2AY9A

Aromatic amino acid aminotransferase with 5-phenylvaleric acid
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
394
structure length
394
Chain Sequence
MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The active site of Paracoccus denitrificans aromatic amino acid aminotransferase has contrary properties: flexibility and rigidity.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Aminotransferase
molecule keywords AROMATIC AMINO ACID AMINOTRANSFERASE
total genus 146
structure length 394
sequence length 394
chains with identical sequence B
ec nomenclature ec 2.6.1.57: Aromatic-amino-acid transaminase.
pdb deposition date 1998-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2ay9A02
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2ay9A01
4UOYA 3MC6A 1M6SA 2VGUA 2C7TA 2GB3A 1AHFA 2O0RA 1W7LA 2O7CA 2EZ1A 8AATA 3E2YA 3PDXA 3FZ8A 2FN6A 4JE5D 2YCNA 4GE9A 3FDDA 4XJMA 2ZJGA 3NDNA 1MDZA 2BYJA 2VMSA 4E1OA 1V72A 3NU7A 3K28A 2PB0A 1EJIA 4RJYA 5EFSA 3EI9A 5EUDA 2DR1A 2C81A 3H14A 4GE4A 1KL2A 2Q7WA 4ISYA 2D7ZA 2VGVA 3FVUA 1AIAA 1YAAA 3WY7A 1AJSA 1M0PA 3PJ0A 1DJEA 1CZEA 1KL1A 1TOGA 2NMPA 2QB3A 1SZSA 2CFBA 2EO5A 1ARIA 3GWPA 3JW9A 3AOWA 3ELPA 1DTYA 1D7RA 4F4EA 1GC3A 4Q31A 1DJ9A 3UE8A 4ADDA 4AZJA 2VIBA 3ELEA 1IVRA 3MKJA 2YKYA 4K2BA 4Q76A 2YOBA 4WXFA 5EAAA 4FL0A 5K8BA 1FG3A 2GMUA 3BCXA 1BQDA 4JEYA 3PD6B 3LVJA 1TOJA 2OKKA 1O69A 1YNUA 4OTLA 1LW5A 3VP6A 4W1WA 3UAKA 2C0RA 2Z9XA 1B5PA 2VI8A 3B1CA 1GC4A 2Z9UA 4JEWA 2GMSA 4P3MA 1LC5A 2HOXA 4W91A 4CBSA 3AATA 2CY8A 4LW2A 5G2PA 1AY8A 2BI2A 2Z9VA 3LV2A 3I16A 1CQ7A 2AATA 4IXSA 4BA5A 2PB2A 1M4NA 2D61A 2EPJA 3F0HA 4CBRA 3CAIA 2AEVA 3WLXA 4F5MA 5LHAA 2OATA 2W8VA 4ATPA 3WGCA 3KGWA 1WKHA 1ASNA 3MEBA 1MAPA 1MLZA 3FQ7A 1CJ0A 2VMNA 2VMPA 4FFCA 1C0NA 4Y0HA 4Q6RA 5DJ9A 1C7GA 4A6UA 1D7VA 3HBXA 4XEWA 3DR4A 1AKBA 2BI1A 1X0MA 2R5CA 1SPAA 4W5KA 1GCKA 2FNIA 5EUEA 9AATA 4AH3A 1C7NA 1BJNA 3GZCA 1IX7A 4BMKA 4K2IA 4WYGA 5HHYA 1LC7A 1G4VA 1TOIA 1Z3ZA 2AEUA 1PMMA 2BYLA 3F6TA 5E4ZA 1WYVB 4BA4A 1LS3A 2BKWA 1OXPA 2V1PA 4E3QA 3W1IA 4LNLA 5EQCA 2CJDA 3CQ6A 3NX3A 5BJ4A 1AKCA 1TATA 1G7XA 3ECDA 3MAFA 4WLHA 1BKGA 5J8QA 1UU1A 4JE5A 3IHJA 1O61A 2AY9A 3BN1A 2CH1A 4AZKA 3OP7A 2X3LA 1BT4A 3NYUA 2YKVA 4RM1A 4E77A 2WKAA 1WSTA 2VMZA 1J04A 1YJYA 3TATA 3ASBA 3BWNC 1ZOBA 2AY8A 4A0HA 2D7YA 2W7EA 2VYCA 4W8IA 3GSBA 2PO3A 1AHYA 3IF2A 4RKDA 3D6KA 3DR7A 4QGRA 4W1VA 3USFA 1AY5A 3WX9A 5IWQA 2AY7A 1AAWA 1PFFA 1ASEA 1PG8A 2YHKA 1M0OA 1S07A 3B46A 2R5CB 1YJSA 4RLGA 3ZRQA 2W8WA 1LW4A 4LC3A 5C6UA 2ZY3A 3FQAA 4W1XA 4ZSYA 4B98A 3ASAA 3AELA 3GJUA 1QGNA 3TFUA 3MADA 4ITGA 1QISA 4KXKA 3H7FA 1UKJA 4ADBA 3A9YA 3AEOA 5G09A 1BW0A 2VIAA 4RKCA 1MDXA 5BJ3A 4H51A 4KAMA 2W7HA 4Y0DA 1CQ8A 5G4JA 3LVMA 5G0AA 4A00A 4JF1A 4F5HA 1SFFA 4AO4A 3QM2A 3T32A 4MKKA 2HUUA 4A72A 2YCTA 2OQXA 4ADEA 3QI6A 4F5FA 1CL2A 1ASCA 4A0GA 2JJHA 1XEYA 1RVYA 5FT4A 2CB1A 3A9ZA 5EIGA 3FFHA 1EQBA 1M7YA 3JWBA 3NUIA 3BCBA 4RAEA 3GBXA 4JEVA 1V2DA 3DYDA 4UHMA 1JS6A 1PMOA 5EIGB 4MQQA 3GR9A 4IXOA 3RQ1A 5M49A 2FNUA 1TARA 4WYAA 4B9BA 4XQ2A 3HL2A 1OHYA 4R5ZA 4A0RA 1VJOA 3G7QA 1KMKA 3PIUA 3QN6A 1BJWA 1E5EA 4WLJA 1O4SA 1CS1A 1W7MA 2AY5A 2ZUKA 4RITA 1RV3A 1KMJA 3FKDA 2DOUA 1OHWA 3FZ7A 2DKJA 1WYTA 3AEJA 3LWSA 4WB0A 2C44A 3I5TA 4WP0A 2OKJA 2GQNA 3PAAA 4R8DA 2Z1ZA 2DGKA 1ASDA 1BJ4A 1BJOA 1GDEA 2BWNA 5F8VA 3BV0A 2YKUA 4BQ0A 1I41A 1BJOB 3OKSA 2E7JA 2HZPA 3E2FA 4HVKA 3EUCA 2HUIA 1H1CA 3K7YA 1MGVA 3R9AA 1G4XA 2W8UA 3EIBA 4OYTA 1QJ5A 3DODA 4IYOA 4TV7A 1ASAA 4EB7A 3G8MA 3HLMA 2EGYA 3FVXA 3GETA 2JJFA 3LY1A 4CXQA 1IAXA 1V2EA 3WZFA 4F5KA 3E77A 3FD0A 4EU1A 4WXBA 2YKXA 2W7MA 1M0QA 3NNKA 4MGRA 2JJEA 5TF5A 3VK4A 1ASGA 2DGLA 3GZDA 2W7LA 4EB5A 3WKSA 2HP2A 1S0AA 3FCRA 4OMAA 3JTXA 5E3KA 3DXVA 1AIBA 3RI6A 1I48A 2QLRA 2W7KA 3QPGA 1AKAA 1QITA 2QA3A 3DU4A 4N0WA 2W7DA 2CH2A 1AX4A 1B8GA 3AENB 3JU7A 4PVFA 1AHXA 4WYDA 2ZSMA 5M4DA 1C9CA 4EFFA 4UQVA 3TCMA 3VK2A 2JGTA 3NUBA 1FC4A 1SVVA 2D63A 2JG2A 2V0YA 4ZM3A 1MDOA 1B9IA 3WGBA 1N8PA 1J32A 4F5JA 3F9TA 4F5LA 1OATA 4PFNA 1UU0A 2HOYA 3RBLA 3PDBA 3R4TA 4ATQA 1MAQA 3QGUA 1S06A 3GZDC 3KKIA 4WXGA 2CJHA 3BS8A 3A9XA 2HP1A 1N31A 3WCOA 2VI9A 2AY1A 2ZY2A 1X28A 1O62A 2QBTA 4JF0A 1SZKA 1JG8A 1W3UA 2XBNA 1IJIA 3CQ5A 4IW7A 3DXWA 1ASLA 2D64A 4JEZA 1LC8A 1JF9A 4PIWA 1GC0A 3EI6A 4GE7A 4RJ0A 4ZSWA 1AMAA 3A2BA 2ZC0A 4L0OA 2Z61A 5M46A 1C4KA 2ORDA 1ARSA 1ASMA 2JJGA 2VGSA 4IX8A 4J5UA 1S09A 4K2MA 2CSTA 4LNMA 3BB8A 4Q75A 5D5SA 2W7IA 2EH6A 7AATA 1QJ3A 2GSAA 2CANA 1AJRA 4XK1A 1WYVA 1AMQA 3LG0A 4F5IA 1DGDA 4OC9A 3CBFA 5HXXA 3PPLA 4LNJA 3ZZKA 3E2ZB 5DX5A 3FFRA 2BWPA 4GDYA 2YRRA 1CQ6A 4NOGA 3AEMC 3BCAA 3MC6C 1W23A 2VLHA 4U2HA 4GSAA 2VGWA 2ZY5A 3W1JA 5E5IA 3WKRA 2AY3A 1JS3A 3N75A 1D7SA 4IXZA 1ASFA 2VMRA 3P6KA 1EG5A 2HORA 2W7GA 5FT6A 4ZDPA 1BQAA 3E2ZA 3NYSA 4I8AA 1S08A 5FT8A 2Z20A 1ELUA 2TPLA 1QZ9A 4ZASA 1GD9A 1SF2A 1TASA 2R5EA 4E3RA 4RIZA 3NYTA 2ZYJA 3FDBA 4OBUA 4OCAA 1AHEA 5F9SA 4ZDLA 3VOMA 2FQ6A 3QBOA 4A0FA 2RFVA 1WKGA 5HDMA 2EZ2A 2XH1A 4GEBA 3DZZA 1T3IA 3N5MA 2VMXA 1ORDA 1C7OA 1SZUA 1UU2A 1B4XA 1GBNA 2W8TA 3HMUA 4MY5A 4XAUA 3ZZJA 1RV4A 2FYFA 3FQ8A 5G2QA 2BIGA 4R5FA 3BC8A 5JAYA 3LVKA 3AOVA 4J8LA 3NU8A 2WK8A 2X5DA 4IYOB 1AHGA 1B9HA 2X5FA 4F5GA 3G0TA 1W7NA 4MQPA 1YIZA 3AENA 3MAUA 2BHXA 2Z67A 2E54A 1YIYA 4ADCA 3PA9A 2E7UA 4KYOA 4Y0IA 2VMQA 4A6RA 2AY6A 4ZDOA 2YCPA 3AEPA 4AOAA 3EZ1A 2FM1A 3JZLA 4IY7A 4TN4A 1D2FA 3B1EA 3FRKA 3ZRPA 2YRIA 2BWOA 2R0TA 4MKJA 5LH9A 1M32A 1ARHA 1RVUA 2VMTA 3PD6A 3HVYA 2W7JA 1WYUB 5DJ1A 3Q8NA 2BI3A 2AY2A 4UHOA 1M0NA 4PFFA 1X2AA 1FG7A 3KGXA 2F8JA 2D66A 3MAFB 4EMYA 2E7IA 1V2FA 2JISA 2OGEA 5M4BA 2CINA 3DC1A 1Z7DA 2X8UA 2ZSLA 1AMRA 1LK9A 1TOEA 1GEWA 2VLFA 3FSLA 3PGYA 4ZWMA 3BWNA 1LKCA 1IX8A 1ELQA 1KKPA 1AICA 2VMWA 4CVQA 1DGEA 3EI8A 3RCHA 3EI7A 3L44A 1CZCA 3MBBA 1DFOA 3EIAA 3RCHB 1ZC9A 4ZWVA 3AEJC 4OBVA 3ATHA 3RUYA 1B5OA 1WYTB 4WB0B 5EUNA 3E6GA 3KE3A 4ITXA 2BIEA 3UWCA 1AJSB 2VGTA 