  3H7F A;  3F0H A;  4JEW A;  4OYT A;  2W7I A;  3PPL A;  2CJG A;  3JTX A;  1O69 A;  1OXO A;  1O4S A;  4QGR A;  2D61 A;  4F5J A;  1ORD A;  3FQA A;  3LVK A;  4TN4 A;  2PB0 A;  2BIG A;  3AEM C;  1AAM A;  1BJW A;  3PDX A;  3DXW A;  3ELP A;  3G8M A;  4M2M A;  4GE7 A;  1V72 A;  1SZS A;  1TAR A;  1IX6 A;  1C0N A;  1ASF A;  2CIN A;  2E7I A;  2EH6 A;  3JU7 A;  3JWB A;  4ZSY A;  3AV7 A;  2W7M A;  5G4J A;  3E2Z A;  3CQ5 A;  2V0Y A;  1ASN A;  3VK4 A;  2AY6 A;  5AX8 A;  2BI1 A;  3GET A;  4OT8 A;  1DKA A;  4UHM A;  2CY8 A;  1M0P A;  4ISY A;  1ZOB A;  3EUC A;  3AEP A;  5E3K A;  4OTL A;  4ADE A;  4EB7 A;  1YNU A;  3LVJ A;  1B9H A;  3ELE A;  3BCB A;  3NDN A;  4KAM A;  3DU4 A;  3LG0 A;  1O61 A;  2AY3 A;  3FD0 A;  4OMA A;  4A0R A;  1OXP A;  3ZRR A;  2O7C A;  3EZS A;  1ECX A;  3FFR A;  3L8A A;  2Z9W A;  3NU8 A;  4ADD A;  2VMQ A;  1WKG A;  2FM1 A;  2JGT A;  3BC8 A;  3A9Y A;  3BWO A;  2VMR A;  1IJI A;  2TPL A;  1DJU A;  5EUD A;  2WK8 A;  2EGY A;  1WYU B;  3MC6 A;  2FNI A;  1AJR A;  5EUE A;  4ZLV A;  1DFO A;  3E2Y A;  4F5I A;  3FKD A;  1ASB A;  1TOJ A;  2W7H A;  1ASA A;  3FTB A;  1I41 A;  5M49 A;  4P3M A;  5EUN A;  1BJO B;  1LK9 A;  4A6T A;  4F5F A;  4E3Q A;  1ASD A;  5G4I A;  1ART A;  1AY5 A;  1V2D A;  2O0R A;  1IVR A;  3AOW A;  3EI9 A;  5D95 A;  3W1H A;  4IXZ A;  1SFF A;  2W8W A;  4ZSW A;  2BWN A;  3NYT A;  3PJ0 A;  2VGT A;  3VK3 A;  1ASL A;  4DBC A;  1JS6 A;  4MQR A;  4WB0 B;  1BJ4 A;  2AY8 A;  3N5M A;  3MEB A;  4WYG A;  1KKP A;  4J8L A;  1B9I A;  3EIA A;  3GJU A;  1MAQ A;  4Y0H A;  4A0G A;  1EQB A;  3F6T A;  3M5U A;  3PD6 B;  4WLH A;  2DGK A;  3B46 A;  2VI9 A;  4ZM4 A;  1DJE A;  1X2A A;  2VLH A;  4GEB A;  3USF A;  2DGL A;  4Y0D A;  2VMO A;  2W8V A;  3FFH A;  5G2Q A;  1LC7 A;  1OHV A;  4R5Z A;  2AY4 A;  3CQ6 A;  2JJG A;  3FSL A;  1M0N A;  3ECD A;  2R5E A;  3G7Q A;  3RUY A;  3DOD A;  1P3W A;  3PDB B;  1BS0 A;  5G2P A;  4CXQ A;  2Q7W A;  4CBS A;  1WYT B;  1MDO A;  3TQX A;  3NUB A;  2BYJ A;  1AJS A;  2D7Y A;  2JJE A;  2VIB A;  3FVX A;  3KKI A;  4Q31 A;  2C44 A;  1E5E A;  2DGM A;  4JE5 D;  3HDO A;  3FDB A;  3K7Y A;  4Q75 A;  3COG A;  5LH9 A;  1S06 A;  3DYD A;  1IX7 A;  2ZY4 A;  1OHW A;  3N0L A;  2F8J A;  3LVM A;  5C6U A;  2FNU A;  1IUG A;  4ZDL A;  3WKR A;  2QB2 A;  2ZYJ A;  4RKD A;  4JEV A;  2D5Y A;  3FDD A;  4K2M A;  2JJH A;  5I92 A;  4ITG A;  2FYF A;  1C9C A;  4CBR A;  4EFF A;  1J04 A;  3BS8 A;  3GZD A;  5M4D A;  1RVU A;  2X8U A;  4A72 A;  1D7V A;  2YRI A;  2ZC0 A;  4BMK A;  1QIR A;  2Z1Z A;  3DR7 A;  1IX8 A;  1GDE A;  4GE9 A;  4LNJ A;  4PIW A;  7AAT A;  3FZ7 A;  2BI3 A;  2ZJG A;  4ZAS A;  2HOR A;  2C81 A;  3LWS A;  4MKJ A;  3KE3 A;  3ZZK A;  2ZY5 A;  2HP2 A;  2HP1 A;  3HQT A;  3FVU A;  3HVY A;  2ZY2 A;  1AKC A;  3WCO A;  4E3R A;  4PFN A;  3DRD A;  4XEW A;  4I8A A;  5F8V A;  1AX4 A;  3WZF A;  1ELQ A;  1SPA A;  1BJN A;  1AIA A;  1N2T A;  1QZ9 A;  2W7G A;  2X3L A;  4OBV A;  4XJL A;  1Z7D A;  2Z61 A;  4Q76 A;  4W1X A;  2DR1 A;  4AO9 A;  2VMU A;  4R8D A;  1CQ8 A;  1O62 A;  2AY2 A;  2E54 A;  2JJF A;  3JZL