3FVSA 1IX6A 2O1BA 2W8JA 1VEFA 4ZLVA 1ARTA 3II0A 2VMOA 1KKJA 4WYCA 1VP4A 4WYFA 1I43A 4AO9A 4UHNA 1AAMA 5DB5A 4CXRA 2CTZA 3FTBA 5AX8A 1CL1A 3B8XA 3FZ6A 2VGZA 1X29A 1GEYA 2Z9WA 3E9KA 3HQTA 3JWAA 4DBCA 3P1TA 1ARGA 2VMUA 4ZAHA 2BI5A 2HUFA 1I29A 4JEXA 3A8UX 4O6ZA 1H0CA 3VK3A 2AY4A 5D95A 3ZRRA 4XJOA 5I92A 3ISLA 4HF8A 4M2KA 4WYEA 3K40A 4MSOA 4TMRA 3RBFA 1DKAA 1ECXA 1P3WA 4MQRA 4BHDA 2BIAA 4OT8A 3CQ4A 5G4IA 3BWOA 3L8AA 3ACZA 3N0LA 2ZP7A 1MLYA 2OGAA 4XJLA 3QHXA 1IUGA 3LVLB 1TOKA 3NRAA 1GEXA 4XJPA 3WCNA 3AEMA 2CJGA 4P7YA 1IAYA 4DGTA 5FT5A 2ZY4A 1N2TA 1AMSA 3HDOA 4A6TA 2BI9A 1YJZA 3NTJA 3DRDA 2WK9A 1WYUA 3EZSA 3TFTA 1OXOA 3AV7A 3TQXA 3HT4A 1ZODA 2W7FA 2D5YA 4N0BA 1OHVA 4M2MA 2WK7A 1BS0A 2D65A 1D7UA 1DJUA 3EI5A 1TPLA 2DGMA 1XI9A 3PDBB 2R2NA 5EAVA 4GRXA 3VAXA 2VMYA 2G6WA 3I4JA 1Y4IA 2QMAA 2Z1YA 4R2NA 1E5FA 3W1HA 1GC2A 4LW4A 4DQ6A 4WD2A 3M5UA 4ZM4A 1U08A 1ASBA 1G7WA 2QB2A 1YOOA 1QIRA 1IBJA 2DKBA 4U1TA 3B1DA 3COGA 4M2JA 2HOZA 1AY4A 2VMVA 4WBTA
chains in the Genus database with same CATH superfamily
4UOYA 3MC6A 1M6SA 2VGUA 2C7TA 2GB3A 1AHFA 2O0RA 1W7LA 2O7CA 2EZ1A 8AATA 3E2YA 3PDXA 3FZ8A 2FN6A 4JE5D 2YCNA 4GE9A 3FDDA 4XJMA 2ZJGA 3NDNA 1MDZA 2BYJA 2VMSA 4E1OA 1V72A 3NU7A 3K28A 2PB0A 1EJIA 4RJYA 5EFSA 3EI9A 5EUDA 2DR1A 2C81A 3H14A 4GE4A 1KL2A 2Q7WA 4ISYA 2D7ZA 2VGVA 3FVUA 3N4XA 1AIAA 1YAAA 3WY7A 1AJSA 1M0PA 3PJ0A 1DJEA 1CZEA 1KL1A 1TOGA 2NMPA 2QB3A 1SZSA 2CFBA 2EO5A 1ARIA 3GWPA 3JW9A 3AOWA 1KAFA 3ELPA 1DTYA 1D7RA 4F4EA 1GC3A 4Q31A 1DJ9A 3UE8A 4ADDA 4AZJA 2VIBA 3ELEA 1IVRA 3MKJA 2YKYA 4K2BA 4Q76A 2YOBA 4WXFA 5EAAA 4K05A 4FL0A 5K8BA 1FG3A 2GMUA 3BCXA 1BQDA 4JEYA 3PD6B 3LVJA 1TOJA 2OKKA 1O69A 1YNUA 4OTLA 1LW5A 3VP6A 4W1WA 3UAKA 2C0RA 2Z9XA 1B5PA 2VI8A 3B1CA 1GC4A 2Z9UA 4JEWA 2GMSA 4P3MA 1LC5A 2HOXA 4W91A 4CBSA 3AATA 2CY8A 4LW2A 5G2PA 1AY8A 2BI2A 2Z9VA 3LV2A 3I16A 1CQ7A 2AATA 4IXSA 4BA5A 2PB2A 1M4NA 2D61A 2EPJA 3F0HA 4CBRA 3CAIA 2AEVA 3WLXA 4F5MA 2KFPA 5LHAA 2OATA 2W8VA 4ATPA 3WGCA 3KGWA 1WKHA 1ASNA 3MEBA 1MAPA 1MLZA 3FQ7A 1CJ0A 2VMNA 2VMPA 4FFCA 1C0NA 4Y0HA 2G7JA 4Q6RA 5DJ9A 1C7GA 4A6UA 1D7VA 3HBXA 4XEWA 3DR4A 1AKBA 2BI1A 1X0MA 2R5CA 1SPAA 4W5KA 1GCKA 2FNIA 5EUEA 9AATA 4AH3A 1C7NA 1BJNA 3GZCA 1IX7A 4BMKA 4K2IA 4WYGA 5HHYA 1LC7A 1G4VA 1TOIA 1Z3ZA 2AEUA 1PMMA 2BYLA 3F6TA 5E4ZA 1WYVB 4BA4A 1LS3A 2BKWA 1OXPA 2V1PA 4E3QA 3W1IA 4LNLA 5EQCA 2CJDA 3CQ6A 3NX3A 5BJ4A 1AKCA 1TATA 1G7XA 3ECDA 3MAFA 4WLHA 1BKGA 5J8QA 1UU1A 4JE5A 3IHJA 1O61A 2AY9A 2WB6A 3BN1A 2CH1A 4AZKA 3OP7A 2X3LA 1BT4A 3NYUA 2YKVA 4RM1A 4E77A 2WKAA 1WSTA 2VMZA 1J04A 1YJYA 3N4SA 3TATA 3ASBA 3BWNC 1ZOBA 2AY8A 4A0HA 4H63Q 2D7YA 2W7EA 2VYCA 4W8IA 3GSBA 2PO3A 1AHYA 3IF2A 4RKDA 3D6KA 3DR7A 4QGRA 4W1VA 3USFA 1AY5A 3WX9A 5IWQA 2AY7A 1AAWA 1PFFA 1ASEA 1PG8A 2YHKA 1M0OA 1S07A 3B46A 2R5CB 1YJSA 4RLGA 3ZRQA 2W8WA 1LW4A 4LC3A 5C6UA 2ZY3A 3FQAA 4W1XA 4ZSYA 4B98A 3ASAA 3AELA 3GJUA 1QGNA 3TFUA 3MADA 4ITGA 1QISA 4KXKA 3H7FA 1UKJA 4ADBA 3A9YA 3AEOA 5G09A 1BW0A 2VIAA 4RKCA 1MDXA 5BJ3A 4H51A 4KAMA 2W7HA 4Y0DA 1CQ8A 5G4JA 3LVMA 5G0AA 4A00A 4JF1A 3N7NA 4F5HA 1SFFA 4AO4A 3QM2A 3T32A 4MKKA 2HUUA 4A72A 2YCTA 2OQXA 4ADEA 3QI6A 4F5FA 1CL2A 1ASCA 4A0GA 2JJHA 1XEYA 1RVYA 5FT4A 2CB1A 3A9ZA 5EIGA 3FFHA 1EQBA 1M7YA 3JWBA 3NUIA 3BCBA 4RAEA 3GBXA 4JEVA 1V2DA 3DYDA 4UHMA 1JS6A 1PMOA 5EIGB 4MQQA 3GR9A 4IXOA 3RQ1A 5M49A 2FNUA 1TARA 4WYAA 4B9BA 4XQ2A 3HL2A 2EYQA 1OHYA 4R5ZA 4A0RA 1VJOA 3G7QA 1KMKA 3PIUA 3QN6A 1BJWA 1E5EA 4WLJA 1O4SA 1CS1A 1W7MA 2AY5A 2ZUKA 4RITA 1RV3A 1KMJA 3FKDA 2DOUA 1OHWA 3FZ7A 2DKJA 1WYTA 3AEJA 3LWSA 4WB0A 2C44A 3I5TA 4WP0A 2OKJA 2GQNA 3PAAA 4R8DA 2Z1ZA 2DGKA 1ASDA 1BJ4A 1BJOA 1GDEA 2BWNA 5F8VA 3BV0A 2YKUA 4BQ0A 1I41A 1BJOB 3OKSA 2E7JA 2HZPA 3E2FA 4HVKA 3EUCA 2HUIA 1H1CA 3K7YA 1MGVA 3R9AA 1G4XA 2W8UA 3EIBA 4OYTA 1QJ5A 3DODA 4IYOA 4TV7A 1ASAA 4EB7A 3G8MA 3HLMA 2EGYA 3FVXA 3GETA 2JJFA 3LY1A 4CXQA 1IAXA 1V2EA 3WZFA 4F5KA 3E77A 3FD0A 4EU1A 2A1VA 4WXBA 2YKXA 2W7MA 1M0QA 3NNKA 4MGRA 2JJEA 5TF5A 3VK4A 1ASGA 2DGLA 3GZDA 2W7LA 4EB5A 3WKSA 2HP2A 1S0AA 3FCRA 4OMAA 3JTXA 5E3KA 3DXVA 1AIBA 3RI6A 1I48A 2QLRA 2W7KA 3QPGA 1AKAA 1QITA 2QA3A 3DU4A 4N0WA 2W7DA 2CH2A 1AX4A 1B8GA 3AENB 3JU7A 4PVFA 1AHXA 4WYDA 2ZSMA 5M4DA 1C9CA 4EFFA 4UQVA 3TCMA 3VK2A 2JGTA 3NUBA 1FC4A 1SVVA 2D63A 2JG2A 2V0YA 4ZM3A 1MDOA 1B9IA 3WGBA 1N8PA 1J32A 4F5JA 3F9TA 4F5LA 1OATA 4PFNA 1UU0A 2HOYA 3RBLA 3PDBA 3R4TA 4ATQA 1MAQA 3QGUA 1S06A 3GZDC 3KKIA 4WXGA 2FKIA 2CJHA 3BS8A 3A9XA 2HP1A 1N31A 3WCOA 2VI9A 2AY1A 2ZY2A 1X28A 1O62A 2QBTA 4JF0A 1SZKA 1JG8A 1W3UA 2XBNA 1IJIA 3CQ5A 4IW7A 3DXWA 1ASLA 2D64A 4JEZA 1LC8A 1JF9A 4PIWA 1GC0A 3EI6A 4GE7A 4RJ0A 4ZSWA 1AMAA 3A2BA 2ZC0A 4L0OA 2Z61A 5M46A 1C4KA 2ORDA 1ARSA 1ASMA 2JJGA 2VGSA 4IX8A 4J5UA 1S09A 4K2MA 2CSTA 4LNMA 3BB8A 4Q75A 5D5SA 2W7IA 2EH6A 7AATA 1QJ3A 2GSAA 2CANA 1AJRA 4XK1A 1WYVA 1AMQA 3LG0A 4F5IA 1DGDA 4OC9A 3CBFA 5HXXA 3PPLA 4LNJA 3ZZKA 3E2ZB 5DX5A 3FFRA 2BWPA 4GDYA 2YRRA 1CQ6A 4NOGA 3AEMC 3BCAA 3MC6C 1W23A 2VLHA 4U2HA 4GSAA 2VGWA 2ZY5A 3W1JA 5E5IA 3WKRA 2AY3A 1JS3A 3N75A 1D7SA 4IXZA 1ASFA 2VMRA 3P6KA 1EG5A 2HORA 2W7GA 5FT6A 4ZDPA 1BQAA 3E2ZA 3NYSA 4I8AA 1S08A 5FT8A 2Z20A 1ELUA 2TPLA 1QZ9A 4ZASA 1GD9A 1SF2A 1TASA 2R5EA 4E3RA 4RIZA 3NYTA 2ZYJA 3FDBA 4OBUA 4OCAA 1AHEA 5F9SA 4ZDLA 3VOMA 2FQ6A 3H9XA 3QBOA 4A0FA 2RFVA 1WKGA 5HDMA 2EZ2A 2XH1A 4GEBA 3DZZA 1T3IA 3N5MA 2VMXA 1ORDA 1C7OA 1SZUA 1UU2A 1B4XA 1GBNA 2W8TA 3HMUA 4MY5A 4XAUA 3ZZJA 1RV4A 2FYFA 3FQ8A 5G2QA 2BIGA 4R5FA 3BC8A 5JAYA 3LVKA 3AOVA 4J8LA 3NU8A 2WK8A 2X5DA 4IYOB 1AHGA 1B9HA 2X5FA 4F5GA 3G0TA 1W7NA 4MQPA 1YIZA 3AENA 3MAUA 2BHXA 2Z67A 2E54A 1YIYA 4ADCA 3PA9A 2E7UA 4KYOA 4Y0IA 2VMQA 4A6RA 2AY6A 4ZDOA 2YCPA 3AEPA 4AOAA 3EZ1A 2FM1A 3JZLA 4IY7A 4TN4A 1D2FA 3B1EA 3FRKA 3ZRPA 2YRIA 2BWOA 2R0TA 4MKJA 5LH9A 1M32A 1ARHA 1RVUA 2VMTA 3PD6A 3HVYA 2W7JA 1WYUB 5DJ1A 3Q8NA 2BI3A 2AY2A 4UHOA 1M0NA 4PFFA 1X2AA 1FG7A 3KGXA 2F8JA 2D66A 3MAFB 4EMYA 2E7IA 1V2FA 2JISA 2OGEA 5M4BA 2CINA 3DC1A 1Z7DA 2X8UA 2ZSLA 1AMRA 1LK9A 1TOEA 1GEWA 2VLFA 3FSLA 3PGYA 4ZWMA 3BWNA 1LKCA 1IX8A 1ELQA 1KKPA 1AICA 2VMWA 4CVQA 5KTBA 1DGEA 3EI8A 3RCHA 3EI7A 3L44A 1CZCA 3MBBA 1DFOA 3EIAA 3RCHB 1ZC9A 4ZWVA 3AEJC 4OBVA 3ATHA 3RUYA 1B5OA 1WYTB 4WB0B 5EUNA 3E6GA 3KE3A 2QSRA 4ITXA 2BIEA 3UWCA 1AJSB 2VGTA 3FVSA 1IX6A 2O1BA 2W8JA 1VEFA 4ZLVA 1ARTA 3II0A 2VMOA 1KKJA 4WYCA 1VP4A 4WYFA 1I43A 4AO9A 3N4RA 4UHNA 1AAMA 5DB5A 4CXRA 2CTZA 3FTBA 5AX8A 1CL1A 3B8XA 3FZ6A 2VGZA 1X29A 1GEYA 2Z9WA 3E9KA 3HQTA 3JWAA 4DBCA 3P1TA 1ARGA 2VMUA 4ZAHA 2BI5A 2HUFA 1I29A 4JEXA 3A8UX 4O6ZA 1H0CA 3VK3A 2AY4A 5D95A 3ZRRA 4XJOA 5I92A 3ISLA 4HF8A 4M2KA 4WYEA 3K40A 4MSOA 4TMRA 3RBFA 1DKAA 1ECXA 1P3WA 4MQRA 4BHDA 2BIAA 4OT8A 3CQ4A 5G4IA 3BWOA 3L8AA 3ACZA 3N0LA 2ZP7A 1MLYA 2OGAA 4XJLA 3QHXA 1IUGA 3LVLB 1TOKA 3NRAA 1GEXA 4XJPA 3WCNA 3AEMA 2CJGA 4P7YA 1IAYA 4DGTA 5FT5A 2ZY4A 1N2TA 1AMSA 3HDOA 4A6TA 2BI9A 1YJZA 3NTJA 3DRDA 2WK9A 1WYUA 3EZSA 3TFTA 1OXOA 3AV7A 3TQXA 3HT4A 1ZODA 2W7FA 2D5YA 4N0BA 1OHVA 4M2MA 2WK7A 1BS0A 2D65A 1D7UA 1DJUA 3EI5A 1TPLA 2DGMA 1XI9A 3PDBB 2R2NA 5EAVA 4GRXA 3VAXA 2VMYA 2G6WA 3I4JA 1Y4IA 2QMAA 2Z1YA 4R2NA 1E5FA 3W1HA 1GC2A 4LW4A 4DQ6A 4WD2A 3M5UA 4ZM4A 1U08A 1ASBA 1G7WA 2QB2A 1YOOA 1QIRA 1IBJA 2DKBA 4U1TA 3B1DA 3COGA 4M2JA 2HOZA 1AY4A 2VMVA 4WBTA
chains in the Genus database with same CATH topology
4UOYA 3MC6A 1M6SA 2VGUA 2C7TA 2GB3A 1AHFA 2O0RA 1W7LA 2O7CA 2EZ1A 8AATA 3E2YA 3PDXA 3FZ8A 2FN6A 4JE5D 2YCNA 4GE9A 3FDDA 4XJMA 2ZJGA 3NDNA 1MDZA 2BYJA 2VMSA 4E1OA 1V72A 3NU7A 3K28A 2PB0A 1EJIA 4RJYA 5EFSA 3EI9A 5EUDA 2DR1A 2C81A 3H14A 4GE4A 1KL2A 2Q7WA 4ISYA 2D7ZA 2VGVA 3FVUA 3N4XA 1AIAA 1YAAA 3WY7A 1AJSA 1M0PA 3PJ0A 1DJEA 1CZEA 1KL1A 1TOGA 2NMPA 2QB3A 1SZSA 2CFBA 2EO5A 1ARIA 3GWPA 3JW9A 3AOWA 3ELPA 1DTYA 1D7RA 4F4EA 1GC3A 4Q31A 1DJ9A 3UE8A 4ADDA 4AZJA 2VIBA 3ELEA 1IVRA 3MKJA 2YKYA 4K2BA 4Q76A 2YOBA 4WXFA 5EAAA 4K05A 4FL0A 5K8BA 1FG3A 2GMUA 3BCXA 1BQDA 4JEYA 3PD6B 3LVJA 1TOJA 2OKKA 1O69A 1YNUA 4OTLA 1LW5A 3VP6A 4W1WA 3UAKA 2C0RA 2Z9XA 1B5PA 2VI8A 3B1CA 1GC4A 2Z9UA 4JEWA 2GMSA 4P3MA 1LC5A 2HOXA 4W91A 4CBSA 3AATA 2CY8A 4LW2A 5G2PA 1AY8A 2BI2A 2Z9VA 3LV2A 3I16A 1CQ7A 2AATA 4IXSA 4BA5A 2PB2A 1M4NA 2D61A 2EPJA 3F0HA 4CBRA 3CAIA 2AEVA 3WLXA 4F5MA 2KFPA 5LHAA 2OATA 2W8VA 4ATPA 3WGCA 3KGWA 1WKHA 1ASNA 3MEBA 1MAPA 1MLZA 3FQ7A 1CJ0A 2VMNA 2VMPA 4FFCA 1C0NA 4Y0HA 2G7JA 4Q6RA 5DJ9A 1C7GA 4A6UA 1D7VA 3HBXA 4XEWA 3DR4A 1AKBA 2BI1A 1X0MA 2R5CA 1SPAA 4W5KA 1GCKA 2FNIA 5EUEA 9AATA 4AH3A 1C7NA 1BJNA 3GZCA 1IX7A 4BMKA 4K2IA 4WYGA 5HHYA 1LC7A 1G4VA 1TOIA 1Z3ZA 2AEUA 1PMMA 2BYLA 3F6TA 5E4ZA 1WYVB 4BA4A 1LS3A 2BKWA 1OXPA 2V1PA 4E3QA 3W1IA 4LNLA 5EQCA 2CJDA 3CQ6A 3NX3A 5BJ4A 1AKCA 1TATA 1G7XA 3ECDA 3MAFA 4WLHA 1BKGA 5J8QA 1UU1A 4JE5A 3IHJA 1O61A 2AY9A 2WB6A 3BN1A 2CH1A 4AZKA 3OP7A 2X3LA 1BT4A 3NYUA 2YKVA 4RM1A 4E77A 2WKAA 1WSTA 2VMZA 1J04A 1YJYA 3N4SA 3TATA 3ASBA 3BWNC 1ZOBA 2AY8A 4A0HA 4H63Q 2D7YA 2W7EA 2VYCA 4W8IA 3GSBA 2PO3A 1AHYA 3IF2A 4RKDA 3D6KA 3DR7A 4QGRA 4W1VA 3USFA 1AY5A 3WX9A 5IWQA 2AY7A 1AAWA 1PFFA 1ASEA 1PG8A 2YHKA 1M0OA 1S07A 3B46A 2R5CB 1YJSA 4RLGA 3ZRQA 2W8WA 1LW4A 4LC3A 5C6UA 2ZY3A 3FQAA 4W1XA 4ZSYA 4B98A 3ASAA 3AELA 3GJUA 1QGNA 3TFUA 3MADA 4ITGA 1QISA 4KXKA 3H7FA 1UKJA 4ADBA 3A9YA 3AEOA 5G09A 1BW0A 2VIAA 4RKCA 1MDXA 5BJ3A 4H51A 4KAMA 2W7HA 4Y0DA 1CQ8A 5G4JA 3LVMA 5G0AA 4A00A 4JF1A 3N7NA 4F5HA 1SFFA 4AO4A 3QM2A 3T32A 4MKKA 2HUUA 4A72A 2YCTA 2OQXA 4ADEA 3QI6A 4F5FA 1CL2A 1ASCA 4A0GA 2JJHA 1XEYA 1RVYA 5FT4A 2CB1A 3A9ZA 5EIGA 3FFHA 1EQBA 1M7YA 3JWBA 3NUIA 3BCBA 4RAEA 3GBXA 4JEVA 1V2DA 3DYDA 4UHMA 1JS6A 1PMOA 5EIGB 4MQQA 3GR9A 4IXOA 3RQ1A 5M49A 2FNUA 1TARA 4WYAA 4B9BA 4XQ2A 3HL2A 2EYQA 1OHYA 4R5ZA 4A0RA 1VJOA 3G7QA 1KMKA 3PIUA 3QN6A 1BJWA 1E5EA 4WLJA 1O4SA 1CS1A 1W7MA 2AY5A 2ZUKA 4RITA 1RV3A 1KMJA 3FKDA 2DOUA 1OHWA 3FZ7A 2DKJA 1WYTA 3AEJA 3LWSA 4WB0A 2C44A 3I5TA 4WP0A 2OKJA 2GQNA 3PAAA 4R8DA 2Z1ZA 2DGKA 1ASDA 1BJ4A 1BJOA 1GDEA 2BWNA 5F8VA 3BV0A 2YKUA 4BQ0A 1I41A 1BJOB 3OKSA 2E7JA 2HZPA 3E2FA 4HVKA 3EUCA 2HUIA 1H1CA 3K7YA 1MGVA 3R9AA 1G4XA 2W8UA 3EIBA 4OYTA 1QJ5A 3DODA 4IYOA 4TV7A 1ASAA 4EB7A 3G8MA 3HLMA 2EGYA 3FVXA 3GETA 2JJFA 3LY1A 4CXQA 1IAXA 1V2EA 3WZFA 4F5KA 3E77A 3FD0A 4EU1A 2A1VA 4WXBA 2YKXA 2W7MA 1M0QA 3NNKA 4MGRA 2JJEA 5TF5A 3VK4A 1ASGA 2DGLA 3GZDA 2W7LA 4EB5A 3WKSA 2HP2A 1S0AA 3FCRA 4OMAA 3JTXA 5E3KA 3DXVA 1AIBA 3RI6A 1I48A 2QLRA 2W7KA 3QPGA 1AKAA 1QITA 2QA3A 3DU4A 4N0WA 2W7DA 2CH2A 1AX4A 1B8GA 3AENB 3JU7A 4PVFA 1AHXA 4WYDA 2ZSMA 5M4DA 1C9CA 4EFFA 4UQVA 3TCMA 3VK2A 2JGTA 3NUBA 1FC4A 1SVVA 2D63A 2JG2A 2V0YA 4ZM3A 1MDOA 1B9IA 3WGBA 1N8PA 1J32A 4F5JA 3F9TA 4F5LA 1OATA 4PFNA 1UU0A 2HOYA 3RBLA 3PDBA 3R4TA 4ATQA 1MAQA 3QGUA 1S06A 3GZDC 3KKIA 4WXGA 2FKIA 2CJHA 3BS8A 3A9XA 2HP1A 1N31A 3WCOA 2VI9A 2AY1A 2ZY2A 1X28A 1O62A 2QBTA 4JF0A 1SZKA 1JG8A 1W3UA 2XBNA 1IJIA 3CQ5A 4IW7A 3DXWA 1ASLA 2D64A 4JEZA 1LC8A 1JF9A 4PIWA 1GC0A 3EI6A 4GE7A 4RJ0A 4ZSWA 1AMAA 3A2BA 2ZC0A 4L0OA 2Z61A 5M46A 1C4KA 2ORDA 1ARSA 1ASMA 2JJGA 2VGSA 4IX8A 4J5UA 1S09A 4K2MA 2CSTA 4LNMA 3BB8A 4Q75A 5D5SA 2W7IA 2EH6A 7AATA 1QJ3A 2GSAA 2CANA 1AJRA 4XK1A 1WYVA 1AMQA 3LG0A 4F5IA 1DGDA 4OC9A 3CBFA 5HXXA 3PPLA 4LNJA 3ZZKA 3E2ZB 5DX5A 3FFRA 2BWPA 4GDYA 2YRRA 1CQ6A 4NOGA 3AEMC 3BCAA 3MC6C 1W23A 2VLHA 4U2HA 4GSAA 2VGWA 2ZY5A 3W1JA 5E5IA 3WKRA 2AY3A 1JS3A 3N75A 1D7SA 4IXZA 1ASFA 2VMRA 3P6KA 1EG5A 2HORA 2W7GA 5FT6A 4ZDPA 1BQAA 3E2ZA 3NYSA 4I8AA 1S08A 5FT8A 2Z20A 1ELUA 2TPLA 1QZ9A 4ZASA 1GD9A 1SF2A 1TASA 2R5EA 4E3RA 4RIZA 3NYTA 2ZYJA 3FDBA 4OBUA 4OCAA 1AHEA 5F9SA 4ZDLA 3VOMA 2FQ6A 3H9XA 3QBOA 4A0FA 2RFVA 1WKGA 5HDMA 2EZ2A 2XH1A 4GEBA 3DZZA 1T3IA 3N5MA 2VMXA 1ORDA 1C7OA 1SZUA 1UU2A 1B4XA 1GBNA 2W8TA 3HMUA 4MY5A 4XAUA 3ZZJA 1RV4A 2FYFA 3FQ8A 5G2QA 2BIGA 4R5FA 3BC8A 5JAYA 3LVKA 3AOVA 4J8LA 3NU8A 2WK8A 2X5DA 4IYOB 1AHGA 1B9HA 2X5FA 4F5GA 3G0TA 1W7NA 4MQPA 1YIZA 3AENA 3MAUA 2BHXA 2Z67A 2E54A 