A;  4JEY A;  3NNK A;  4LW4 A;  4TMR A;  3AEN B;  1GEY A;  3CAI A;  1I29 A;  5DX5 A;  3ACZ A;  5FT6 A;  2HUI A;  4E1O A;  1FG7 A;  3EI7 A;  1M0Q A;  1CZE A;  1BKG A;  4AZK A;  3HMU A;  4FFC A;  1CJ0 A;  4A0H A;  2ZSL A;  1I43 A;  2XBN A;  3WX9 A;  3AEJ C;  3NX3 A;  2BI2 A;  2EZ2 A;  1RV4 A;  4F5K A;  5DJ1 A;  3A8U X;  2V1P A;  4WYD A;  4BHD A;  2HOZ A;  1D7S A;  2GQN A;  4WYA A;  1AHF A;  2Z1Y A;  4IXO A;  2O1B A;  1RVY A;  1G7W A;  3ATH A;  3B8X A;  3E9K A;  5EQC A;  3FQ8 A;  9AAT A;  2FQ6 A;  4WYE A;  2ORD A;  4PVF A;  1QJ3 A;  2VMV A;  2GB3 A;  1KL1 A;  1EJI A;  3E77 A;  3CQ4 A;  1OHY A;  2BWO A;  3HT4 A;  3UE8 A;  4AZJ A;  2D66 A;  1GC2 A;  2G6W A;  5G0A A;  3R4T A;  3RQ1 A;  1ASG A;  1S0A A;  1X28 A;  1CS1 A;  3Q8N A;  1ZOD A;  5M46 A;  1GD9 A;  3FCR A;  3NU7 A;  3WGB A;  2QMA A;  4DGT A;  3RCH B;  3LVL B;  4KXK A;  1XI9 A;  1WKH A;  4GRX A;  2YCN A;  4B98 A;  3CBF A;  2AY7 A;  2AEU A;  1X29 A;  3RBL A;  4XK1 A;  2XH1 A;  5FT8 A;  4U2H A;  1M6S A;  1QGN A;  1DGD A;  1WYU A;  2R5C B;  4IY7 A;  3VK2 A;  3JWA A;  2ZSM A;  4PFF A;  1IBJ A;  3B1D A;  1BJO A;  3OKS A;  3VOM A;  1RV3 A;  3NYS A;  1UKJ A;  2GMS A;  5HHY A;  3RBF A;  3BCX A;  1G4X A;  3NTJ A;  1S09 A;  4OBU A;  1G7X A;  3AEM A;  3G0T A;  4DQ6 A;  3IHJ A;  1D7R A;  3K28 A;  4F4E A;  1GEW A;  3QM2 A;  1AY8 A;  1C7N A;  3LY1 A;  1AHG A;  4JF1 A;  3MAU A;  4W1W A;  3TFT A;  3AEJ A;  1GC0 A;  3NYU A;  1ASM A;  2BKW A;  4F5H A;  4WB0 A;  3QBO A;  1DJ9 A;  2R2N A;  2W7D A;  2CAN A;  1MDX A;  4WXG A;  3AEO A;  3MAF B;  3W1J A;  3TFU A;  5TF5 A;  1BQA A;  2Z9X A;  4CVQ A;  1BW0 A;  1BQD A;  3BWN C;  3PD6 A;  4IXS A;  2BI5 A;  4LNM A;  4WXB A;  1WST A;  4ZWM A;  2FN6 A;  1TAS A;  4ITX A;  2BWP A;  2PB2 A;  4L0O A;  1FG3 A;  1GEX A;  1YIY A;  2BYL A;  2EZ1 A;  2OKK A;  2OQX A;  2PO3 A;  3ISL A;  4IYO B;  3DR4 A;  3T32 A;  5JAY A;  2X5F A;  2HUF A;  4W91 A;  2Z20 A;  2AEV A;  4B9B A;  3PDB A;  5DB5 A;  1CL2 A;  1H1C A;  4CXR A;  1X0M A;  4W1V A;  4IW7 A;  1WYT A;  1VP4 A;  3DXV A;  4LNL A;  4WP0 A;  5DJ9 A;  5IWQ A;  4LW2 A;  1CL1 A;  2GSA A;  1DGE A;  1N31 A;  2WK9 A;  4MSO A;  3DZZ A;  2CH1 A;  3W1I A;  3EI6 A;  4ATQ A;  1GBN A;  3AOV A;  4JEZ A;  2C7T A;  1AMQ A;  3ZRP A;  5J8Q A;  2VGV A;  1JF9 A;  3FZ8 A;  1YIZ A;  2OAT A;  5E4Z A;  3WCN A;  3ZRQ A;  3GSB A;  2VIA A;  4HF8 A;  5EIG B;  1TOG A;  3HL2 A;  1CQ7 A;  1KMK A;  2CST A;  3HLM A;  1UU1 A;  2DKJ A;  3EI8 A;  1AHX A;  1QIT A;  1YJS A;  1OAT A;  1U08 A;  1TAT A;  1MLY A;  3FQ7 A;  2EO5 A;  4Y0I A;  1S08 A;  2R0T A;  1AY4 A;  3L44 A;  3PGY A;  5K8B A;  1GCK A;  4ZAH A;  4BQ0 A;  5F9S A;  1WYV B;  4H51 A;  2WKA A;  2YKV A;  1KKJ A;  2OKJ A;  3PIU A;  1W3U A;  4LC3 A;  4HVK A;  3TCM A;  1E5F A;  3BWN A;  2X5D A;  1LW5 A;  1SVV A;  3EZ1 A;  2HOY A;  4K2B A;  1M7Y A; 
#chains in the Genus database with same CATH topology