1YIYA 4ADCA 3PA9A 2E7UA 4KYOA 4Y0IA 2VMQA 4A6RA 2AY6A 4ZDOA 2YCPA 3AEPA 4AOAA 3EZ1A 2FM1A 3JZLA 4IY7A 4TN4A 1D2FA 3B1EA 3FRKA 3ZRPA 2YRIA 2BWOA 2R0TA 4MKJA 5LH9A 1M32A 1ARHA 1RVUA 2VMTA 3PD6A 3HVYA 2W7JA 1WYUB 5DJ1A 3Q8NA 2BI3A 2AY2A 4UHOA 1M0NA 4PFFA 1X2AA 1FG7A 3KGXA 2F8JA 2D66A 3MAFB 4EMYA 2E7IA 1V2FA 2JISA 2OGEA 5M4BA 2CINA 3DC1A 1Z7DA 2X8UA 2ZSLA 1AMRA 1LK9A 1TOEA 1GEWA 2VLFA 3FSLA 3PGYA 4ZWMA 3BWNA 1LKCA 1IX8A 1ELQA 1KKPA 1AICA 2VMWA 4CVQA 5KTBA 1DGEA 3EI8A 3RCHA 3EI7A 3L44A 1CZCA 3MBBA 1DFOA 3EIAA 3RCHB 1ZC9A 4ZWVA 3AEJC 4OBVA 3ATHA 3RUYA 1B5OA 1WYTB 4WB0B 5EUNA 3E6GA 3KE3A 2QSRA 4ITXA 2BIEA 3UWCA 1AJSB 2VGTA 3FVSA 1IX6A 2O1BA 2W8JA 1VEFA 4ZLVA 1ARTA 3II0A 2VMOA 1KKJA 4WYCA 1VP4A 4WYFA 1I43A 4AO9A 3N4RA 4UHNA 1AAMA 5DB5A 4CXRA 2CTZA 3FTBA 5AX8A 1CL1A 3B8XA 3FZ6A 2VGZA 1X29A 1GEYA 2Z9WA 3E9KA 3HQTA 3JWAA 4DBCA 3P1TA 1ARGA 2VMUA 4ZAHA 2BI5A 2HUFA 1I29A 4JEXA 3A8UX 4O6ZA 1H0CA 3VK3A 2AY4A 5D95A 3ZRRA 4XJOA 5I92A 3ISLA 4HF8A 4M2KA 4WYEA 3K40A 4MSOA 4TMRA 3RBFA 1DKAA 1ECXA 1P3WA 4MQRA 4BHDA 2BIAA 4OT8A 3CQ4A 5G4IA 3BWOA 3L8AA 3ACZA 3N0LA 2ZP7A 1MLYA 2OGAA 4XJLA 3QHXA 1IUGA 3LVLB 1TOKA 3NRAA 1GEXA 4XJPA 3WCNA 3AEMA 2CJGA 4P7YA 1IAYA 4DGTA 5FT5A 2ZY4A 1N2TA 1AMSA 3HDOA 4A6TA 2BI9A 1YJZA 3NTJA 3DRDA 2WK9A 1WYUA 3EZSA 3TFTA 1OXOA 3AV7A 3TQXA 3HT4A 1ZODA 2W7FA 2D5YA 4N0BA 1OHVA 4M2MA 2WK7A 1BS0A 2D65A 1D7UA 1DJUA 3EI5A 1TPLA 2DGMA 1XI9A 3PDBB 2R2NA 5EAVA 4GRXA 3VAXA 2VMYA 2G6WA 3I4JA 1Y4IA 2QMAA 2Z1YA 4R2NA 1E5FA 3W1HA 1GC2A 4LW4A 4DQ6A 4WD2A 3M5UA 4ZM4A 1U08A 1ASBA 1G7WA 2QB2A 1YOOA 1QIRA 1IBJA 2DKBA 4U1TA 3B1DA 3COGA 4M2JA 2HOZA 1AY4A 2VMVA 4WBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UOY A;  3MC6 A;  1M6S A;  2VGU A;  2C7T A;  2GB3 A;  1AHF A;  2O0R A;  1W7L A;  2O7C A;  2EZ1 A;  8AAT A;  3E2Y A;  3PDX A;  3FZ8 A;  2FN6 A;  4JE5 D;  2YCN A;  4GE9 A;  3FDD A;  4XJM A;  2ZJG A;  3NDN A;  1MDZ A;  2BYJ A;  2VMS A;  4E1O A;  1V72 A;  3NU7 A;  3K28 A;  2PB0 A;  1EJI A;  4RJY A;  5EFS A;  3EI9 A;  5EUD A;  2DR1 A;  2C81 A;  3H14 A;  4GE4 A;  1KL2 A;  2Q7W A;  4ISY A;  2D7Z A;  2VGV A;  3FVU A;  1AIA A;  1YAA A;  3WY7 A;  1AJS A;  1M0P A;  3PJ0 A;  1DJE A;  1CZE A;  1KL1 A;  1TOG A;  2NMP A;  2QB3 A;  1SZS A;  2CFB A;  2EO5 A;  1ARI A;  3GWP A;  3JW9 A;  3AOW A;  3ELP A;  1DTY A;  1D7R A;  4F4E A;  1GC3 A;  4Q31 A;  1DJ9 A;  3UE8 A;  4ADD A;  4AZJ A;  2VIB A;  3ELE A;  1IVR A;  3MKJ A;  2YKY A;  4K2B A;  4Q76 A;  2YOB A;  4WXF A;  5EAA A;  4FL0 A;  5K8B A;  1FG3 A;  2GMU A;  3BCX A;  1BQD A;  4JEY A;  3PD6 B;  3LVJ A;  1TOJ A;  2OKK A;  1O69 A;  1YNU A;  4OTL A;  1LW5 A;  3VP6 A;  4W1W A;  3UAK A;  2C0R A;  2Z9X A;  1B5P A;  2VI8 A;  3B1C A;  1GC4 A;  2Z9U A;  4JEW A;  2GMS A;  4P3M A;  1LC5 A;  2HOX A;  4W91 A;  4CBS A;  3AAT A;  2CY8 A;  4LW2 A;  5G2P A;  1AY8 A;  2BI2 A;  2Z9V A;  3LV2 A;  3I16 A;  1CQ7 A;  2AAT A;  4IXS A;  4BA5 A;  2PB2 A;  1M4N A;  2D61 A;  2EPJ A;  3F0H A;  4CBR A;  3CAI A;  2AEV A;  3WLX A;  4F5M A;  5LHA A;  2OAT A;  2W8V A;  4ATP A;  3WGC A;  3KGW A;  1WKH A;  1ASN A;  3MEB A;  1MAP A;  1MLZ A;  3FQ7 A;  1CJ0 A;  2VMN A;  2VMP A;  4FFC A;  1C0N A;  4Y0H A;  4Q6R A;  5DJ9 A;  1C7G A;  4A6U A;  1D7V A;  3HBX A;  4XEW A;  3DR4 A;  1AKB A;  2BI1 A;  1X0M A;  2R5C A;  1SPA A;  4W5K A;  1GCK A;  2FNI A;  5EUE A;  9AAT A;  4AH3 A;  1C7N A;  1BJN A;  3GZC A;  1IX7 A;  4BMK A;  4K2I A;  4WYG A;  5HHY A;  1LC7 A;  1G4V A;  1TOI A;  1Z3Z A;  2AEU A;  1PMM A;  2BYL A;  3F6T A;  5E4Z A;  1WYV B;  4BA4 A;  1LS3 A;  2BKW A;  1OXP A;  2V1P A;  4E3Q A;  3W1I A;  4LNL A;  5EQC A;  2CJD A;  3CQ6 A;  3NX3 A;  5BJ4 A;  1AKC A;  1TAT A;  1G7X A;  3ECD A;  3MAF A;  4WLH A;  1BKG A;  5J8Q A;  1UU1 A;  4JE5 A;  3IHJ A;  1O61 A;  2AY9 A;  3BN1 A;  2CH1 A;  4AZK A;  3OP7 A;  2X3L A;  1BT4 A;  3NYU A;  2YKV A;  4RM1 A;  4E77 A;  2WKA A;  1WST A;  2VMZ A;  1J04 A;  1YJY A;  3TAT A;  3ASB A;  3BWN C;  1ZOB A;  2AY8 A;  4A0H A;  2D7Y A;  2W7E A;  2VYC A;  4W8I A;  3GSB A;  2PO3 A;  1AHY A;  3IF2 A;  4RKD A;  3D6K A;  3DR7 A;  4QGR A;  4W1V A;  3USF A;  1AY5 A;  3WX9 A;  5IWQ A;  2AY7 A;  1AAW A;  1PFF A;  1ASE A;  1PG8 A;  2YHK A;  1M0O A;  1S07 A;  3B46 A;  2R5C B;  1YJS A;  4RLG A;  3ZRQ A;  2W8W A;  1LW4 A;  4LC3 A;  5C6U A;  2ZY3 A;  3FQA A;  4W1X A;  4ZSY A;  4B98 A;  3ASA A;  3AEL A;  3GJU A;  1QGN A;  3TFU A;  3MAD A;  4ITG A;  1QIS A;  4KXK A;  3H7F A;  1UKJ A;  4ADB A;  3A9Y A;  3AEO A;  5G09 A;  1BW0 A;  2VIA A;  4RKC A;  1MDX A;  5BJ3 A;  4H51 A;  4KAM A;  2W7H A;  4Y0D A;  1CQ8 A;  5G4J A;  3LVM A;  5G0A A;  4A00 A;  4JF1 A;  4F5H A;  1SFF A;  4AO4 A;  3QM2 A;  3T32 A;  4MKK A;  2HUU A;  4A72 A;  2YCT A;  2OQX A;  4ADE A;  3QI6 A;  4F5F A;  1CL2 A;  1ASC A;  4A0G A;  2JJH A;  1XEY A;  1RVY A;  5FT4 A;  2CB1 A;  3A9Z A;  5EIG A;  3FFH A;  1EQB A;  1M7Y A;  3JWB A;  3NUI A;  3BCB A;  4RAE A;  3GBX A;  4JEV A;  1V2D A;  3DYD A;  4UHM A;  1JS6 A;  1PMO A;  5EIG B;  4MQQ A;  3GR9 A;  4IXO A;  3RQ1 A;  5M49 A;  2FNU A;  1TAR A;  4WYA A;  4B9B A;  4XQ2 A;  3HL2 A;  1OHY A;  4R5Z A;  4A0R A;  1VJO A;  3G7Q A;  1KMK A;  3PIU A;  3QN6 A;  1BJW A;  1E5E A;  4WLJ A;  1O4S A;  1CS1 A;  1W7M A;  2AY5 A;  2ZUK A;  4RIT A;  1RV3 A;  1KMJ A;  3FKD A;  2DOU A;  1OHW A;  3FZ7 A;  2DKJ A;  1WYT A;  3AEJ A;  3LWS A;  4WB0 A;  2C44 A;  3I5T A;  4WP0 A;  2OKJ A;  2GQN A;  3PAA A;  4R8D A;  2Z1Z A;  2DGK A;  1ASD A;  1BJ4 A;  1BJO A;  1GDE A;  2BWN A;  5F8V A;  3BV0 A;  2YKU A;  4BQ0 A;  1I41 A;  1BJO B;  3OKS A;  2E7J A;  2HZP A;  3E2F A;  4HVK A;  3EUC A;  2HUI A;  1H1C A;  3K7Y A;  1MGV A;  3R9A A;  1G4X A;  2W8U A;  3EIB A;  4OYT A;  1QJ5 A;  3DOD A;  4IYO A;  4TV7 A;  1ASA A;  4EB7 A;  3G8M A;  3HLM A;  2EGY A;  3FVX A;  3GET A;  2JJF A;  3LY1 A;  4CXQ A;  1IAX A;  1V2E A;  3WZF A;  4F5K A;  3E77 A;  3FD0 A;  4EU1 A;  4WXB A;  2YKX A;  2W7M A;  1M0Q A;  3NNK A;  4MGR A;  2JJE A;  5TF5 A;  3VK4 A;  1ASG A;  2DGL A;  3GZD A;  2W7L A;  4EB5 A;  3WKS A;  2HP2 A;  1S0A A;  3FCR A;  4OMA A;  3JTX A;  5E3K A;  3DXV A;  1AIB A;  3RI6 A;  1I48 A;  2QLR A;  2W7K A;  3QPG A;  1AKA A;  1QIT A;  2QA3 A;  3DU4 A;  4N0W A;  2W7D A;  2CH2 A;  1AX4 A;  1B8G A;  3AEN B;  3JU7 A;  4PVF A;  1AHX A;  4WYD A;  2ZSM A;  5M4D A;  1C9C A;  4EFF A;  4UQV A;  3TCM A;  3VK2 A;  2JGT A;  3NUB A;  1FC4 A;  1SVV A;  2D63 A;  2JG2 A;  2V0Y A;  4ZM3 A;  1MDO A;  1B9I A;  3WGB A;  1N8P A;  1J32 A;  4F5J A;  3F9T A;  4F5L A;  1OAT A;  4PFN A;  1UU0 A;  2HOY A;  3RBL A;  3PDB A;  3R4T A;  4ATQ A;  1MAQ A;  3QGU A;  1S06 A;  3GZD C;  3KKI A;  4WXG A;  2CJH A;  3BS8 A;  3A9X A;  2HP1 A;  1N31 A;  3WCO A;  2VI9 A;  2AY1 A;  2ZY2 A;  1X28 A;  1O62 A;  2QBT A;  4JF0 A;  1SZK A;  1JG8 A;  1W3U A;  2XBN A;  1IJI A;  3CQ5 A;  4IW7 A;  3DXW A;  1ASL A;  2D64 A;  4JEZ A;  1LC8 A;  1JF9 A;  4PIW A;  1GC0 A;  3EI6 A;  4GE7 A;  4RJ0 A;  4ZSW A;  1AMA A;  3A2B A;  2ZC0 A;  4L0O A;  2Z61 A;  5M46 A;  1C4K A;  2ORD A;  1ARS A;  1ASM A;  2JJG A;  2VGS A;  4IX8 A;  4J5U A;  1S09 A;  4K2M A;  2CST A;  4LNM A;  3BB8 A;  4Q75 A;  5D5S A;  2W7I A;  2EH6 A;  7AAT A;  1QJ3 A;  2GSA A;  2CAN A;  1AJR A;  4XK1 A;  1WYV A;  1AMQ A;  3LG0 A;  4F5I A;  1DGD A;  4OC9 A;  3CBF A;  5HXX A;  3PPL A;  4LNJ A;  3ZZK A;  3E2Z B;  5DX5 A;  3FFR A;  2BWP A;  4GDY A;  2YRR A;  1CQ6 A;  4NOG A;  3AEM C;  3BCA A;  3MC6 C;  1W23 A;  2VLH A;  4U2H A;  4GSA A;  2VGW A;  2ZY5 A;  3W1J A;  5E5I A;  3WKR A;  2AY3 A;  1JS3 A;  3N75 A;  1D7S A;  4IXZ A;  1ASF A;  2VMR A;  3P6K A;  1EG5 A;  2HOR A;  2W7G A;  5FT6 A;  4ZDP A;  1BQA A;  3E2Z A;  3NYS A;  4I8A A;  1S08 A;  5FT8 A;  2Z20 A;  1ELU A;  2TPL A;  1QZ9 A;  4ZAS A;  1GD9 A;  1SF2 A;  1TAS A;  2R5E A;  4E3R A;  4RIZ A;  3NYT A;  2ZYJ A;  3FDB A;  4OBU A;  4OCA A;  1AHE A;  5F9S A;  4ZDL A;  3VOM A;  2FQ6 A;  3QBO A;  4A0F A;  2RFV A;  1WKG A;  5HDM A;  2EZ2 A;  2XH1 A;  4GEB A;  3DZZ A;  1T3I A;  3N5M A;  2VMX A;  1ORD A;  1C7O A;  1SZU A;  1UU2 A;  1B4X A;  1GBN A;  2W8T A;  3HMU A;  4MY5 A;  4XAU A;  3ZZJ A;  1RV4 A;  2FYF A;  3FQ8 A;  5G2Q A;  2BIG A;  4R5F A;  3BC8 A;  5JAY A;  3LVK A;  3AOV A;  4J8L A;  3NU8 A;  2WK8 A;  2X5D A;  4IYO B;  1AHG A;  1B9H A;  2X5F A;  4F5G A;  3G0T A;  1W7N A;  4MQP A;  1YIZ A;  3AEN A;  3MAU A;  2BHX A;  2Z67 A;  2E54 A;  1YIY A;  4ADC A;  3PA9 A;  2E7U A;  4KYO A;  4Y0I A;  2VMQ A;  4A6R A;  2AY6 A;  4ZDO A;  2YCP A;  3AEP A;  4AOA A;  3EZ1 A;  2FM1 A;  3JZL A;  4IY7 A;  4TN4 A;  1D2F A;  3B1E A;  3FRK A;  3ZRP A;  2YRI A;  2BWO A;  2R0T A;  4MKJ A;  5LH9 A;  1M32 A;  1ARH A;  1RVU A;  2VMT A;  3PD6 A;  3HVY A;  2W7J A;  1WYU B;  5DJ1 A;  3Q8N A;  2BI3 A;  2AY2 A;  4UHO A;  1M0N A;  4PFF A;  1X2A A;  1FG7 A;  3KGX A;  2F8J A;  2D66 A;  3MAF B;  4EMY A;  2E7I A;  1V2F A;  2JIS A;  2OGE A;  5M4B A;  2CIN A;  3DC1 A;  1Z7D A;  2X8U A;  2ZSL A;  1AMR A;  1LK9 A;  1TOE A;  1GEW A;  2VLF A;  3FSL A;  3PGY A;  4ZWM A;  3BWN A;  1LKC A;  1IX8 A;  1ELQ A;  1KKP A;  1AIC A;  2VMW A;  4CVQ A;  1DGE A;  3EI8 A;  3RCH A;  3EI7 A;  3L44 A;  1CZC A;  3MBB A;  1DFO A;  3EIA A;  3RCH B;  1ZC9 A;  4ZWV A;  3AEJ C;  4OBV A;  3ATH A;  3RUY A;  1B5O A;  1WYT B;  4WB0 B;  5EUN A;  3E6G A;  3KE3 A;  4ITX A;  2BIE A;  3UWC A;  1AJS B;  2VGT A;  3FVS A;  1IX6 A;  2O1B A;  2W8J A;  1VEF A;  4ZLV A;  1ART A;  3II0 A;  2VMO A;  1KKJ A;  4WYC A;  1VP4 A;  4WYF A;  1I43 A;  4AO9 A;  4UHN A;  1AAM A;  5DB5 A;  4CXR A;  2CTZ A;  3FTB A;  5AX8 A;  1CL1 A;  3B8X A;  3FZ6 A;  2VGZ A;  1X29 A;  1GEY A;  2Z9W A;  3E9K A;  3HQT A;  3JWA A;  4DBC A;  3P1T A;  1ARG A;  2VMU A;  4ZAH A;  2BI5 A;  2HUF A;  1I29 A;  4JEX A;  3A8U X;  4O6Z A;  1H0C A;  3VK3 A;  2AY4 A;  5D95 A;  3ZRR A;  4XJO A;  5I92 A;  3ISL A;  4HF8 A;  4M2K A;  4WYE A;  3K40 A;  4MSO A;  4TMR A;  3RBF A;  1DKA A;  1ECX A;  1P3W A;  4MQR A;  4BHD A;  2BIA A;  4OT8 A;  3CQ4 A;  5G4I A;  3BWO A;  3L8A A;  3ACZ A;  3N0L A;  2ZP7 A;  1MLY A;  2OGA A;  4XJL A;  3QHX A;  1IUG A;  3LVL B;  1TOK A;  3NRA A;  1GEX A;  4XJP A;  3WCN A;  3AEM A;  2CJG A;  4P7Y A;  1IAY A;  4DGT A;  5FT5 A;  2ZY4 A;  1N2T A;  1AMS A;  3HDO A;  4A6T A;  2BI9 A;  1YJZ A;  3NTJ A;  3DRD A;  2WK9 A;  1WYU A;  3EZS A;  3TFT A;  1OXO A;  3AV7 A;  3TQX A;  3HT4 A;  1ZOD A;  2W7F A;  2D5Y A;  4N0B A;  1OHV A;  4M2M A;  2WK7 A;  1BS0 A;  2D65 A;  1D7U A;  1DJU A;  3EI5 A;  1TPL A;  2DGM A;  1XI9 A;  3PDB B;  2R2N A;  5EAV A;  4GRX A;  3VAX A;  2VMY A;  2G6W A;  3I4J A;  1Y4I A;  2QMA A;  2Z1Y A;  4R2N A;  1E5F A;  3W1H A;  1GC2 A;  4LW4 A;  4DQ6 A;  4WD2 A;  3M5U A;  4ZM4 A;  1U08 A;  1ASB A;  1G7W A;  2QB2 A;  1YOO A;  1QIR A;  1IBJ A;  2DKB A;  4U1T A;  3B1D A;  3COG A;  4M2J A;  2HOZ A;  1AY4 A;  2VMV A;  4WBT A; 
#chains in the Genus database with same CATH topology
 4UOY A;  3MC6 A;  1M6S A;  2VGU A;  2C7T A;  2GB3 A;  1AHF A;  2O0R A;  1W7L A;  2O7C A;  2EZ1 A;  8AAT A;  3E2Y A;  3PDX A;  3FZ8 A;  2FN6 A;  4JE5 D;  2YCN A;  4GE9 A;  3FDD A;  4XJM A;  2ZJG A;  3NDN A;  1MDZ A;  2BYJ A;  2VMS A;  4E1O A;  1V72 A;  3NU7 A;  3K28 A;  2PB0 A;  1EJI A;  4RJY A;  5EFS A;  3EI9 A;  5EUD A;  2DR1 A;  2C81 A;  3H14 A;  4GE4 A;  1KL2 A;  2Q7W A;  4ISY A;  2D7Z A;  2VGV A;  3FVU A;  3N4X A;  1AIA A;  1YAA A;  3WY7 A;  1AJS A;  1M0P A;  3PJ0 A;  1DJE A;  1CZE A;  1KL1 A;  1TOG A;  2NMP A;  2QB3 A;  1SZS A;  2CFB A;  2EO5 A;  1ARI A;  3GWP A;  3JW9 A;  3AOW A;  1KAF A;  3ELP A;  1DTY A;  1D7R A;  4F4E A;  1GC3 A;  4Q31 A;  1DJ9 A;  3UE8 A;  4ADD A;  4AZJ A;  2VIB A;  3ELE A;  1IVR A;  3MKJ A;  2YKY A;  4K2B A;  4Q76 A;  2YOB A;  4WXF A;  5EAA A;  4K05 A;  4FL0 A;  5K8B A;  1FG3 A;  2GMU A;  3BCX A;  1BQD A;  4JEY A;  3PD6 B;  3LVJ A;  1TOJ A;  2OKK