 5FT4 A;  4GSA A;  1I48 A;  3LV2 A;  1XEY A;  4XQ2 A;  3BCA A;  1G4V A;  1FC4 A;  3GWP A;  3FVS A;  4GDY A;  1UU2 A;  1B5P A;  1V2E A;  5LHA A;  1TOI A;  2VMY A;  2VMX A;  2W8U A;  1JG8 A;  4A00 A;  4F5L A;  1B8G A;  3BN1 A;  4JE5 A;  3FRK A;  4WYF A;  5KTB A;  2E7J A;  1CZC A;  3AEN A;  4UHO A;  2YKX A;  3NRA A;  2C0R A;  1ASC A;  1C7O A;  3GZC A;  2YOB A;  4M2K A;  5EAV A;  3MC6 C;  4WYC A;  1LW4 A;  5D5S A;  2YKY A;  2VYC A;  1MGV A;  2E7U A;  1W7N A;  2OGA A;  1SZU A;  1DTY A;  1TOK A;  3H14 A;  1PG8 A;  4UQV A;  2WB6 A;  3HBX A;  1AMS A;  1AKA A;  3RI6 A;  2AY1 A;  2VMP A;  1KL2 A;  3I16 A;  4RIZ A;  4W8I A;  1EG5 A;  4N0B A;  4MGR A;  3E6G A;  1MDZ A;  4AOA A;  4IX8 A;  2QB3 A;  4RAE A;  3WGC A;  1TPL A;  2D64 A;  3QPG A;  4MQQ A;  2Z9U A;  2D7Z A;  1AMR A;  4ADB A;  2AY5 A;  4E77 A;  2GMU A;  4A6R A;  1TOE A;  4ZM3 A;  2VGW A;  3E2Z B;  3UAK A;  1J32 A;  3D6K A;  3KGX A;  2HUU A;  4XJM A;  1LKC A;  1Z3Z A;  4MQP A;  4MKK A;  2AAT A;  3WLX A;  4XJO A;  1AIB A;  4NOG A;  4RJ0 A;  1IAX A;  1S07 A;  2QLR A;  2CJH A;  5EAA A;  4AH3 A;  4OCA A;  1LS3 A;  4P7Y A;  2VMS A;  3RCH A;  2JIS A;  3OP7 A;  4U1T A;  2JG2 A;  3ZZJ A;  3QN6 A;  1H0C A;  1M0O A;  8AAT A;  3KGW A;  4UHN A;  1LC8 A;  2BI9 A;  2Z9V A;  5EFS A;  4Q6R A;  1GC3 A;  1B5O A;  2CB1 A;  4BA4 A;  1D7U A;  4KYO A;  5BJ4 A;  1BT4 A;  4M2J A;  2VMW A;  2VMZ A;  2R5C A;  4F5M A;  3N75 A;  3PA9 A;  4A0F A;  2OGE A;  2WK7 A;  4EMY A;  1PMM A;  2DOU A;  2ZUK A;  1W23 A;  1MAP A;  4BA5 A;  4WD2 A;  1MLZ A;  4ATP A;  3QHX A;  1B4X A;  1W7M A;  1YJZ A;  3WY7 A;  4GE4 A;  1AHE A;  4N0W A;  1VJO A;  1SF2 A;  2ZY3 A;  4RIT A;  1C4K A;  2VI8 A;  4A6U A;  2W7E A;  4K2I A;  4MY5 A;  2VLF A;  1ARI A;  3ASA A;  3B1C A;  3I5T A;  4O6Z A;  2QBT A;  2W7J A;  3GZD C;  1PMO A;  1JS3 A;  3MAF A;  2VMT A;  1YAA A;  2VMN A;  1AKB A;  1ARS A;  4WBT A;  2D63 A;  5BJ3 A;  4H63 Q;  1VEF A;  2HOX A;  2BIE A;  4RJY A;  4ADC A;  2CFB A;  3EI5 A;  4IYO A;  1N8P A;  3WKS A;  4RKC A;  1QIS A;  1C7G A;  3K40 A;  4RLG A;  2VGS A;  1YOO A;  3I4J A;  1GC4 A;  3GBX A;  4WLJ A;  2W7K A;  2D65 A;  3R9A A;  3DC1 A;  3JW9 A;  2EPJ A;  4RM1 A;  1ARG A;  1AIC A;  4R2N A;  1UU0 A;  3GR9 A;  3A9Z A;  3MKJ A;  1AJS B;  3TAT A;  2W8J A;  4TV7 A;  3P1T A;  4ZDP A;  2W8T A;  4FL0 A;  1ELU A;  2BHX A;  3VP6 A;  1M32 A;  4ZDO A;  1AAW A;  4UOY A;  3AAT A;  3BB8 A;  3PAA A;  4JF0 A;  4OC9 A;  5EIG A;  5HDM A;  4F5G A;  4ZWV A;  5HXX A;  3A2B A;  2HZP A;  1IAY A;  1CQ6 A;  1Y4I A;  1PFF A;  1SZK A;  1AHY A;  2RFV A;  2YKU A;  1D2F A;  3QI6 A;  2BIA A;  1AMA A;  4JEX A;  4R5F A;  2CTZ A;  3UWC A;  2VGU A;  5FT5 A;  2QA3 A;  2W7L A;  3F9T A;  3MAD A;  4J5U A;  4EB5 A;  2VGZ A;  1WYV A;  1W7L A;  5E5I A;  1YJY A;  2YCP A;  3BV0 A;  4W5K A;  3AEL A;  2CH2 A;  2ZP7 A;  4WXF A;  3EIB A;  1M4N A;  3E2F A;  3QGU A;  1V2F A;  3IF2 A;  2YHK A;  2DKB A;  4XJP A;  2AY9 A;  2YRR A;  1QJ5 A;  1ZC9 A;  3P6K A;  1T3I A;  3MBB A;  3ASB A;  3VAX A;  4EU1 A;  4XAU A;  1LC5 A;  1KMJ A;  3NUI A;  2YCT A;  3B1E A;  2CJD A;  2Z67 A;  3A9X A;  3FZ6 A;  2NMP A;  5G09 A;  4AO4 A;  1ARH A;  2W7F A;  1ASE A;  3II0 A;  5M4B A;  3H7F A;  3F0H A;  4JEW A;  4OYT