A;  1O69 A;  1YNU A;  4OTL A;  1LW5 A;  3VP6 A;  4W1W A;  3UAK A;  2C0R A;  2Z9X A;  1B5P A;  2VI8 A;  3B1C A;  1GC4 A;  2Z9U A;  4JEW A;  2GMS A;  4P3M A;  1LC5 A;  2HOX A;  4W91 A;  4CBS A;  3AAT A;  2CY8 A;  4LW2 A;  5G2P A;  1AY8 A;  2BI2 A;  2Z9V A;  3LV2 A;  3I16 A;  1CQ7 A;  2AAT A;  4IXS A;  4BA5 A;  2PB2 A;  1M4N A;  2D61 A;  2EPJ A;  3F0H A;  4CBR A;  3CAI A;  2AEV A;  3WLX A;  4F5M A;  2KFP A;  5LHA A;  2OAT A;  2W8V A;  4ATP A;  3WGC A;  3KGW A;  1WKH A;  1ASN A;  3MEB A;  1MAP A;  1MLZ A;  3FQ7 A;  1CJ0 A;  2VMN A;  2VMP A;  4FFC A;  1C0N A;  4Y0H A;  2G7J A;  4Q6R A;  5DJ9 A;  1C7G A;  4A6U A;  1D7V A;  3HBX A;  4XEW A;  3DR4 A;  1AKB A;  2BI1 A;  1X0M A;  2R5C A;  1SPA A;  4W5K A;  1GCK A;  2FNI A;  5EUE A;  9AAT A;  4AH3 A;  1C7N A;  1BJN A;  3GZC A;  1IX7 A;  4BMK A;  4K2I A;  4WYG A;  5HHY A;  1LC7 A;  1G4V A;  1TOI A;  1Z3Z A;  2AEU A;  1PMM A;  2BYL A;  3F6T A;  5E4Z A;  1WYV B;  4BA4 A;  1LS3 A;  2BKW A;  1OXP A;  2V1P A;  4E3Q A;  3W1I A;  4LNL A;  5EQC A;  2CJD A;  3CQ6 A;  3NX3 A;  5BJ4 A;  1AKC A;  1TAT A;  1G7X A;  3ECD A;  3MAF A;  4WLH A;  1BKG A;  5J8Q A;  1UU1 A;  4JE5 A;  3IHJ A;  1O61 A;  2AY9 A;  2WB6 A;  3BN1 A;  2CH1 A;  4AZK A;  3OP7 A;  2X3L A;  1BT4 A;  3NYU A;  2YKV A;  4RM1 A;  4E77 A;  2WKA A;  1WST A;  2VMZ A;  1J04 A;  1YJY A;  3N4S A;  3TAT A;  3ASB A;  3BWN C;  1ZOB A;  2AY8 A;  4A0H A;  4H63 Q;  2D7Y A;  2W7E A;  2VYC A;  4W8I A;  3GSB A;  2PO3 A;  1AHY A;  3IF2 A;  4RKD A;  3D6K A;  3DR7 A;  4QGR A;  4W1V A;  3USF A;  1AY5 A;  3WX9 A;  5IWQ A;  2AY7 A;  1AAW A;  1PFF A;  1ASE A;  1PG8 A;  2YHK A;  1M0O A;  1S07 A;  3B46 A;  2R5C B;  1YJS A;  4RLG A;  3ZRQ A;  2W8W A;  1LW4 A;  4LC3 A;  5C6U A;  2ZY3 A;  3FQA A;  4W1X A;  4ZSY A;  4B98 A;  3ASA A;  3AEL A;  3GJU A;  1QGN A;  3TFU A;  3MAD A;  4ITG A;  1QIS A;  4KXK A;  3H7F A;  1UKJ A;  4ADB A;  3A9Y A;  3AEO A;  5G09 A;  1BW0 A;  2VIA A;  4RKC A;  1MDX A;  5BJ3 A;  4H51 A;  4KAM A;  2W7H A;  4Y0D A;  1CQ8 A;  5G4J A;  3LVM A;  5G0A A;  4A00 A;  4JF1 A;  3N7N A;  4F5H A;  1SFF A;  4AO4 A;  3QM2 A;  3T32 A;  4MKK A;  2HUU A;  4A72 A;  2YCT A;  2OQX A;  4ADE A;  3QI6 A;  4F5F A;  1CL2 A;  1ASC A;  4A0G A;  2JJH A;  1XEY A;  1RVY A;  5FT4 A;  2CB1 A;  3A9Z A;  5EIG A;  3FFH A;  1EQB A;  1M7Y A;  3JWB A;  3NUI A;  3BCB A;  4RAE A;  3GBX A;  4JEV A;  1V2D A;  3DYD A;  4UHM A;  1JS6 A;  1PMO A;  5EIG B;  4MQQ A;  3GR9 A;  4IXO A;  3RQ1 A;  5M49 A;  2FNU A;  1TAR A;  4WYA A;  4B9B A;  4XQ2 A;  3HL2 A;  2EYQ A;  1OHY A;  4R5Z A;  4A0R A;  1VJO A;  3G7Q A;  1KMK A;  3PIU A;  3QN6 A;  1BJW A;  1E5E A;  4WLJ A;  1O4S A;  1CS1 A;  1W7M A;  2AY5 A;  2ZUK A;  4RIT A;  1RV3 A;  1KMJ A;  3FKD A;  2DOU A;  1OHW A;  3FZ7 A;  2DKJ A;  1WYT A;  3AEJ A;  3LWS A;  4WB0 A;  2C44 A;  3I5T A;  4WP0 A;  2OKJ A;  2GQN A;  3PAA A;  4R8D A;  2Z1Z A;  2DGK A;  1ASD A;  1BJ4 A;  1BJO A;  1GDE A;  2BWN A;  5F8V A;  3BV0 A;  2YKU A;  4BQ0 A;  1I41 A;  1BJO B;  3OKS A;  2E7J A;  2HZP A;  3E2F A;  4HVK A;  3EUC A;  2HUI A;  1H1C A;  3K7Y A;  1MGV A;  3R9A A;  1G4X A;  2W8U A;  3EIB A;  4OYT A;  1QJ5 A;  3DOD A;  4IYO A;  4TV7 A;  1ASA A;  4EB7 A;  3G8M A;  3HLM A;  2EGY A;  3FVX A;  3GET A;  2JJF A;  3LY1 A;  4CXQ A;  1IAX A;  1V2E A;  3WZF A;  4F5K A;  3E77 A;  3FD0 A;  4EU1 A;  2A1V A;  4WXB A;  2YKX A;  2W7M A;  1M0Q A;  3NNK A;  4MGR A;  2JJE A;  5TF5 A;  3VK4 A;  1ASG A;  2DGL A;  3GZD A;  2W7L A;  4EB5 A;  3WKS A;  2HP2 A;  1S0A A;  3FCR A;  4OMA A;  3JTX A;  5E3K A;  3DXV A;  1AIB A;  3RI6 A;  1I48 A;  2QLR A;  2W7K A;  3QPG A;  1AKA A;  1QIT A;  2QA3 A;  3DU4 A;  4N0W A;  2W7D A;  2CH2 A;  1AX4 A;  1B8G A;  3AEN B;  3JU7 A;  4PVF A;  1AHX A;  4WYD A;  2ZSM A;  5M4D A;  1C9C A;  4EFF A;  4UQV A;  3TCM A;  3VK2 A;  2JGT A;  3NUB A;  1FC4 A;  1SVV A;  2D63 A;  2JG2 A;  2V0Y A;  4ZM3 A;  1MDO A;  1B9I A;  3WGB A;  1N8P A;  1J32 A;  4F5J A;  3F9T A;  4F5L A;  1OAT A;  4PFN A;  1UU0 A;  2HOY A;  3RBL A;  3PDB A;  3R4T A;  4ATQ A;  1MAQ A;  3QGU A;  1S06 A;  3GZD C;  3KKI A;  4WXG A;  2FKI A;  2CJH A;  3BS8 A;  3A9X A;  2HP1 A;  1N31 A;  3WCO A;  2VI9 A;  2AY1 A;  2ZY2 A;  1X28 A;  1O62 A;  2QBT A;  4JF0 A;  1SZK A;  1JG8 A;  1W3U A;  2XBN A;  1IJI A;  3CQ5 A;  4IW7 A;  3DXW A;  1ASL A;  2D64 A;  4JEZ A;  1LC8 A;  1JF9 A;  4PIW A;  1GC0 A;  3EI6 A;  4GE7 A;  4RJ0 A;  4ZSW A;  1AMA A;  3A2B A;  2ZC0 A;  4L0O A;  2Z61 A;  5M46 A;  1C4K A;  2ORD A;  1ARS A;  1ASM A;  2JJG A;  2VGS A;  4IX8 A;  4J5U A;  1S09 A;  4K2M A;  2CST A;  4LNM A;  3BB8 A;  4Q75 A;  5D5S A;  2W7I A;  2EH6 A;  7AAT A;  1QJ3 A;  2GSA A;  2CAN A;  1AJR A;  4XK1 A;  1WYV A;  1AMQ A;  3LG0 A;  4F5I A;  1DGD A;  4OC9 A;  3CBF A;  5HXX A;  3PPL A;  4LNJ A;  3ZZK A;  3E2Z B;  5DX5 A;  3FFR A;  2BWP A;  4GDY A;  2YRR A;  1CQ6 A;  4NOG A;  3AEM C;  3BCA A;  3MC6 C;  1W23 A;  2VLH A;  4U2H A;  4GSA A;  2VGW A;  2ZY5 A;  3W1J A;  5E5I A;  3WKR A;  2AY3 A;  1JS3 A;  3N75 A;  1D7S A;  4IXZ A;  1ASF A;  2VMR A;  3P6K A;  1EG5 A;  2HOR A;  2W7G A;  5FT6 A;  4ZDP A;  1BQA A;  3E2Z A;  3NYS A;  4I8A A;  1S08 A;  5FT8 A;  2Z20 A;  1ELU A;  2TPL A;  1QZ9 A;  4ZAS A;  1GD9 A;  1SF2 A;  1TAS A;  2R5E A;  4E3R A;  4RIZ A;  3NYT A;  2ZYJ A;  3FDB A;  4OBU A;  4OCA A;  1AHE A;  5F9S A;  4ZDL A;  3VOM A;  2FQ6 A;  3H9X A;  3QBO A;  4A0F A;  2RFV A;  1WKG A;  5HDM A;  2EZ2 A;  2XH1 A;  4GEB A;  3DZZ A;  1T3I A;  3N5M A;  2VMX A;  1ORD A;  1C7O A;  1SZU A;  1UU2 A;  1B4X A;  1GBN A;  2W8T A;  3HMU A;  4MY5 A;  4XAU A;  3ZZJ A;  1RV4 A;  2FYF A;  3FQ8 A;  5G2Q A;  2BIG A;  4R5F A;  3BC8 A;  5JAY A;  3LVK A;  3AOV A;  4J8L A;  3NU8 A;  2WK8 A;  2X5D A;  4IYO B;  1AHG A;  1B9H A;  2X5F A;  4F5G A;  3G0T A;  1W7N A;  4MQP A;  1YIZ A;  3AEN A;  3MAU A;  2BHX A;  2Z67 A;  2E54 A;  1YIY A;  4ADC A;  3PA9 A;  2E7U A;  4KYO A;  4Y0I A;  2VMQ A;  4A6R A;  2AY6 A;  4ZDO A;  2YCP A;  3AEP A;  4AOA A;  3EZ1 A;  2FM1 A;  3JZL A;  4IY7 A;  4TN4 A;  1D2F A;  3B1E A;  3FRK A;  3ZRP A;  2YRI A;  2BWO A;  2R0T A;  4MKJ A;  5LH9 A;  1M32 A;  1ARH A;  1RVU A;  2VMT A;  3PD6 A;  3HVY A;  2W7J A;  1WYU B;  5DJ1 A;  3Q8N A;  2BI3 A;  2AY2 A;  4UHO A;  1M0N A;  4PFF A;  1X2A A;  1FG7 A;  3KGX A;  2F8J A;  2D66 A;  3MAF B;  4EMY A;  2E7I A;  1V2F A;  2JIS A;  2OGE A;  5M4B A;  2CIN A;  3DC1 A;  1Z7D A;  2X8U A;  2ZSL A;  1AMR A;  1LK9 A;  1TOE A;  1GEW A;  2VLF A;  3FSL A;  3PGY A;  4ZWM A;  3BWN A;  1LKC A;  1IX8 A;  1ELQ A;  1KKP A;  1AIC A;  2VMW A;  4CVQ A;  5KTB A;  1DGE A;  3EI8 A;  3RCH A;  3EI7 A;  3L44 A;  1CZC A;  3MBB A;  1DFO A;  3EIA A;  3RCH B;  1ZC9 A;  4ZWV A;  3AEJ C;  4OBV A;  3ATH A;  3RUY A;  1B5O A;  1WYT B;  4WB0 B;  5EUN A;  3E6G A;  3KE3 A;  2QSR A;  4ITX A;  2BIE A;  3UWC A;  1AJS B;  2VGT A;  3FVS A;  1IX6 A;  2O1B A;  2W8J A;  1VEF A;  4ZLV A;  1ART A;  3II0 A;  2VMO A;  1KKJ A;  4WYC A;  1VP4 A;  4WYF A;  1I43 A;  4AO9 A;  3N4R A;  4UHN A;  1AAM A;  5DB5 A;  4CXR A;  2CTZ A;  3FTB A;  5AX8 A;  1CL1 A;  3B8X A;  3FZ6 A;  2VGZ A;  1X29 A;  1GEY A;  2Z9W A;  3E9K A;  3HQT A;  3JWA A;  4DBC A;  3P1T A;  1ARG A;  2VMU A;  4ZAH A;  2BI5 A;  2HUF A;  1I29 A;  4JEX A;  3A8U X;  4O6Z A;  1H0C A;  3VK3 A;  2AY4 A;  5D95 A;  3ZRR A;  4XJO A;  5I92 A;  3ISL A;  4HF8 A;  4M2K A;  4WYE A;  3K40 A;  4MSO A;  4TMR A;  3RBF A;  1DKA A;  1ECX A;  1P3W A;  4MQR A;  4BHD A;  2BIA A;  4OT8 A;  3CQ4 A;  5G4I A;  3BWO A;  3L8A A;  3ACZ A;  3N0L A;  2ZP7 A;  1MLY A;  2OGA A;  4XJL A;  3QHX A;  1IUG A;  3LVL B;  1TOK A;  3NRA A;  1GEX A;  4XJP A;  3WCN A;  3AEM A;  2CJG A;  4P7Y A;  1IAY A;  4DGT A;  5FT5 A;  2ZY4 A;  1N2T A;  1AMS A;  3HDO A;  4A6T A;  2BI9 A;  1YJZ A;  3NTJ A;  3DRD A;  2WK9 A;  1WYU A;  3EZS A;  3TFT A;  1OXO A;  3AV7 A;  3TQX A;  3HT4 A;  1ZOD A;  2W7F A;  2D5Y A;  4N0B A;  1OHV A;  4M2M A;  2WK7 A;  1BS0 A;  2D65 A;  1D7U A;  1DJU A;  3EI5 A;  1TPL A;  2DGM A;  1XI9 A;  3PDB B;  2R2N A;  5EAV A;  4GRX A;  3VAX A;  2VMY A;  2G6W A;  3I4J A;  1Y4I A;  2QMA A;  2Z1Y A;  4R2N A;  1E5F A;  3W1H A;  1GC2 A;  4LW4 A;  4DQ6 A;  4WD2 A;  3M5U A;  4ZM4 A;  1U08 A;  1ASB A;  1G7W A;  2QB2 A;  1YOO A;  1QIR A;  1IBJ A;  2DKB A;  4U1T A;  3B1D A;  3COG A;  4M2J A;  2HOZ A;  1AY4 A;  2VMV A;  4WBT A; 
#chains in the Genus database with same CATH homology
 4UOY A;  3MC6 A;  1M6S A;  2VGU A;  2C7T A;  2GB3 A;  1AHF A;  2O0R A;  1W7L A;  2O7C A;  2EZ1 A;  8AAT A;  3E2Y A;  3PDX A;  3FZ8 A;  2FN6 A;  4JE5 D;  2YCN A;  4GE9 A;  3FDD A;  4XJM A;  2ZJG A;  3NDN A;  1MDZ A;  2BYJ A;  2VMS A;  4E1O A;  1V72 A;  3NU7 A;  3K28 A;  2PB0 A;  1EJI A;  4RJY A;  5EFS A;  3EI9 A;  5EUD A;  2DR1 A;  2C81 A;  3H14 A;  4GE4 A;  1KL2 A;  2Q7W A;  4ISY A;  2D7Z A;  2VGV A;  3FVU A;  3N4X A;  1AIA A;  1YAA A;  3WY7 A;  1AJS A;  1M0P A;  3PJ0 A;  1DJE A;  1CZE A;  1KL1 A;  1TOG A;  2NMP A;  2QB3 A;  1SZS A;  2CFB A;  2EO5 A;  1ARI A;  3GWP A;  3JW9 A;  3AOW A;  3ELP A;  1DTY A;  1D7R A;  4F4E A;  1GC3 A;  4Q31 A;  1DJ9 A;  3UE8 A;  4ADD A;  4AZJ A;  2VIB A;  3ELE A;  1IVR A;  3MKJ A;  2YKY A;  4K2B A;  4Q76 A;  2YOB A;  4WXF A;  5EAA A;  4K05 A;  4FL0 A;  5K8B A;  1FG3 A;  2GMU A;  3BCX A;  1BQD A;  4JEY A;  3PD6 B;  3LVJ A;  1TOJ A;  2OKK A;  1O69 A;  1YNU A;  4OTL A;  1LW5 A;  3VP6 A;  4W1W A;  3UAK A;  2C0R A;  2Z9X A;  1B5P A;  2VI8 A;  3B1C A;  1GC4 A;  2Z9U A;  4JEW A;  2GMS A;  4P3M A;  1LC5 A;  2HOX A;  4W91 A;  4CBS A;  3AAT A;  2CY8 A;  4LW2 A;  5G2P A;  1AY8 A;  2BI2 A;  2Z9V A;  3LV2 A;  3I16 A;  1CQ7 A;  2AAT A;  4IXS A;  4BA5 A;  2PB2 A;  1M4N A;  2D61 A;  2EPJ A;  3F0H A;  4CBR A;  3CAI A;  2AEV A;  3WLX A;  4F5M A;  2KFP A;  5LHA A;  2OAT A;  2W8V A;  4ATP A;  3WGC A;  3KGW A;  1WKH A;  1ASN A;  3MEB A;  1MAP A;  1MLZ A;  3FQ7 A;  1CJ0 A;  2VMN A;  2VMP A;  4FFC A;  1C0N A;  4Y0H A;  2G7J A;  4Q6R A;  5DJ9 A;  1C7G A;  4A6U A;  1D7V A;  3HBX A;  4XEW A;  3DR4 A;  1AKB A;  2BI1 A;  1X0M A;  2R5C A;  1SPA A;  4W5K A;  1GCK A;  2FNI A;  5EUE A;  9AAT A;  4AH3 A;  1C7N A;  1BJN A;  3GZC A;  1IX7 A;  4BMK A;  4K2I A;  4WYG A;  5HHY A;  1LC7 A;  1G4V A;  1TOI A;  1Z3Z A;  2AEU A;  1PMM A;  2BYL A;  3F6T A;  5E4Z A;  1WYV B;  4BA4 A;  1LS3 A;  2BKW A;  1OXP A;  2V1P A;  4E3Q A;  3W1I A;  4LNL A;  5EQC A;  2CJD A;  3CQ6 A;  3NX3 A;  5BJ4 A;  1AKC A;  1TAT A;  1G7X A;  3ECD A;  3MAF A;  4WLH A;  1BKG A;  5J8Q A;  1UU1 A;  4JE5 A;  3IHJ A;  1O61 A;  2AY9 A;  2WB6 A;  3BN1 A;  2CH1 A;  4AZK A;  3OP7 A;  2X3L A;  1BT4 A;  3NYU A;  2YKV A;  4RM1 A;  4E77 A;  2WKA A;  1WST A;  2VMZ A;  1J04 A;  1YJY A;  3N4S A;  3TAT A;  3ASB A;  3BWN C;  1ZOB A;  2AY8 A;  4A0H A;  4H63 Q;  2D7Y A;  2W7E A;  2VYC A;  4W8I A;  3GSB A;  2PO3 A;  1AHY A;  3IF2 A;  4RKD A;  3D6K A;  3DR7 A;  4QGR A;  4W1V A;  3USF A;  1AY5 A;  3WX9 A;  5IWQ A;  2AY7 A;  1AAW A;  1PFF A;  1ASE A;  1PG8 A;  2YHK A;  1M0O A;  1S07 A;  3B46 A;  2R5C B;  1YJS A;  4RLG A;  3ZRQ A;  2W8W A;  1LW4 A;  4LC3 A;  5C6U A;  2ZY3 A;  3FQA A;  4W1X A;  4ZSY A;  4B98 A;  3ASA A;  3AEL A;  3GJU A;  1QGN A;  3TFU A;  3MAD A;  4ITG A;  1QIS A;  4KXK A;  3H7F A;  1UKJ A;  4ADB A;  3A9Y A;  3AEO A;  5G09 A;  1BW0 A;  2VIA A;  4RKC A;  1MDX A;  5BJ3 A;  4H51 A;  4KAM A;  2W7H A;  4Y0D A;  1CQ8 A;  5G4J A;  3LVM A;  5G0A A;  4A00 A;  4JF1 A;  3N7N A;  4F5H A;  1SFF A;  4AO4 A;  3QM2 A;  3T32 A;  4MKK A;  2HUU A;  4A72 A;  2YCT A;  2OQX A;  4ADE A;  3QI6 A;  4F5F A;  1CL2 A;  1ASC A;  4A0G A;  2JJH A;  1XEY A;  1RVY A;  5FT4 A;  2CB1 A;  3A9Z A;  5EIG A;  3FFH A;  1EQB A;  1M7Y A;  3JWB A;  3NUI A;  3BCB A;  4RAE A;  3GBX A;  4JEV A;  1V2D A;  3DYD A;  4UHM A;  1JS6 A;  1PMO A;  5EIG B;  4MQQ A;  3GR9 A;  4IXO A;  3RQ1 A;  