A;  2W7I A;  3PPL A;  2CJG A;  3JTX A;  1O69 A;  1OXO A;  1O4S A;  4QGR A;  2D61 A;  4F5J A;  1ORD A;  3FQA A;  3LVK A;  4TN4 A;  2EYQ A;  2PB0 A;  2BIG A;  3AEM C;  1AAM A;  1BJW A;  3PDX A;  3DXW A;  3ELP A;  3G8M A;  4M2M A;  4GE7 A;  1V72 A;  1SZS A;  1TAR A;  1IX6 A;  1C0N A;  1ASF A;  2CIN A;  2E7I A;  2EH6 A;  3JU7 A;  3JWB A;  4ZSY A;  3AV7 A;  2W7M A;  5G4J A;  3E2Z A;  3CQ5 A;  2V0Y A;  1ASN A;  3VK4 A;  2AY6 A;  5AX8 A;  2BI1 A;  3GET A;  4OT8 A;  1DKA A;  4UHM A;  2CY8 A;  1M0P A;  4ISY A;  1ZOB A;  3EUC A;  3AEP A;  5E3K A;  4OTL A;  4ADE A;  4EB7 A;  1YNU A;  3LVJ A;  1B9H A;  3ELE A;  3BCB A;  3NDN A;  4KAM A;  3DU4 A;  3LG0 A;  1O61 A;  2AY3 A;  3FD0 A;  4OMA A;  4A0R A;  1OXP A;  3ZRR A;  2O7C A;  3EZS A;  1ECX A;  3FFR A;  3L8A A;  2Z9W A;  3NU8 A;  4ADD A;  2VMQ A;  1WKG A;  2FM1 A;  2JGT A;  3BC8 A;  3A9Y A;  3BWO A;  2VMR A;  1IJI A;  2TPL A;  2KFP A;  1DJU A;  5EUD A;  2WK8 A;  2QSR A;  2EGY A;  1WYU B;  3MC6 A;  2FNI A;  1AJR A;  5EUE A;  4ZLV A;  1DFO A;  3E2Y A;  4F5I A;  3FKD A;  1ASB A;  1TOJ A;  2W7H A;  1ASA A;  3FTB A;  1I41 A;  5M49 A;  4P3M A;  3H9X A;  5EUN A;  1BJO B;  1LK9 A;  4A6T A;  4F5F A;  4E3Q A;  1ASD A;  5G4I A;  1ART A;  1AY5 A;  1V2D A;  2O0R A;  1IVR A;  3AOW A;  3EI9 A;  5D95 A;  3W1H A;  4IXZ A;  1SFF A;  2W8W A;  4ZSW A;  2BWN A;  3NYT A;  3PJ0 A;  2VGT A;  3VK3 A;  1ASL A;  4DBC A;  1JS6 A;  4MQR A;  4WB0 B;  1BJ4 A;  2AY8 A;  3N5M A;  3MEB A;  4WYG A;  1KKP A;  4J8L A;  1B9I A;  3EIA A;  3GJU A;  1MAQ A;  4Y0H A;  4A0G A;  1EQB A;  3F6T A;  3M5U A;  3PD6 B;  4WLH A;  2DGK A;  3B46 A;  2VI9 A;  4ZM4 A;  1DJE A;  1X2A A;  2VLH A;  4GEB A;  3USF A;  2DGL A;  4Y0D A;  2VMO A;  2W8V A;  3FFH A;  5G2Q A;  1LC7 A;  1OHV A;  4R5Z A;  2AY4 A;  3CQ6 A;  2JJG A;  3FSL A;  1M0N A;  3ECD A;  2R5E A;  3G7Q A;  3RUY A;  3DOD A;  1P3W A;  3PDB B;  1BS0 A;  5G2P A;  4CXQ A;  2Q7W A;  4CBS A;  1WYT B;  1MDO A;  3TQX A;  3NUB A;  2BYJ A;  1AJS A;  2D7Y A;  2JJE A;  2VIB A;  3FVX A;  3KKI A;  4Q31 A;  2C44 A;  1E5E A;  2DGM A;  4JE5 D;  3HDO A;  3FDB A;  3K7Y A;  4Q75 A;  3COG A;  5LH9 A;  1S06 A;  3DYD A;  1IX7 A;  2ZY4 A;  1OHW A;  3N0L A;  2F8J A;  3LVM A;  5C6U A;  2FNU A;  1IUG A;  4ZDL A;  3WKR A;  2QB2 A;  2ZYJ A;  4RKD A;  4JEV A;  2D5Y A;  3FDD A;  4K2M A;  2JJH A;  5I92 A;  4ITG A;  2FYF A;  1C9C A;  4CBR A;  4EFF A;  1J04 A;  3BS8 A;  3GZD A;  5M4D A;  1RVU A;  2X8U A;  4A72 A;  1D7V A;  2A1V A;  2YRI A;  2ZC0 A;  4BMK A;  1QIR A;  2Z1Z A;  3DR7 A;  1IX8 A;  1GDE A;  4GE9 A;  4LNJ A;  4PIW A;  7AAT A;  3FZ7 A;  2BI3 A;  2ZJG A;  4ZAS A;  2HOR A;  2C81 A;  3LWS A;  4MKJ A;  3KE3 A;  3ZZK A;  2ZY5 A;  2HP2 A;  2HP1 A;  3HQT A;  3FVU A;  3HVY A;  2ZY2 A;  1AKC A;  3WCO A;  4E3R A;  4PFN A;  3DRD A;  4XEW A;  4I8A A;  5F8V A;  1AX4 A;  3WZF A;  1ELQ A;  1SPA A;  1BJN A;  1AIA A;  1N2T A;  1QZ9 A;  2W7G A;  2X3L A;  4OBV A;  4XJL A;  1Z7D A;  2Z61 A;  4Q76 A;  4W1X A;  2DR1 A;  4AO9 A;  2VMU A;  4R8D A;  1CQ8 A;  1O62 A;  2AY2 A;  2E54 A;  2JJF A;  3JZL A;  4JEY A;  3NNK A;  4LW4 A;  4TMR A;  3AEN B;  1GEY A;  3CAI A;  1I29 A;  5DX5 A;  3ACZ A;  5FT6 A;  2HUI A;  4E1O A;  1FG7 A;  3EI7 A;  1M0Q A;  1CZE A;  1BKG A;  4AZK A;  3HMU A;  4FFC A;  1CJ0 A;  4A0H A;  2ZSL A;  1I43 A;  2XBN A;  3WX9 A;  3AEJ C;  3NX3 A;  2BI2 A;  2EZ2 A;  1RV4 A;  4F5K A;  5DJ1 A;  3A8U X;  2V1P A;  4WYD A;  4BHD A;  2HOZ A;  1D7S A;  2GQN A;  4WYA A;  1AHF A;  2Z1Y A;  4IXO A;  2O1B A;  1RVY A;  1G7W A;  3ATH A;  3B8X A;  3E9K A;  5EQC A;  3FQ8 A;  3N7N A;  9AAT A;  2FQ6 A;  4WYE A;  2ORD A;  4PVF A;  1QJ3 A;  4K05 A;  2VMV A;  2GB3 A;  1KL1 A;  1EJI A;  3E77 A;  3CQ4 A;  1OHY A;  2BWO A;  3HT4 A;  3UE8 A;  4AZJ A;  2D66 A;  1GC2 A;  2G6W A;  5G0A A;  3R4T A;  3RQ1 A;  1ASG A;  1S0A A;  1X28 A;  1CS1 A;  3Q8N A;  1ZOD A;  5M46 A;  1GD9 A;  3FCR A;  3NU7 A;  3WGB A;  2QMA A;  3N4X A;  4DGT A;  3RCH B;  3LVL B;  4KXK A;  1XI9 A;  1WKH A;  4GRX A;  2YCN A;  4B98 A;  3CBF A;  2AY7 A;  2AEU A;  1X29 A;  3RBL A;  4XK1 A;  2XH1 A;  5FT8 A;  4U2H A;  1M6S A;  1QGN A;  1DGD A;  1WYU A;  2R5C B;  1KAF A;  4IY7 A;  3VK2 A;  3JWA A;  2ZSM A;  4PFF A;  1IBJ A;  3B1D A;  1BJO A;  3OKS A;  3VOM A;  1RV3 A;  3NYS A;  1UKJ A;  2GMS A;  5HHY A;  3RBF A;  3BCX A;  1G4X A;  3NTJ A;  1S09 A;  4OBU A;  1G7X A;  3AEM A;  3G0T A;  4DQ6 A;  3IHJ A;  1D7R A;  3K28 A;  4F4E A;  1GEW A;  3QM2 A;  1AY8 A;  1C7N A;  3LY1 A;  1AHG A;  4JF1 A;  3MAU A;  4W1W A;  3TFT A;  3AEJ A;  1GC0 A;  3NYU A;  1ASM A;  2BKW A;  4F5H A;  4WB0 A;  3QBO A;  1DJ9 A;  2R2N A;  2W7D A;  2CAN A;  1MDX A;  4WXG A;  3AEO A;  3MAF B;  3W1J A;  3TFU A;  5TF5 A;  1BQA A;  2Z9X A;  4CVQ A;  1BW0 A;  1BQD A;  3BWN C;  3PD6 A;  4IXS A;  2BI5 A;  4LNM A;  4WXB A;  1WST A;  4ZWM A;  2FN6 A;  1TAS A;  4ITX A;  2BWP A;  2PB2 A;  4L0O A;  1FG3 A;  1GEX A;  1YIY A;  2BYL A;  2EZ1 A;  2OKK A;  2OQX A;  2PO3 A;  3ISL A;  4IYO B;  3DR4 A;  3T32 A;  5JAY A;  2X5F A;  2HUF A;  4W91 A;  2Z20 A;  2AEV A;  4B9B A;  3PDB A;  5DB5 A;  1CL2 A;  1H1C A;  4CXR A;  1X0M A;  4W1V A;  4IW7 A;  1WYT A;  1VP4 A;  3DXV A;  4LNL A;  4WP0 A;  5DJ9 A;  5IWQ A;  4LW2 A;  1CL1 A;  2GSA A;  1DGE A;  1N31 A;  2WK9 A;  3N4S A;  4MSO A;  3DZZ A;  2CH1 A;  3W1I A;  3EI6 A;  4ATQ A;  1GBN A;  3AOV A;  4JEZ A;  2C7T A;  1AMQ A;  3ZRP A;  5J8Q A;  2VGV A;  1JF9 A;  3FZ8 A;  1YIZ A;  2OAT A;  5E4Z A;  3WCN A;  3ZRQ A;  3GSB A;  2VIA A;  4HF8 A;  5EIG B;  1TOG A;  3HL2 A;  3N4R A;  1CQ7 A;  1KMK A;  2CST A;  3HLM A;  1UU1 A;  2DKJ A;  3EI8 A;  1AHX A;  1QIT A;  1YJS A;  1OAT A;  1U08 A;  1TAT A;  1MLY A;  3FQ7 A;  2EO5 A;  4Y0I A;  1S08 A;  2R0T A;  1AY4 A;  3L44 A;  3PGY A;  5K8B A;  1GCK A;  4ZAH A;  4BQ0 A;  5F9S A;  1WYV B;  4H51 A;  2WKA A;  2FKI A;  2YKV A;  1KKJ A;  2OKJ A;  3PIU A;  1W3U A;  4LC3 A;  4HVK A;  3TCM A;  1E5F A;  3BWN A;  2X5D A;  1LW5 A;  1SVV A;  3EZ1 A;  2HOY A;  2G7J A;  4K2B A;  1M7Y A; 
#chains in the Genus database with same CATH homology