5M49 A;  2FNU A;  1TAR A;  4WYA A;  4B9B A;  4XQ2 A;  3HL2 A;  2EYQ A;  1OHY A;  4R5Z A;  4A0R A;  1VJO A;  3G7Q A;  1KMK A;  3PIU A;  3QN6 A;  1BJW A;  1E5E A;  4WLJ A;  1O4S A;  1CS1 A;  1W7M A;  2AY5 A;  2ZUK A;  4RIT A;  1RV3 A;  1KMJ A;  3FKD A;  2DOU A;  1OHW A;  3FZ7 A;  2DKJ A;  1WYT A;  3AEJ A;  3LWS A;  4WB0 A;  2C44 A;  3I5T A;  4WP0 A;  2OKJ A;  2GQN A;  3PAA A;  4R8D A;  2Z1Z A;  2DGK A;  1ASD A;  1BJ4 A;  1BJO A;  1GDE A;  2BWN A;  5F8V A;  3BV0 A;  2YKU A;  4BQ0 A;  1I41 A;  1BJO B;  3OKS A;  2E7J A;  2HZP A;  3E2F A;  4HVK A;  3EUC A;  2HUI A;  1H1C A;  3K7Y A;  1MGV A;  3R9A A;  1G4X A;  2W8U A;  3EIB A;  4OYT A;  1QJ5 A;  3DOD A;  4IYO A;  4TV7 A;  1ASA A;  4EB7 A;  3G8M A;  3HLM A;  2EGY A;  3FVX A;  3GET A;  2JJF A;  3LY1 A;  4CXQ A;  1IAX A;  1V2E A;  3WZF A;  4F5K A;  3E77 A;  3FD0 A;  4EU1 A;  2A1V A;  4WXB A;  2YKX A;  2W7M A;  1M0Q A;  3NNK A;  4MGR A;  2JJE A;  5TF5 A;  3VK4 A;  1ASG A;  2DGL A;  3GZD A;  2W7L A;  4EB5 A;  3WKS A;  2HP2 A;  1S0A A;  3FCR A;  4OMA A;  3JTX A;  5E3K A;  3DXV A;  1AIB A;  3RI6 A;  1I48 A;  2QLR A;  2W7K A;  3QPG A;  1AKA A;  1QIT A;  2QA3 A;  3DU4 A;  4N0W A;  2W7D A;  2CH2 A;  1AX4 A;  1B8G A;  3AEN B;  3JU7 A;  4PVF A;  1AHX A;  4WYD A;  2ZSM A;  5M4D A;  1C9C A;  4EFF A;  4UQV A;  3TCM A;  3VK2 A;  2JGT A;  3NUB A;  1FC4 A;  1SVV A;  2D63 A;  2JG2 A;  2V0Y A;  4ZM3 A;  1MDO A;  1B9I A;  3WGB A;  1N8P A;  1J32 A;  4F5J A;  3F9T A;  4F5L A;  1OAT A;  4PFN A;  1UU0 A;  2HOY A;  3RBL A;  3PDB A;  3R4T A;  4ATQ A;  1MAQ A;  3QGU A;  1S06 A;  3GZD C;  3KKI A;  4WXG A;  2FKI A;  2CJH A;  3BS8 A;  3A9X A;  2HP1 A;  1N31 A;  3WCO A;  2VI9 A;  2AY1 A;  2ZY2 A;  1X28 A;  1O62 A;  2QBT A;  4JF0 A;  1SZK A;  1JG8 A;  1W3U A;  2XBN A;  1IJI A;  3CQ5 A;  4IW7 A;  3DXW A;  1ASL A;  2D64 A;  4JEZ A;  1LC8 A;  1JF9 A;  4PIW A;  1GC0 A;  3EI6 A;  4GE7 A;  4RJ0 A;  4ZSW A;  1AMA A;  3A2B A;  2ZC0 A;  4L0O A;  2Z61 A;  5M46 A;  1C4K A;  2ORD A;  1ARS A;  1ASM A;  2JJG A;  2VGS A;  4IX8 A;  4J5U A;  1S09 A;  4K2M A;  2CST A;  4LNM A;  3BB8 A;  4Q75 A;  5D5S A;  2W7I A;  2EH6 A;  7AAT A;  1QJ3 A;  2GSA A;  2CAN A;  1AJR A;  4XK1 A;  1WYV A;  1AMQ A;  3LG0 A;  4F5I A;  1DGD A;  4OC9 A;  3CBF A;  5HXX A;  3PPL A;  4LNJ A;  3ZZK A;  3E2Z B;  5DX5 A;  3FFR A;  2BWP A;  4GDY A;  2YRR A;  1CQ6 A;  4NOG A;  3AEM C;  3BCA A;  3MC6 C;  1W23 A;  2VLH A;  4U2H A;  4GSA A;  2VGW A;  2ZY5 A;  3W1J A;  5E5I A;  3WKR A;  2AY3 A;  1JS3 A;  3N75 A;  1D7S A;  4IXZ A;  1ASF A;  2VMR A;  3P6K A;  1EG5 A;  2HOR A;  2W7G A;  5FT6 A;  4ZDP A;  1BQA A;  3E2Z A;  3NYS A;  4I8A A;  1S08 A;  5FT8 A;  2Z20 A;  1ELU A;  2TPL A;  1QZ9 A;  4ZAS A;  1GD9 A;  1SF2 A;  1TAS A;  2R5E A;  4E3R A;  4RIZ A;  3NYT A;  2ZYJ A;  3FDB A;  4OBU A;  4OCA A;  1AHE A;  5F9S A;  4ZDL A;  3VOM A;  2FQ6 A;  3H9X A;  3QBO A;  4A0F A;  2RFV A;  1WKG A;  5HDM A;  2EZ2 A;  2XH1 A;  4GEB A;  3DZZ A;  1T3I A;  3N5M A;  2VMX A;  1ORD A;  1C7O A;  1SZU A;  1UU2 A;  1B4X A;  1GBN A;  2W8T A;  3HMU A;  4MY5 A;  4XAU A;  3ZZJ A;  1RV4 A;  2FYF A;  3FQ8 A;  5G2Q A;  2BIG A;  4R5F A;  3BC8 A;  5JAY A;  3LVK A;  3AOV A;  4J8L A;  3NU8 A;  2WK8 A;  2X5D A;  4IYO B;  1AHG A;  1B9H A;  2X5F A;  4F5G A;  3G0T A;  1W7N A;  4MQP A;  1YIZ A;  3AEN A;  3MAU A;  2BHX A;  2Z67 A;  2E54 A;  1YIY A;  4ADC A;  3PA9 A;  2E7U A;  4KYO A;  4Y0I A;  2VMQ A;  4A6R A;  2AY6 A;  4ZDO A;  2YCP A;  3AEP A;  4AOA A;  3EZ1 A;  2FM1 A;  3JZL A;  4IY7 A;  4TN4 A;  1D2F A;  3B1E A;  3FRK A;  3ZRP A;  2YRI A;  2BWO A;  2R0T A;  4MKJ A;  5LH9 A;  1M32 A;  1ARH A;  1RVU A;  2VMT A;  3PD6 A;  3HVY A;  2W7J A;  1WYU B;  5DJ1 A;  3Q8N A;  2BI3 A;  2AY2 A;  4UHO A;  1M0N A;  4PFF A;  1X2A A;  1FG7 A;  3KGX A;  2F8J A;  2D66 A;  3MAF B;  4EMY A;  2E7I A;  1V2F A;  2JIS A;  2OGE A;  5M4B A;  2CIN A;  3DC1 A;  1Z7D A;  2X8U A;  2ZSL A;  1AMR A;  1LK9 A;  1TOE A;  1GEW A;  2VLF A;  3FSL A;  3PGY A;  4ZWM A;  3BWN A;  1LKC A;  1IX8 A;  1ELQ A;  1KKP A;  1AIC A;  2VMW A;  4CVQ A;  5KTB A;  1DGE A;  3EI8 A;  3RCH A;  3EI7 A;  3L44 A;  1CZC A;  3MBB A;  1DFO A;  3EIA A;  3RCH B;  1ZC9 A;  4ZWV A;  3AEJ C;  4OBV A;  3ATH A;  3RUY A;  1B5O A;  1WYT B;  4WB0 B;  5EUN A;  3E6G A;  3KE3 A;  2QSR A;  4ITX A;  2BIE A;  3UWC A;  1AJS B;  2VGT A;  3FVS A;  1IX6 A;  2O1B A;  2W8J A;  1VEF A;  4ZLV A;  1ART A;  3II0 A;  2VMO A;  1KKJ A;  4WYC A;  1VP4 A;  4WYF A;  1I43 A;  4AO9 A;  3N4R A;  4UHN A;  1AAM A;  5DB5 A;  4CXR A;  2CTZ A;  3FTB A;  5AX8 A;  1CL1 A;  3B8X A;  3FZ6 A;  2VGZ A;  1X29 A;  1GEY A;  2Z9W A;  3E9K A;  3HQT A;  3JWA A;  4DBC A;  3P1T A;  1ARG A;  2VMU A;  4ZAH A;  2BI5 A;  2HUF A;  1I29 A;  4JEX A;  3A8U X;  4O6Z A;  1H0C A;  3VK3 A;  2AY4 A;  5D95 A;  3ZRR A;  4XJO A;  5I92 A;  3ISL A;  4HF8 A;  4M2K A;  4WYE A;  3K40 A;  4MSO A;  4TMR A;  3RBF A;  1DKA A;  1ECX A;  1P3W A;  4MQR A;  4BHD A;  2BIA A;  4OT8 A;  3CQ4 A;  5G4I A;  3BWO A;  3L8A A;  3ACZ A;  3N0L A;  2ZP7 A;  1MLY A;  2OGA A;  4XJL A;  3QHX A;  1IUG A;  3LVL B;  1TOK A;  3NRA A;  1GEX A;  4XJP A;  3WCN A;  3AEM A;  2CJG A;  4P7Y A;  1IAY A;  4DGT A;  5FT5 A;  2ZY4 A;  1N2T A;  1AMS A;  3HDO A;  4A6T A;  2BI9 A;  1YJZ A;  3NTJ A;  3DRD A;  2WK9 A;  1WYU A;  3EZS A;  3TFT A;  1OXO A;  3AV7 A;  3TQX A;  3HT4 A;  1ZOD A;  2W7F A;  2D5Y A;  4N0B A;  1OHV A;  4M2M A;  2WK7 A;  1BS0 A;  2D65 A;  1D7U A;  1DJU A;  3EI5 A;  1TPL A;  2DGM A;  1XI9 A;  3PDB B;  2R2N A;  5EAV A;  4GRX A;  3VAX A;  2VMY A;  2G6W A;  3I4J A;  1Y4I A;  2QMA A;  2Z1Y A;  4R2N A;  1E5F A;  3W1H A;  1GC2 A;  4LW4 A;  4DQ6 A;  4WD2 A;  3M5U A;  4ZM4 A;  1U08 A;  1ASB A;  1G7W A;  2QB2 A;  1YOO A;  1QIR A;  1IBJ A;  2DKB A;  4U1T A;  3B1D A;  3COG A;  4M2J A;  2HOZ A;  1AY4 A;  2VMV A;  4WBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...