 5FT4 A;  4GSA A;  1I48 A;  3LV2 A;  1XEY A;  4XQ2 A;  3BCA A;  1G4V A;  1FC4 A;  3GWP A;  3FVS A;  4GDY A;  1UU2 A;  1B5P A;  1V2E A;  5LHA A;  1TOI A;  2VMY A;  2VMX A;  2W8U A;  1JG8 A;  4A00 A;  4F5L A;  1B8G A;  3BN1 A;  4JE5 A;  3FRK A;  4WYF A;  5KTB A;  2E7J A;  1CZC A;  3AEN A;  4UHO A;  2YKX A;  3NRA A;  2C0R A;  1ASC A;  1C7O A;  3GZC A;  2YOB A;  4M2K A;  5EAV A;  3MC6 C;  4WYC A;  1LW4 A;  5D5S A;  2YKY A;  2VYC A;  1MGV A;  2E7U A;  1W7N A;  2OGA A;  1SZU A;  1DTY A;  1TOK A;  3H14 A;  1PG8 A;  4UQV A;  2WB6 A;  3HBX A;  1AMS A;  1AKA A;  3RI6 A;  2AY1 A;  2VMP A;  1KL2 A;  3I16 A;  4RIZ A;  4W8I A;  1EG5 A;  4N0B A;  4MGR A;  3E6G A;  1MDZ A;  4AOA A;  4IX8 A;  2QB3 A;  4RAE A;  3WGC A;  1TPL A;  2D64 A;  3QPG A;  4MQQ A;  2Z9U A;  2D7Z A;  1AMR A;  4ADB A;  2AY5 A;  4E77 A;  2GMU A;  4A6R A;  1TOE A;  4ZM3 A;  2VGW A;  3E2Z B;  3UAK A;  1J32 A;  3D6K A;  3KGX A;  2HUU A;  4XJM A;  1LKC A;  1Z3Z A;  4MQP A;  4MKK A;  2AAT A;  3WLX A;  4XJO A;  1AIB A;  4NOG A;  4RJ0 A;  1IAX A;  1S07 A;  2QLR A;  2CJH A;  5EAA A;  4AH3 A;  4OCA A;  1LS3 A;  4P7Y A;  2VMS A;  3RCH A;  2JIS A;  3OP7 A;  4U1T A;  2JG2 A;  3ZZJ A;  3QN6 A;  1H0C A;  1M0O A;  8AAT A;  3KGW A;  4UHN A;  1LC8 A;  2BI9 A;  2Z9V A;  5EFS A;  4Q6R A;  1GC3 A;  1B5O A;  2CB1 A;  4BA4 A;  1D7U A;  4KYO A;  5BJ4 A;  1BT4 A;  4M2J A;  2VMW A;  2VMZ A;  2R5C A;  4F5M A;  3N75 A;  3PA9 A;  4A0F A;  2OGE A;  2WK7 A;  4EMY A;  1PMM A;  2DOU A;  2ZUK A;  1W23 A;  1MAP A;  4BA5 A;  4WD2 A;  1MLZ A;  4ATP A;  3QHX A;  1B4X A;  1W7M A;  1YJZ A;  3WY7 A;  4GE4 A;  1AHE A;  4N0W A;  1VJO A;  1SF2 A;  2ZY3 A;  4RIT A;  1C4K A;  2VI8 A;  4A6U A;  2W7E A;  4K2I A;  4MY5 A;  2VLF A;  1ARI A;  3ASA A;  3B1C A;  3I5T A;  4O6Z A;  2QBT A;  2W7J A;  3GZD C;  1PMO A;  1JS3 A;  3MAF A;  2VMT A;  1YAA A;  2VMN A;  1AKB A;  1ARS A;  4WBT A;  2D63 A;  5BJ3 A;  4H63 Q;  1VEF A;  2HOX A;  2BIE A;  4RJY A;  4ADC A;  2CFB A;  3EI5 A;  4IYO A;  1N8P A;  3WKS A;  4RKC A;  1QIS A;  1C7G A;  3K40 A;  4RLG A;  2VGS A;  1YOO A;  3I4J A;  1GC4 A;  3GBX A;  4WLJ A;  2W7K A;  2D65 A;  3R9A A;  3DC1 A;  3JW9 A;  2EPJ A;  4RM1 A;  1ARG A;  1AIC A;  4R2N A;  1UU0 A;  3GR9 A;  3A9Z A;  3MKJ A;  1AJS B;  3TAT A;  2W8J A;  4TV7 A;  3P1T A;  4ZDP A;  2W8T A;  4FL0 A;  1ELU A;  2BHX A;  3VP6 A;  1M32 A;  4ZDO A;  1AAW A;  4UOY A;  3AAT A;  3BB8 A;  3PAA A;  4JF0 A;  4OC9 A;  5EIG A;  5HDM A;  4F5G A;  4ZWV A;  5HXX A;  3A2B A;  2HZP A;  1IAY A;  1CQ6 A;  1Y4I A;  1PFF A;  1SZK A;  1AHY A;  2RFV A;  2YKU A;  1D2F A;  3QI6 A;  2BIA A;  1AMA A;  4JEX A;  4R5F A;  2CTZ A;  3UWC A;  2VGU A;  5FT5 A;  2QA3 A;  2W7L A;  3F9T A;  3MAD A;  4J5U A;  4EB5 A;  2VGZ A;  1WYV A;  1W7L A;  5E5I A;  1YJY A;  2YCP A;  3BV0 A;  4W5K A;  3AEL A;  2CH2 A;  2ZP7 A;  4WXF A;  3EIB A;  1M4N A;  3E2F A;  3QGU A;  1V2F A;  3IF2 A;  2YHK A;  2DKB A;  4XJP A;  2AY9 A;  2YRR A;  1QJ5 A;  1ZC9 A;  3P6K A;  1T3I A;  3MBB A;  3ASB A;  3VAX A;  4EU1 A;  4XAU A;  1LC5 A;  1KMJ A;  3NUI A;  2YCT A;  3B1E A;  2CJD A;  2Z67 A;  3A9X A;  3FZ6 A;  2NMP A;  5G09 A;  4AO4 A;  1ARH A;  2W7F A;  1ASE A;  3II0 A;  5M4B A;  3H7F A;  3F0H A;  4JEW A;  4OYT A;  2W7I A;  3PPL A;  2CJG A;  3JTX A;  1O69 A;  1OXO A;  1O4S A;  4QGR A;  2D61 A;  4F5J A;  1ORD A;  3FQA A;  3LVK A;  4TN4 A;  2EYQ A;  2PB0 A;  2BIG A;  3AEM C;  1AAM A;  1BJW A;  3PDX A;  3DXW A;  3ELP A;  3G8M A;  4M2M A;  4GE7 A;  1V72 A;  1SZS A;  1TAR A;  1IX6 A;  1C0N A;  1ASF A;  2CIN A;  2E7I A;  2EH6 A;  3JU7 A;  3JWB A;  4ZSY A;  3AV7 A;  2W7M A;  5G4J A;  3E2Z A;  3CQ5 A;  2V0Y A;  1ASN A;  3VK4 A;  2AY6 A;  5AX8 A;  2BI1 A;  3GET A;  4OT8 A;  1DKA A;  4UHM A;  2CY8 A;  1M0P A;  4ISY A;  1ZOB A;  3EUC A;  3AEP A;  5E3K A;  4OTL A;  4ADE A;  4EB7 A;  1YNU A;  3LVJ A;  1B9H A;  3ELE A;  3BCB A;  3NDN A;  4KAM A;  3DU4 A;  3LG0 A;  1O61 A;  2AY3 A;  3FD0 A;  4OMA A;  4A0R A;  1OXP A;  3ZRR A;  2O7C A;  3EZS A;  1ECX A;  3FFR A;  3L8A A;  2Z9W A;  3NU8 A;  4ADD A;  2VMQ A;  1WKG A;  2FM1 A;  2JGT A;  3BC8 A;  3A9Y A;  3BWO A;  2VMR A;  1IJI A;  2TPL A;  2KFP A;  1DJU A;  5EUD A;  2WK8 A;  2QSR A;  2EGY A;  1WYU B;  3MC6 A;  2FNI A;  1AJR A;  5EUE A;  4ZLV A;  1DFO A;  3E2Y A;  4F5I A;  3FKD A;  1ASB A;  1TOJ A;  2W7H A;  1ASA A;  3FTB A;  1I41 A;  5M49 A;  4P3M A;  3H9X A;  5EUN A;  1BJO B;  1LK9 A;  4A6T A;  4F5F A;  4E3Q A;  1ASD A;  5G4I A;  1ART A;  1AY5 A;  1V2D A;  2O0R A;  1IVR A;  3AOW A;  3EI9 A;  5D95 A;  3W1H A;  4IXZ A;  1SFF A;  2W8W A;  4ZSW A;  2BWN A;  3NYT A;  3PJ0 A;  2VGT A;  3VK3 A;  1ASL A;  4DBC A;  1JS6 A;  4MQR A;  4WB0 B;  1BJ4 A;  2AY8 A;  3N5M A;  3MEB A;  4WYG A;  1KKP A;  4J8L A;  1B9I A;  3EIA A;  3GJU A;  1MAQ A;  4Y0H A;  4A0G A;  1EQB A;  3F6T A;  3M5U A;  3PD6 B;  4WLH A;  2DGK A;  3B46 A;  2VI9 A;  4ZM4 A;  1DJE A;  1X2A A;  2VLH A;  4GEB A;  3USF A;  2DGL A;  4Y0D A;  2VMO A;  2W8V A;  3FFH A;  5G2Q A;  1LC7 A;  1OHV A;  4R5Z A;  2AY4 A;  3CQ6 A;  2JJG A;  3FSL A;  1M0N A;  3ECD A;  2R5E A;  3G7Q A;  3RUY A;  3DOD A;  1P3W A;  3PDB B;  1BS0 A;  5G2P A;  4CXQ A;  2Q7W A;  4CBS A;  1WYT B;  1MDO A;  3TQX A;  3NUB A;  2BYJ A;  1AJS A;  2D7Y A;  2JJE A;  2VIB A;  3FVX A;  3KKI A;  4Q31 A;  2C44 A;  1E5E A;  2DGM A;  4JE5 D;  3HDO A;  3FDB A;  3K7Y A;  4Q75 A;  3COG A;  5LH9 A;  1S06 A;  3DYD A;  1IX7 A;  2ZY4 A;  1OHW A;  3N0L A;  2F8J A;  3LVM A;  5C6U A;  2FNU A;  1IUG A;  4ZDL A;  3WKR A;  2QB2 A;  2ZYJ A;  4RKD A;  4JEV A;  2D5Y A;  3FDD A;  4K2M A;  2JJH A;  5I92 A;  4ITG A;  2FYF A;  1C9C A;  4CBR A;  4EFF A;  1J04 A;  3BS8 A;  3GZD A;  5M4D A;  1RVU A;  2X8U A;  4A72 A;  1D7V A;  2A1V A;  2YRI A;  2ZC0 A;  4BMK A;  1QIR A;  2Z1Z A;  3DR7 A;  1IX8 A;  1GDE A;  4GE9 A;  4LNJ A;  4PIW A;  7AAT A;  3FZ7 A;  2BI3 A;  2ZJG A;  4ZAS A;  2HOR A;  2C81 A;  3LWS A;  4MKJ A;  3KE3 A;  3ZZK A;  2ZY5 A;  2HP2 A;  2HP1 A;  3HQT A;  3FVU A;  3HVY A;  2ZY2 A;  1AKC A;  3WCO A;  4E3R A;  4PFN A;  3DRD A;  4XEW A;  4I8A A;  5F8V A;  1AX4 A;  3WZF A;  1ELQ A;  1SPA A;  1BJN A;  1AIA A;  1N2T A;  1QZ9 A;  2W7G A;  2X3L A;  4OBV A;  4XJL A;  1Z7D A;  2Z61 A;  4Q76 A;  4W1X A;  2DR1 A;  4AO9 A;  2VMU A;  4R8D A;  1CQ8 A;  1O62 A;  2AY2 A;  2E54 A;  2JJF A;  3JZL A;  4JEY A;  3NNK A;  4LW4 A;  4TMR A;  3AEN B;  1GEY A;  3CAI A;  1I29 A;  5DX5 A;  3ACZ A;  5FT6 A;  2HUI A;  4E1O A;  1FG7 A;  3EI7 A;  1M0Q A;  1CZE A;  1BKG A;  4AZK A;  3HMU A;  4FFC A;  1CJ0 A;  4A0H A;  2ZSL A;  1I43 A;  2XBN A;  3WX9 A;  3AEJ C;  3NX3 A;  2BI2 A;  2EZ2 A;  1RV4 A;  4F5K A;  5DJ1 A;  3A8U X;  2V1P A;  4WYD A;  4BHD A;  2HOZ A;  1D7S A;  2GQN A;  4WYA A;  1AHF A;  2Z1Y A;  4IXO A;  2O1B A;  1RVY A;  1G7W A;  3ATH A;  3B8X A;  3E9K A;  5EQC A;  3FQ8 A;  3N7N A;  9AAT A;  2FQ6 A;  4WYE A;  2ORD A;  4PVF A;  1QJ3 A;  4K05 A;  2VMV A;  2GB3 A;  1KL1 A;  1EJI A;  3E77 A;  3CQ4 A;  1OHY A;  2BWO A;  3HT4 A;  3UE8 A;  4AZJ A;  2D66 A;  1GC2 A;  2G6W A;  5G0A A;  3R4T A;  3RQ1 A;  1ASG A;  1S0A A;  1X28 A;  1CS1 A;  3Q8N A;  1ZOD A;  5M46 A;  1GD9 A;  3FCR A;  3NU7 A;  3WGB A;  2QMA A;  3N4X A;  4DGT A;  3RCH B;  3LVL B;  4KXK A;  1XI9 A;  1WKH A;  4GRX A;  2YCN A;  4B98 A;  3CBF A;  2AY7 A;  2AEU A;  1X29 A;  3RBL A;  4XK1 A;  2XH1 A;  5FT8 A;  4U2H A;  1M6S A;  1QGN A;  1DGD A;  1WYU A;  2R5C B;  4IY7 A;  3VK2 A;  3JWA A;  2ZSM A;  4PFF A;  1IBJ A;  3B1D A;  1BJO A;  3OKS A;  3VOM A;  1RV3 A;  3NYS A;  1UKJ A;  2GMS A;  5HHY A;  3RBF A;  3BCX A;  1G4X A;  3NTJ A;  1S09 A;  4OBU A;  1G7X A;  3AEM A;  3G0T A;  4DQ6 A;  3IHJ A;  1D7R A;  3K28 A;  4F4E A;  1GEW A;  3QM2 A;  1AY8 A;  1C7N A;  3LY1 A;  1AHG A;  4JF1 A;  3MAU A;  4W1W A;  3TFT A;  3AEJ A;  1GC0 A;  3NYU A;  1ASM A;  2BKW A;  4F5H A;  4WB0 A;  3QBO A;  1DJ9 A;  2R2N A;  2W7D A;  2CAN A;  1MDX A;  4WXG A;  3AEO A;  3MAF B;  3W1J A;  3TFU A;  5TF5 A;  1BQA A;  2Z9X A;  4CVQ A;  1BW0 A;  1BQD A;  3BWN C;  3PD6 A;  4IXS A;  2BI5 A;  4LNM A;  4WXB A;  1WST A;  4ZWM A;  2FN6 A;  1TAS A;  4ITX A;  2BWP A;  2PB2 A;  4L0O A;  1FG3 A;  1GEX A;  1YIY A;  2BYL A;  2EZ1 A;  2OKK A;  2OQX A;  2PO3 A;  3ISL A;  4IYO B;  3DR4 A;  3T32 A;  5JAY A;  2X5F A;  2HUF A;  4W91 A;  2Z20 A;  2AEV A;  4B9B A;  3PDB A;  5DB5 A;  1CL2 A;  1H1C A;  4CXR A;  1X0M A;  4W1V A;  4IW7 A;  1WYT A;  1VP4 A;  3DXV A;  4LNL A;  4WP0 A;  5DJ9 A;  5IWQ A;  4LW2 A;  1CL1 A;  2GSA A;  1DGE A;  1N31 A;  2WK9 A;  3N4S A;  4MSO A;  3DZZ A;  2CH1 A;  3W1I A;  3EI6 A;  4ATQ A;  1GBN A;  3AOV A;  4JEZ A;  2C7T A;  1AMQ A;  3ZRP A;  5J8Q A;  2VGV A;  1JF9 A;  3FZ8 A;  1YIZ A;  2OAT A;  5E4Z A;  3WCN A;  3ZRQ A;  3GSB A;  2VIA A;  4HF8 A;  5EIG B;  1TOG A;  3HL2 A;  3N4R A;  1CQ7 A;  1KMK A;  2CST A;  3HLM A;  1UU1 A;  2DKJ A;  3EI8 A;  1AHX A;  1QIT A;  1YJS A;  1OAT A;  1U08 A;  1TAT A;  1MLY A;  3FQ7 A;  2EO5 A;  4Y0I A;  1S08 A;  2R0T A;  1AY4 A;  3L44 A;  3PGY A;  5K8B A;  1GCK A;  4ZAH A;  4BQ0 A;  5F9S A;  1WYV B;  4H51 A;  2WKA A;  2FKI A;  2YKV A;  1KKJ A;  2OKJ A;  3PIU A;  1W3U A;  4LC3 A;  4HVK A;  3TCM A;  1E5F A;  3BWN A;  2X5D A;  1LW5 A;  1SVV A;  3EZ1 A;  2HOY A;  2G7J A;  4K2B A;  1M7Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...